[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ54462.1


[Show Plain Result]

## Summary of Sequence Search
   1::1210
  36::399  1.7e-73 36.1% 0052548 00525481 1/1   p containing nucleoside triphosphate hy 
 602::892  3.6e-63 27.8% 0051486 00514861 1/1   p containing nucleoside triphosphate hy 
 578::837  1.8e-62 35.0% 0038162 00381621 1/2   p containing nucleoside triphosphate hy 
 602::838  5.7e-56 30.1% 0038141 00381411 1/2   p containing nucleoside triphosphate hy 
 836::1046 2.7e-54 33.6% 0052549 00525493 3/3   p containing nucleoside triphosphate hy 
 705::987  3.8e-54 27.3% 0050677 00506771 1/1   p containing nucleoside triphosphate hy 
 602::838  6.6e-54 30.7% 0038151 00381511 1/2   p containing nucleoside triphosphate hy 
 603::837  8.8e-51 28.8% 0052547 00525471 1/2   p containing nucleoside triphosphate hy 
 669::980  5.3e-50 28.0% 0052004 00520041 1/1   p containing nucleoside triphosphate hy 
 650::833  3.1e-46 37.2% 0035848 00358482 2/3   p containing nucleoside triphosphate hy 
  52::345  2.3e-44 35.3% 0035848 00358481 1/3   p containing nucleoside triphosphate hy 
 678::1040 3.5e-42 27.7% 0038163 00381631 1/1   p containing nucleoside triphosphate hy 
  22::348  6.1e-40 33.5% 0036317 00363171 1/3   p containing nucleoside triphosphate hy 
 636::829  1.1e-38 33.0% 0043258 00432581 1/2   p containing nucleoside triphosphate hy 
 646::914  1.9e-38 28.7% 0051499 00514991 1/1   p containing nucleoside triphosphate hy 
 829::1111 1.2e-37 23.9% 0051332 00513321 1/1   p containing nucleoside triphosphate hy 
 647::833  1.8e-37 37.2% 0036317 00363172 2/3   p containing nucleoside triphosphate hy 
 777::977  2.3e-37 28.6% 0052795 00527952 2/2   p containing nucleoside triphosphate hy 
 579::984  2.8e-37 24.3% 0041442 00414421 1/1   p containing nucleoside triphosphate hy 
1043::1205 6.4e-37 34.8% 0052550 00525501 1/1   domain-like                             
 588::818  3.1e-36 27.8% 0052796 00527961 1/1   p containing nucleoside triphosphate hy 
 776::1044 4.9e-35 31.4% 0051485 00514851 1/1   p containing nucleoside triphosphate hy 
 635::836    1e-32 23.4% 0042553 00425531 1/2   p containing nucleoside triphosphate hy 
 635::835  1.4e-30 26.6% 0043901 00439011 1/2   p containing nucleoside triphosphate hy 
 600::836  1.5e-30 26.0% 0048111 00481111 1/1   p containing nucleoside triphosphate hy 
 650::853  2.5e-30 31.6% 0050676 00506761 1/2   p containing nucleoside triphosphate hy 
 832::1013 8.5e-30 31.0% 0053147 00531472 2/2   p containing nucleoside triphosphate hy 
 834::1018 1.4e-29 29.8% 0049301 00493012 2/2   p containing nucleoside triphosphate hy 
 835::1007 6.1e-29 26.4% 0052823 00528232 2/2   p containing nucleoside triphosphate hy 
 776::1023 6.4e-29 24.7% 0051498 00514981 1/1   p containing nucleoside triphosphate hy 
 632::837  1.8e-28 25.5% 0038740 00387401 1/2   p containing nucleoside triphosphate hy 
 836::1037 2.1e-28 25.4% 0042089 00420892 2/2   p containing nucleoside triphosphate hy 
 625::837  1.4e-27 23.0% 0052855 00528551 1/2   p containing nucleoside triphosphate hy 
 810::1040 7.9e-27 24.2% 0036155 00361551 1/1   p containing nucleoside triphosphate hy 
 619::837  1.9e-25 23.6% 0053146 00531461 1/2   p containing nucleoside triphosphate hy 
 635::837  4.2e-25 26.0% 0049300 00493001 1/2   p containing nucleoside triphosphate hy 
 839::1019 1.6e-24 28.0% 0043887 00438872 2/2   p containing nucleoside triphosphate hy 
 626::833  1.7e-24 23.4% 0042720 00427201 1/2   p containing nucleoside triphosphate hy 
 840::1015 5.1e-24 24.1% 0038142 00381422 2/2   p containing nucleoside triphosphate hy 
 810::1017 1.8e-23 27.7% 0034833 00348331 1/1   p containing nucleoside triphosphate hy 
 844::975  2.7e-23 33.3% 0035848 00358483 3/3   p containing nucleoside triphosphate hy 
 857::1025 3.4e-23 28.1% 0035849 00358492 2/2   p containing nucleoside triphosphate hy 
 840::1014 6.5e-22 25.3% 0037787 00377872 2/2   p containing nucleoside triphosphate hy 
 857::1012 7.8e-22 26.0% 0036318 00363182 2/2   p containing nucleoside triphosphate hy 
 672::817  8.4e-20 25.4% 0051331 00513311 1/1   p containing nucleoside triphosphate hy 
 655::802  9.2e-20 28.0% 0050356 00503561 1/1   p containing nucleoside triphosphate hy 
 633::834  1.4e-19 23.4% 0044714 00447141 1/2   p containing nucleoside triphosphate hy 
 839::996  1.6e-19 21.3% 0038741 00387412 2/2   p containing nucleoside triphosphate hy 
 519::602    3e-19 47.4% 0052545 00525451 1/1   like                                    
 833::986  4.5e-19 22.0% 0041443 00414432 2/2   p containing nucleoside triphosphate hy 
 834::986  3.6e-18 23.5% 0040826 00408262 2/2   p containing nucleoside triphosphate hy 
 677::839  4.5e-18 31.9% 0038142 00381421 1/2   p containing nucleoside triphosphate hy 
 634::837  7.9e-18 26.3% 0042088 00420881 1/2   p containing nucleoside triphosphate hy 
 832::977    4e-17 25.9% 0039715 00397151 1/1   p containing nucleoside triphosphate hy 
 854::962    1e-16 32.1% 0052547 00525472 2/2   p containing nucleoside triphosphate hy 
 407::521  4.6e-16 29.8% 0052546 00525461 1/1   p containing nucleoside triphosphate hy 
 678::792  4.9e-16 34.8% 0052549 00525492 2/3   p containing nucleoside triphosphate hy 
 838::961    1e-15 26.6% 0036317 00363173 3/3   p containing nucleoside triphosphate hy 
 855::972    2e-15 24.1% 0038141 00381412 2/2   p containing nucleoside triphosphate hy 
 855::972    3e-15 21.6% 0038151 00381512 2/2   p containing nucleoside triphosphate hy 
 615::836  5.3e-15 21.2% 0050691 00506911 1/2   p containing nucleoside triphosphate hy 
 835::980  3.7e-14 27.0% 0042720 00427202 2/2   p containing nucleoside triphosphate hy 
 677::767  7.3e-14 36.8% 0036318 00363181 1/2   p containing nucleoside triphosphate hy 
 854::964  1.1e-13 24.3% 0038162 00381622 2/2   p containing nucleoside triphosphate hy 
 854::977  5.1e-13 30.4% 0043901 00439012 2/2   p containing nucleoside triphosphate hy 
 854::976  8.1e-13 30.9% 0042553 00425532 2/2   p containing nucleoside triphosphate hy 
 679::785  2.2e-12 30.4% 0038741 00387411 1/2   p containing nucleoside triphosphate hy 
 854::976  2.5e-12 29.4% 0038740 00387402 2/2   p containing nucleoside triphosphate hy 
 678::767  2.8e-12 33.3% 0037787 00377871 1/2   p containing nucleoside triphosphate hy 
 682::815  2.9e-12 28.6% 0034832 00348321 1/1   p containing nucleoside triphosphate hy 
 847::972  3.2e-12 27.4% 0042088 00420882 2/2   p containing nucleoside triphosphate hy 
 677::787  6.2e-12 32.0% 0043887 00438871 1/2   p containing nucleoside triphosphate hy 
 676::768  2.4e-11 33.0% 0042089 00420891 1/2   p containing nucleoside triphosphate hy 
 677::767  2.4e-11 35.6% 0035849 00358491 1/2   p containing nucleoside triphosphate hy 
 855::976  8.9e-10 27.8% 0044714 00447142 2/2   p containing nucleoside triphosphate hy 
 856::978  2.7e-09 19.8% 0043258 00432582 2/2   p containing nucleoside triphosphate hy 
 644::770  8.7e-05 31.8% 0052795 00527951 1/2   p containing nucleoside triphosphate hy 
 674::768  0.00015 31.0% 0052823 00528231 1/2   p containing nucleoside triphosphate hy 
 375::498  0.00041 24.6% 0047329 00473291 1/1   nosyl-L-methionine-dependent methyltran 
 664::921  0.00042 17.1% 0049491 00494911 1/1   p containing nucleoside triphosphate hy 
 635::860  0.00052 21.0% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
 865::947    0.031 24.1% 0049300 00493002 2/2   p containing nucleoside triphosphate hy 
 675::768    0.035 26.1% 0053147 00531471 1/2   p containing nucleoside triphosphate hy 
 854::946     0.11 20.5% 0050676 00506762 2/2   p containing nucleoside triphosphate hy 
 687::767     0.27 26.7% 0041443 00414431 1/2   p containing nucleoside triphosphate hy 
 855::948      0.4 22.2% 0053146 00531462 2/2   p containing nucleoside triphosphate hy 
 855::948     0.74 22.0% 0052855 00528552 2/2   p containing nucleoside triphosphate hy 
 673::767      3.7 24.4% 0049301 00493011 1/2   p containing nucleoside triphosphate hy 
 414::463      3.8 24.0% 0052549 00525491 1/3   p containing nucleoside triphosphate hy 
 677::767       24 31.7% 0040826 00408261 1/2   p containing nucleoside triphosphate hy 
 894::948       35 31.4% 0050691 00506912 2/2   p containing nucleoside triphosphate hy 
   1::1210


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPHVLRPLRAGRPSSHAPPGDMSLNGLLSVVTGDPALKRAIETARNGHDPLLDLVAPPSVRPLIVAGLAA
00525481   1/1  -----------------------------------ailellegllkggkrqlllgltgsakalllaalae
00514861   1/1  ----------------------------------------------------------------------
00381621   1/2  ----------------------------------------------------------------------
00381411   1/2  ----------------------------------------------------------------------
00525493   3/3  ----------------------------------------------------------------------
00506771   1/1  ----------------------------------------------------------------------
00381511   1/2  ----------------------------------------------------------------------
00525471   1/2  ----------------------------------------------------------------------
00520041   1/1  ----------------------------------------------------------------------
00358482   2/3  ----------------------------------------------------------------------
00358481   1/3  ---------------------------------------------------lkalgpfeltpiQqeaipa
00381631   1/1  ----------------------------------------------------------------------
00363171   1/3  ---------------------ikplklispfeprpyQqeaiealleglekgkknvllvgptGtGKTltaa
00432581   1/2  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00513321   1/1  ----------------------------------------------------------------------
00363172   2/3  ----------------------------------------------------------------------
00527952   2/2  ----------------------------------------------------------------------
00414421   1/1  ----------------------------------------------------------------------
00525501   1/1  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00514851   1/1  ----------------------------------------------------------------------
00425531   1/2  ----------------------------------------------------------------------
00439011   1/2  ----------------------------------------------------------------------
00481111   1/1  ----------------------------------------------------------------------
00506761   1/2  ----------------------------------------------------------------------
00531472   2/2  ----------------------------------------------------------------------
00493012   2/2  ----------------------------------------------------------------------
00528232   2/2  ----------------------------------------------------------------------
00514981   1/1  ----------------------------------------------------------------------
00387401   1/2  ----------------------------------------------------------------------
00420892   2/2  ----------------------------------------------------------------------
00528551   1/2  ----------------------------------------------------------------------
00361551   1/1  ----------------------------------------------------------------------
00531461   1/2  ----------------------------------------------------------------------
00493001   1/2  ----------------------------------------------------------------------
00438872   2/2  ----------------------------------------------------------------------
00427201   1/2  ----------------------------------------------------------------------
00381422   2/2  ----------------------------------------------------------------------
00348331   1/1  ----------------------------------------------------------------------
00358483   3/3  ----------------------------------------------------------------------
00358492   2/2  ----------------------------------------------------------------------
00377872   2/2  ----------------------------------------------------------------------
00363182   2/2  ----------------------------------------------------------------------
00513311   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00447141   1/2  ----------------------------------------------------------------------
00387412   2/2  ----------------------------------------------------------------------
00525451   1/1  ----------------------------------------------------------------------
00414432   2/2  ----------------------------------------------------------------------
00408262   2/2  ----------------------------------------------------------------------
00381421   1/2  ----------------------------------------------------------------------
00420881   1/2  ----------------------------------------------------------------------
00397151   1/1  ----------------------------------------------------------------------
00525472   2/2  ----------------------------------------------------------------------
00525461   1/1  ----------------------------------------------------------------------
00525492   2/3  ----------------------------------------------------------------------
00363173   3/3  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00506911   1/2  ----------------------------------------------------------------------
00427202   2/2  ----------------------------------------------------------------------
00363181   1/2  ----------------------------------------------------------------------
00381622   2/2  ----------------------------------------------------------------------
00439012   2/2  ----------------------------------------------------------------------
00425532   2/2  ----------------------------------------------------------------------
00387411   1/2  ----------------------------------------------------------------------
00387402   2/2  ----------------------------------------------------------------------
00377871   1/2  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00420882   2/2  ----------------------------------------------------------------------
00438871   1/2  ----------------------------------------------------------------------
00420891   1/2  ----------------------------------------------------------------------
00358491   1/2  ----------------------------------------------------------------------
00447142   2/2  ----------------------------------------------------------------------
00432582   2/2  ----------------------------------------------------------------------
00527951   1/2  ----------------------------------------------------------------------
00528231   1/2  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00493002   2/2  ----------------------------------------------------------------------
00531471   1/2  ----------------------------------------------------------------------
00506762   2/2  ----------------------------------------------------------------------
00414431   1/2  ----------------------------------------------------------------------
00531462   2/2  ----------------------------------------------------------------------
00528552   2/2  ----------------------------------------------------------------------
00493011   1/2  ----------------------------------------------------------------------
00525491   1/3  ----------------------------------------------------------------------
00408261   1/2  ----------------------------------------------------------------------
00506912   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           DAPVGAGRPVLALTATEREAADLNSALGSLLPADSVALFPAWETLPHERLSPRSDTVGQRLAVLRRLTHP
00525481   1/1  el....grpllvvtpnkteaaqlyselkfflpd.avlyfPawdtlpyddlspnpeivalRlsaLsaLler
00514861   1/1  ----------------------------------------------------------------------
00381621   1/2  ----------------------------------------------------------------------
00381411   1/2  ----------------------------------------------------------------------
00525493   3/3  ----------------------------------------------------------------------
00506771   1/1  ----------------------------------------------------------------------
00381511   1/2  ----------------------------------------------------------------------
00525471   1/2  ----------------------------------------------------------------------
00520041   1/1  ----------------------------------------------------------------------
00358482   2/3  ----------------------------------------------------------------------
00358481   1/3  ileglesgprdvllvgptGtGKTltaaalalel....gkqvlvlaptrelaeqlaeelrelfpelpvilf
00381631   1/1  ----------------------------------------------------------------------
00363171   1/3  alaael....gkpvlivaptkeladqlyeelkkllpelkvellhggldylqkealfpeidtlpykdaspn
00432581   1/2  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00513321   1/1  ----------------------------------------------------------------------
00363172   2/3  ----------------------------------------------------------------------
00527952   2/2  ----------------------------------------------------------------------
00414421   1/1  ----------------------------------------------------------------------
00525501   1/1  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00514851   1/1  ----------------------------------------------------------------------
00425531   1/2  ----------------------------------------------------------------------
00439011   1/2  ----------------------------------------------------------------------
00481111   1/1  ----------------------------------------------------------------------
00506761   1/2  ----------------------------------------------------------------------
00531472   2/2  ----------------------------------------------------------------------
00493012   2/2  ----------------------------------------------------------------------
00528232   2/2  ----------------------------------------------------------------------
00514981   1/1  ----------------------------------------------------------------------
00387401   1/2  ----------------------------------------------------------------------
00420892   2/2  ----------------------------------------------------------------------
00528551   1/2  ----------------------------------------------------------------------
00361551   1/1  ----------------------------------------------------------------------
00531461   1/2  ----------------------------------------------------------------------
00493001   1/2  ----------------------------------------------------------------------
00438872   2/2  ----------------------------------------------------------------------
00427201   1/2  ----------------------------------------------------------------------
00381422   2/2  ----------------------------------------------------------------------
00348331   1/1  ----------------------------------------------------------------------
00358483   3/3  ----------------------------------------------------------------------
00358492   2/2  ----------------------------------------------------------------------
00377872   2/2  ----------------------------------------------------------------------
00363182   2/2  ----------------------------------------------------------------------
00513311   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00447141   1/2  ----------------------------------------------------------------------
00387412   2/2  ----------------------------------------------------------------------
00525451   1/1  ----------------------------------------------------------------------
00414432   2/2  ----------------------------------------------------------------------
00408262   2/2  ----------------------------------------------------------------------
00381421   1/2  ----------------------------------------------------------------------
00420881   1/2  ----------------------------------------------------------------------
00397151   1/1  ----------------------------------------------------------------------
00525472   2/2  ----------------------------------------------------------------------
00525461   1/1  ----------------------------------------------------------------------
00525492   2/3  ----------------------------------------------------------------------
00363173   3/3  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00506911   1/2  ----------------------------------------------------------------------
00427202   2/2  ----------------------------------------------------------------------
00363181   1/2  ----------------------------------------------------------------------
00381622   2/2  ----------------------------------------------------------------------
00439012   2/2  ----------------------------------------------------------------------
00425532   2/2  ----------------------------------------------------------------------
00387411   1/2  ----------------------------------------------------------------------
00387402   2/2  ----------------------------------------------------------------------
00377871   1/2  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00420882   2/2  ----------------------------------------------------------------------
00438871   1/2  ----------------------------------------------------------------------
00420891   1/2  ----------------------------------------------------------------------
00358491   1/2  ----------------------------------------------------------------------
00447142   2/2  ----------------------------------------------------------------------
00432582   2/2  ----------------------------------------------------------------------
00527951   1/2  ----------------------------------------------------------------------
00528231   1/2  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00493002   2/2  ----------------------------------------------------------------------
00531471   1/2  ----------------------------------------------------------------------
00506762   2/2  ----------------------------------------------------------------------
00414431   1/2  ----------------------------------------------------------------------
00531462   2/2  ----------------------------------------------------------------------
00528552   2/2  ----------------------------------------------------------------------
00493011   1/2  ----------------------------------------------------------------------
00525491   1/3  ----------------------------------------------------------------------
00408261   1/2  ----------------------------------------------------------------------
00506912   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           DPDDPLTAPLRVVVAPIRSVLQPLVSGLGDLQPVRVREGDSVALDELVQSLVDIGYSRVDLVEKRGDIAV
00525481   1/1  k........dvivvtsvsallqrlpppelllkltltlkvgdeldldellerLvelgYervdlveepGeFa
00514861   1/1  ----------------------------------------------------------------------
00381621   1/2  ----------------------------------------------------------------------
00381411   1/2  ----------------------------------------------------------------------
00525493   3/3  ----------------------------------------------------------------------
00506771   1/1  ----------------------------------------------------------------------
00381511   1/2  ----------------------------------------------------------------------
00525471   1/2  ----------------------------------------------------------------------
00520041   1/1  ----------------------------------------------------------------------
00358482   2/3  ----------------------------------------------------------------------
00358481   1/3  ldeidalpperlspssdviirvallhgglseaerlealrallegead........ilvaTvgrlldlldp
00381631   1/1  ----------------------------------------------------------------------
00363171   1/3  eeidlerlsallallegepd........ivvatvqalldlpkpellllltltllvgdeldldellerLve
00432581   1/2  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00513321   1/1  ----------------------------------------------------------------------
00363172   2/3  ----------------------------------------------------------------------
00527952   2/2  ----------------------------------------------------------------------
00414421   1/1  ----------------------------------------------------------------------
00525501   1/1  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00514851   1/1  ----------------------------------------------------------------------
00425531   1/2  ----------------------------------------------------------------------
00439011   1/2  ----------------------------------------------------------------------
00481111   1/1  ----------------------------------------------------------------------
00506761   1/2  ----------------------------------------------------------------------
00531472   2/2  ----------------------------------------------------------------------
00493012   2/2  ----------------------------------------------------------------------
00528232   2/2  ----------------------------------------------------------------------
00514981   1/1  ----------------------------------------------------------------------
00387401   1/2  ----------------------------------------------------------------------
00420892   2/2  ----------------------------------------------------------------------
00528551   1/2  ----------------------------------------------------------------------
00361551   1/1  ----------------------------------------------------------------------
00531461   1/2  ----------------------------------------------------------------------
00493001   1/2  ----------------------------------------------------------------------
00438872   2/2  ----------------------------------------------------------------------
00427201   1/2  ----------------------------------------------------------------------
00381422   2/2  ----------------------------------------------------------------------
00348331   1/1  ----------------------------------------------------------------------
00358483   3/3  ----------------------------------------------------------------------
00358492   2/2  ----------------------------------------------------------------------
00377872   2/2  ----------------------------------------------------------------------
00363182   2/2  ----------------------------------------------------------------------
00513311   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00447141   1/2  ----------------------------------------------------------------------
00387412   2/2  ----------------------------------------------------------------------
00525451   1/1  ----------------------------------------------------------------------
00414432   2/2  ----------------------------------------------------------------------
00408262   2/2  ----------------------------------------------------------------------
00381421   1/2  ----------------------------------------------------------------------
00420881   1/2  ----------------------------------------------------------------------
00397151   1/1  ----------------------------------------------------------------------
00525472   2/2  ----------------------------------------------------------------------
00525461   1/1  ----------------------------------------------------------------------
00525492   2/3  ----------------------------------------------------------------------
00363173   3/3  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00506911   1/2  ----------------------------------------------------------------------
00427202   2/2  ----------------------------------------------------------------------
00363181   1/2  ----------------------------------------------------------------------
00381622   2/2  ----------------------------------------------------------------------
00439012   2/2  ----------------------------------------------------------------------
00425532   2/2  ----------------------------------------------------------------------
00387411   1/2  ----------------------------------------------------------------------
00387402   2/2  ----------------------------------------------------------------------
00377871   1/2  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00420882   2/2  ----------------------------------------------------------------------
00438871   1/2  ----------------------------------------------------------------------
00420891   1/2  ----------------------------------------------------------------------
00358491   1/2  ----------------------------------------------------------------------
00447142   2/2  ----------------------------------------------------------------------
00432582   2/2  ----------------------------------------------------------------------
00527951   1/2  ----------------------------------------------------------------------
00528231   1/2  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00493002   2/2  ----------------------------------------------------------------------
00531471   1/2  ----------------------------------------------------------------------
00506762   2/2  ----------------------------------------------------------------------
00414431   1/2  ----------------------------------------------------------------------
00531462   2/2  ----------------------------------------------------------------------
00528552   2/2  ----------------------------------------------------------------------
00493011   1/2  ----------------------------------------------------------------------
00525491   1/3  ----------------------------------------------------------------------
00408261   1/2  ----------------------------------------------------------------------
00506912   2/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           RGGILDVFPPTEEHPLRLEFWGDTVEEIRYFQVADQRSISKPGAAEAGLFAPPCRELLLTDTVRKRARAL
00525481   1/1  vRGgilDifPpgselPvRieffgdeiesIrtFdpetqrslek....ldeitilPasefvldeeaierare
00514861   1/1  ----------------------------------------------------------------------
00381621   1/2  ----------------------------------------------------------------------
00381411   1/2  ----------------------------------------------------------------------
00525493   3/3  ----------------------------------------------------------------------
00506771   1/1  ----------------------------------------------------------------------
00381511   1/2  ----------------------------------------------------------------------
00525471   1/2  ----------------------------------------------------------------------
00520041   1/1  ----------------------------------------------------------------------
00358482   2/3  ----------------------------------------------------------------------
00358481   1/3  allrlgrldllvgdeadldellktllelGydrvdlvlerGeFavRGdilDifPlgselpvRielfgdeie
00381631   1/1  ----------------------------------------------------------------------
00363171   1/3  lgYervdlvl.rGefsvRGdilDIfplgdselpvRiefFgdeiesireefdpltqrslee....leeill
00432581   1/2  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00513321   1/1  ----------------------------------------------------------------------
00363172   2/3  ----------------------------------------------------------------------
00527952   2/2  ----------------------------------------------------------------------
00414421   1/1  ----------------------------------------------------------------------
00525501   1/1  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00514851   1/1  ----------------------------------------------------------------------
00425531   1/2  ----------------------------------------------------------------------
00439011   1/2  ----------------------------------------------------------------------
00481111   1/1  ----------------------------------------------------------------------
00506761   1/2  ----------------------------------------------------------------------
00531472   2/2  ----------------------------------------------------------------------
00493012   2/2  ----------------------------------------------------------------------
00528232   2/2  ----------------------------------------------------------------------
00514981   1/1  ----------------------------------------------------------------------
00387401   1/2  ----------------------------------------------------------------------
00420892   2/2  ----------------------------------------------------------------------
00528551   1/2  ----------------------------------------------------------------------
00361551   1/1  ----------------------------------------------------------------------
00531461   1/2  ----------------------------------------------------------------------
00493001   1/2  ----------------------------------------------------------------------
00438872   2/2  ----------------------------------------------------------------------
00427201   1/2  ----------------------------------------------------------------------
00381422   2/2  ----------------------------------------------------------------------
00348331   1/1  ----------------------------------------------------------------------
00358483   3/3  ----------------------------------------------------------------------
00358492   2/2  ----------------------------------------------------------------------
00377872   2/2  ----------------------------------------------------------------------
00363182   2/2  ----------------------------------------------------------------------
00513311   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00447141   1/2  ----------------------------------------------------------------------
00387412   2/2  ----------------------------------------------------------------------
00525451   1/1  ----------------------------------------------------------------------
00414432   2/2  ----------------------------------------------------------------------
00408262   2/2  ----------------------------------------------------------------------
00381421   1/2  ----------------------------------------------------------------------
00420881   1/2  ----------------------------------------------------------------------
00397151   1/1  ----------------------------------------------------------------------
00525472   2/2  ----------------------------------------------------------------------
00525461   1/1  ----------------------------------------------------------------------
00525492   2/3  ----------------------------------------------------------------------
00363173   3/3  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00506911   1/2  ----------------------------------------------------------------------
00427202   2/2  ----------------------------------------------------------------------
00363181   1/2  ----------------------------------------------------------------------
00381622   2/2  ----------------------------------------------------------------------
00439012   2/2  ----------------------------------------------------------------------
00425532   2/2  ----------------------------------------------------------------------
00387411   1/2  ----------------------------------------------------------------------
00387402   2/2  ----------------------------------------------------------------------
00377871   1/2  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00420882   2/2  ----------------------------------------------------------------------
00438871   1/2  ----------------------------------------------------------------------
00420891   1/2  ----------------------------------------------------------------------
00358491   1/2  ----------------------------------------------------------------------
00447142   2/2  ----------------------------------------------------------------------
00432582   2/2  ----------------------------------------------------------------------
00527951   1/2  ----------------------------------------------------------------------
00528231   1/2  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00493002   2/2  ----------------------------------------------------------------------
00531471   1/2  ----------------------------------------------------------------------
00506762   2/2  ----------------------------------------------------------------------
00414431   1/2  ----------------------------------------------------------------------
00531462   2/2  ----------------------------------------------------------------------
00528552   2/2  ----------------------------------------------------------------------
00493011   1/2  ----------------------------------------------------------------------
00525491   1/3  ----------------------------------------------------------------------
00408261   1/2  ----------------------------------------------------------------------
00506912   2/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           AAEYPALADILTKLADGVAVEGMEAFAPVLADRMELLLDLLPPGTHIVGCDPERIRTRAQELVATSQEFL
00525481   1/1  rireelearqrteellemlsegglcegienylplfydrepatLldYlpedtllvldes..lleqaeglya
00514861   1/1  ----------------------------------------------------------------------
00381621   1/2  ----------------------------------------------------------------------
00381411   1/2  ----------------------------------------------------------------------
00525493   3/3  ----------------------------------------------------------------------
00506771   1/1  ----------------------------------------------------------------------
00381511   1/2  ----------------------------------------------------------------------
00525471   1/2  ----------------------------------------------------------------------
00520041   1/1  ----------------------------------------------------------------------
00358482   2/3  ----------------------------------------------------------------------
00358481   1/3  sirlfdpltqrslee....leevlllPaseflldeedleraleilkellerllllekvdklleaq-----
00381631   1/1  ----------------------------------------------------------------------
00363171   1/3  lPasefvlddevleraisrikeeleerldelvklgklleaqrleerteydlemlkeggylagienylr--
00432581   1/2  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00513321   1/1  ----------------------------------------------------------------------
00363172   2/3  ----------------------------------------------------------------------
00527952   2/2  ----------------------------------------------------------------------
00414421   1/1  ----------------------------------------------------------------------
00525501   1/1  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00514851   1/1  ----------------------------------------------------------------------
00425531   1/2  ----------------------------------------------------------------------
00439011   1/2  ----------------------------------------------------------------------
00481111   1/1  ----------------------------------------------------------------------
00506761   1/2  ----------------------------------------------------------------------
00531472   2/2  ----------------------------------------------------------------------
00493012   2/2  ----------------------------------------------------------------------
00528232   2/2  ----------------------------------------------------------------------
00514981   1/1  ----------------------------------------------------------------------
00387401   1/2  ----------------------------------------------------------------------
00420892   2/2  ----------------------------------------------------------------------
00528551   1/2  ----------------------------------------------------------------------
00361551   1/1  ----------------------------------------------------------------------
00531461   1/2  ----------------------------------------------------------------------
00493001   1/2  ----------------------------------------------------------------------
00438872   2/2  ----------------------------------------------------------------------
00427201   1/2  ----------------------------------------------------------------------
00381422   2/2  ----------------------------------------------------------------------
00348331   1/1  ----------------------------------------------------------------------
00358483   3/3  ----------------------------------------------------------------------
00358492   2/2  ----------------------------------------------------------------------
00377872   2/2  ----------------------------------------------------------------------
00363182   2/2  ----------------------------------------------------------------------
00513311   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00447141   1/2  ----------------------------------------------------------------------
00387412   2/2  ----------------------------------------------------------------------
00525451   1/1  ----------------------------------------------------------------------
00414432   2/2  ----------------------------------------------------------------------
00408262   2/2  ----------------------------------------------------------------------
00381421   1/2  ----------------------------------------------------------------------
00420881   1/2  ----------------------------------------------------------------------
00397151   1/1  ----------------------------------------------------------------------
00525472   2/2  ----------------------------------------------------------------------
00525461   1/1  ----------------------------------------------------------------------
00525492   2/3  ----------------------------------------------------------------------
00363173   3/3  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00506911   1/2  ----------------------------------------------------------------------
00427202   2/2  ----------------------------------------------------------------------
00363181   1/2  ----------------------------------------------------------------------
00381622   2/2  ----------------------------------------------------------------------
00439012   2/2  ----------------------------------------------------------------------
00425532   2/2  ----------------------------------------------------------------------
00387411   1/2  ----------------------------------------------------------------------
00387402   2/2  ----------------------------------------------------------------------
00377871   1/2  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00420882   2/2  ----------------------------------------------------------------------
00438871   1/2  ----------------------------------------------------------------------
00420891   1/2  ----------------------------------------------------------------------
00358491   1/2  ----------------------------------------------------------------------
00447142   2/2  ----------------------------------------------------------------------
00432582   2/2  ----------------------------------------------------------------------
00527951   1/2  ----------------------------------------------------------------------
00528231   1/2  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00493002   2/2  ----------------------------------------------------------------------
00531471   1/2  ----------------------------------------------------------------------
00506762   2/2  ----------------------------------------------------------------------
00414431   1/2  ----------------------------------------------------------------------
00531462   2/2  ----------------------------------------------------------------------
00528552   2/2  ----------------------------------------------------------------------
00493011   1/2  ----------------------------------------------------------------------
00525491   1/3  ----------------------------------------------------------------------
00408261   1/2  ----------------------------------------------------------------------
00506912   2/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           EASWINAASGGEAPIDLGASAYQSIAELRSRARELGLPWWTVTPFDPGNPAAAEDDHSVVVGASATDAYR
00525481   1/1  edreryeall....edgfrlplapdnlyldfeellellkqfpviylsat---------------------
00514861   1/1  ----------------------------------------------------------------------
00381621   1/2  ----------------------------------------------------------------------
00381411   1/2  ----------------------------------------------------------------------
00525493   3/3  ----------------------------------------------------------------------
00506771   1/1  ----------------------------------------------------------------------
00381511   1/2  ----------------------------------------------------------------------
00525471   1/2  ----------------------------------------------------------------------
00520041   1/1  ----------------------------------------------------------------------
00358482   2/3  ----------------------------------------------------------------------
00358481   1/3  ----------------------------------------------------------------------
00381631   1/1  ----------------------------------------------------------------------
00363171   1/3  ----------------------------------------------------------------------
00432581   1/2  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00513321   1/1  ----------------------------------------------------------------------
00363172   2/3  ----------------------------------------------------------------------
00527952   2/2  ----------------------------------------------------------------------
00414421   1/1  ----------------------------------------------------------------------
00525501   1/1  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00514851   1/1  ----------------------------------------------------------------------
00425531   1/2  ----------------------------------------------------------------------
00439011   1/2  ----------------------------------------------------------------------
00481111   1/1  ----------------------------------------------------------------------
00506761   1/2  ----------------------------------------------------------------------
00531472   2/2  ----------------------------------------------------------------------
00493012   2/2  ----------------------------------------------------------------------
00528232   2/2  ----------------------------------------------------------------------
00514981   1/1  ----------------------------------------------------------------------
00387401   1/2  ----------------------------------------------------------------------
00420892   2/2  ----------------------------------------------------------------------
00528551   1/2  ----------------------------------------------------------------------
00361551   1/1  ----------------------------------------------------------------------
00531461   1/2  ----------------------------------------------------------------------
00493001   1/2  ----------------------------------------------------------------------
00438872   2/2  ----------------------------------------------------------------------
00427201   1/2  ----------------------------------------------------------------------
00381422   2/2  ----------------------------------------------------------------------
00348331   1/1  ----------------------------------------------------------------------
00358483   3/3  ----------------------------------------------------------------------
00358492   2/2  ----------------------------------------------------------------------
00377872   2/2  ----------------------------------------------------------------------
00363182   2/2  ----------------------------------------------------------------------
00513311   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00447141   1/2  ----------------------------------------------------------------------
00387412   2/2  ----------------------------------------------------------------------
00525451   1/1  ----------------------------------------------------------------------
00414432   2/2  ----------------------------------------------------------------------
00408262   2/2  ----------------------------------------------------------------------
00381421   1/2  ----------------------------------------------------------------------
00420881   1/2  ----------------------------------------------------------------------
00397151   1/1  ----------------------------------------------------------------------
00525472   2/2  ----------------------------------------------------------------------
00525461   1/1  --------------------------------------------------------gvlnlgarplpdfa
00525492   2/3  ----------------------------------------------------------------------
00363173   3/3  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00506911   1/2  ----------------------------------------------------------------------
00427202   2/2  ----------------------------------------------------------------------
00363181   1/2  ----------------------------------------------------------------------
00381622   2/2  ----------------------------------------------------------------------
00439012   2/2  ----------------------------------------------------------------------
00425532   2/2  ----------------------------------------------------------------------
00387411   1/2  ----------------------------------------------------------------------
00387402   2/2  ----------------------------------------------------------------------
00377871   1/2  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00420882   2/2  ----------------------------------------------------------------------
00438871   1/2  ----------------------------------------------------------------------
00420891   1/2  ----------------------------------------------------------------------
00358491   1/2  ----------------------------------------------------------------------
00447142   2/2  ----------------------------------------------------------------------
00432582   2/2  ----------------------------------------------------------------------
00527951   1/2  ----------------------------------------------------------------------
00528231   1/2  ----------------------------------------------------------------------
00473291   1/1  ------------------------lelarenlaraglalpdnvevvvgDaedlplpdgsfDavvs....d
00494911   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00493002   2/2  ----------------------------------------------------------------------
00531471   1/2  ----------------------------------------------------------------------
00506762   2/2  ----------------------------------------------------------------------
00414431   1/2  ----------------------------------------------------------------------
00531462   2/2  ----------------------------------------------------------------------
00528552   2/2  ----------------------------------------------------------------------
00493011   1/2  ----------------------------------------------------------------------
00525491   1/3  ---------------------------------------------------------------rPvdrlq
00408261   1/2  ----------------------------------------------------------------------
00506912   2/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           GDTERAIADVKSWLHEGWRVVLLTPGQGPAERLASMLRDAGLGTQLRDALPEPPEPAVATVTTGLLEHGF
00525481   1/1  ----------------------------------------------------------------------
00514861   1/1  ----------------------------------------------------------------------
00381621   1/2  ----------------------------------------------------------------------
00381411   1/2  ----------------------------------------------------------------------
00525493   3/3  ----------------------------------------------------------------------
00506771   1/1  ----------------------------------------------------------------------
00381511   1/2  ----------------------------------------------------------------------
00525471   1/2  ----------------------------------------------------------------------
00520041   1/1  ----------------------------------------------------------------------
00358482   2/3  ----------------------------------------------------------------------
00358481   1/3  ----------------------------------------------------------------------
00381631   1/1  ----------------------------------------------------------------------
00363171   1/3  ----------------------------------------------------------------------
00432581   1/2  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00513321   1/1  ----------------------------------------------------------------------
00363172   2/3  ----------------------------------------------------------------------
00527952   2/2  ----------------------------------------------------------------------
00414421   1/1  ----------------------------------------------------------------------
00525501   1/1  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00514851   1/1  ----------------------------------------------------------------------
00425531   1/2  ----------------------------------------------------------------------
00439011   1/2  ----------------------------------------------------------------------
00481111   1/1  ----------------------------------------------------------------------
00506761   1/2  ----------------------------------------------------------------------
00531472   2/2  ----------------------------------------------------------------------
00493012   2/2  ----------------------------------------------------------------------
00528232   2/2  ----------------------------------------------------------------------
00514981   1/1  ----------------------------------------------------------------------
00387401   1/2  ----------------------------------------------------------------------
00420892   2/2  ----------------------------------------------------------------------
00528551   1/2  ----------------------------------------------------------------------
00361551   1/1  ----------------------------------------------------------------------
00531461   1/2  ----------------------------------------------------------------------
00493001   1/2  ----------------------------------------------------------------------
00438872   2/2  ----------------------------------------------------------------------
00427201   1/2  ----------------------------------------------------------------------
00381422   2/2  ----------------------------------------------------------------------
00348331   1/1  ----------------------------------------------------------------------
00358483   3/3  ----------------------------------------------------------------------
00358492   2/2  ----------------------------------------------------------------------
00377872   2/2  ----------------------------------------------------------------------
00363182   2/2  ----------------------------------------------------------------------
00513311   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00447141   1/2  ----------------------------------------------------------------------
00387412   2/2  ----------------------------------------------------------------------
00525451   1/1  ----------------------------------------------------------------------
00414432   2/2  ----------------------------------------------------------------------
00408262   2/2  ----------------------------------------------------------------------
00381421   1/2  ----------------------------------------------------------------------
00420881   1/2  ----------------------------------------------------------------------
00397151   1/1  ----------------------------------------------------------------------
00525472   2/2  ----------------------------------------------------------------------
00525461   1/1  vergqldplaalleflakaggrvllaaesegrrerLlelLadlglkpalvdsldeflkg.rvalvvgple
00525492   2/3  ----------------------------------------------------------------------
00363173   3/3  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00506911   1/2  ----------------------------------------------------------------------
00427202   2/2  ----------------------------------------------------------------------
00363181   1/2  ----------------------------------------------------------------------
00381622   2/2  ----------------------------------------------------------------------
00439012   2/2  ----------------------------------------------------------------------
00425532   2/2  ----------------------------------------------------------------------
00387411   1/2  ----------------------------------------------------------------------
00387402   2/2  ----------------------------------------------------------------------
00377871   1/2  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00420882   2/2  ----------------------------------------------------------------------
00438871   1/2  ----------------------------------------------------------------------
00420891   1/2  ----------------------------------------------------------------------
00358491   1/2  ----------------------------------------------------------------------
00447142   2/2  ----------------------------------------------------------------------
00432582   2/2  ----------------------------------------------------------------------
00527951   1/2  ----------------------------------------------------------------------
00528231   1/2  ----------------------------------------------------------------------
00473291   1/1  l..pdpeaalaeaarlLkpGGrlvlseptleqlaellellraaglfvllevledlarrprvrfltleele
00494911   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00493002   2/2  ----------------------------------------------------------------------
00531471   1/2  ----------------------------------------------------------------------
00506762   2/2  ----------------------------------------------------------------------
00414431   1/2  ----------------------------------------------------------------------
00531462   2/2  ----------------------------------------------------------------------
00528552   2/2  ----------------------------------------------------------------------
00493011   1/2  ----------------------------------------------------------------------
00525491   1/3  lvivvgsgkklvlllallkelekggqvlvfvptrklaeqlael---------------------------
00408261   1/2  ----------------------------------------------------------------------
00506912   2/2  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           VWRSVRTVLLTETDLVGQRSSTRDMRRMPSRRRGVDPLQLKPGDYVVHEQHGIGRYVEMVSRTIQGATRE
00525481   1/1  ----------------------------------------------------------------------
00514861   1/1  ----------------------------------------------------------------------
00381621   1/2  ----------------------------------------------------------------------
00381411   1/2  ----------------------------------------------------------------------
00525493   3/3  ----------------------------------------------------------------------
00506771   1/1  ----------------------------------------------------------------------
00381511   1/2  ----------------------------------------------------------------------
00525471   1/2  ----------------------------------------------------------------------
00520041   1/1  ----------------------------------------------------------------------
00358482   2/3  ----------------------------------------------------------------------
00358481   1/3  ----------------------------------------------------------------------
00381631   1/1  ----------------------------------------------------------------------
00363171   1/3  ----------------------------------------------------------------------
00432581   1/2  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00513321   1/1  ----------------------------------------------------------------------
00363172   2/3  ----------------------------------------------------------------------
00527952   2/2  ----------------------------------------------------------------------
00414421   1/1  ----------------------------------------------------------------------
00525501   1/1  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00514851   1/1  ----------------------------------------------------------------------
00425531   1/2  ----------------------------------------------------------------------
00439011   1/2  ----------------------------------------------------------------------
00481111   1/1  ----------------------------------------------------------------------
00506761   1/2  ----------------------------------------------------------------------
00531472   2/2  ----------------------------------------------------------------------
00493012   2/2  ----------------------------------------------------------------------
00528232   2/2  ----------------------------------------------------------------------
00514981   1/1  ----------------------------------------------------------------------
00387401   1/2  ----------------------------------------------------------------------
00420892   2/2  ----------------------------------------------------------------------
00528551   1/2  ----------------------------------------------------------------------
00361551   1/1  ----------------------------------------------------------------------
00531461   1/2  ----------------------------------------------------------------------
00493001   1/2  ----------------------------------------------------------------------
00438872   2/2  ----------------------------------------------------------------------
00427201   1/2  ----------------------------------------------------------------------
00381422   2/2  ----------------------------------------------------------------------
00348331   1/1  ----------------------------------------------------------------------
00358483   3/3  ----------------------------------------------------------------------
00358492   2/2  ----------------------------------------------------------------------
00377872   2/2  ----------------------------------------------------------------------
00363182   2/2  ----------------------------------------------------------------------
00513311   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00447141   1/2  ----------------------------------------------------------------------
00387412   2/2  ----------------------------------------------------------------------
00525451   1/1  ----------------------------sedallldllelkvGdyvVhpdhGvGrflgletlevggvlle
00414432   2/2  ----------------------------------------------------------------------
00408262   2/2  ----------------------------------------------------------------------
00381421   1/2  ----------------------------------------------------------------------
00420881   1/2  ----------------------------------------------------------------------
00397151   1/1  ----------------------------------------------------------------------
00525472   2/2  ----------------------------------------------------------------------
00525461   1/1  nGFelpdlklalitEtelfgervvrrrrrkk---------------------------------------
00525492   2/3  ----------------------------------------------------------------------
00363173   3/3  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00506911   1/2  ----------------------------------------------------------------------
00427202   2/2  ----------------------------------------------------------------------
00363181   1/2  ----------------------------------------------------------------------
00381622   2/2  ----------------------------------------------------------------------
00439012   2/2  ----------------------------------------------------------------------
00425532   2/2  ----------------------------------------------------------------------
00387411   1/2  ----------------------------------------------------------------------
00387402   2/2  ----------------------------------------------------------------------
00377871   1/2  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00420882   2/2  ----------------------------------------------------------------------
00438871   1/2  ----------------------------------------------------------------------
00420891   1/2  ----------------------------------------------------------------------
00358491   1/2  ----------------------------------------------------------------------
00447142   2/2  ----------------------------------------------------------------------
00432582   2/2  ----------------------------------------------------------------------
00527951   1/2  ----------------------------------------------------------------------
00528231   1/2  ----------------------------------------------------------------------
00473291   1/1  rlleeaGF--------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00493002   2/2  ----------------------------------------------------------------------
00531471   1/2  ----------------------------------------------------------------------
00506762   2/2  ----------------------------------------------------------------------
00414431   1/2  ----------------------------------------------------------------------
00531462   2/2  ----------------------------------------------------------------------
00528552   2/2  ----------------------------------------------------------------------
00493011   1/2  ----------------------------------------------------------------------
00525491   1/3  ----------------------------------------------------------------------
00408261   1/2  ----------------------------------------------------------------------
00506912   2/2  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           YLVIEYAPSKRGQPGDRLFVPTDQLDEVTRYVGGDSPTLSKMGGSDWAKAKSRARKAVREIAGDLIRLYS
00525481   1/1  ----------------------------------------------------------------------
00514861   1/1  -----------------------------------------ldgdlaellealldllieelerlllglll
00381621   1/2  -----------------eylpvdllllvslleleeallliklpsdlweklkaklrlileellllelelll
00381411   1/2  -----------------------------------------lllgelvllklklkellrelleillelea
00525493   3/3  ----------------------------------------------------------------------
00506771   1/1  ----------------------------------------------------------------------
00381511   1/2  -----------------------------------------lllillelllalarllleellldllkldl
00525471   1/2  ------------------------------------------deelldalkrllleellllalellllla
00520041   1/1  ----------------------------------------------------------------------
00358482   2/3  ----------------------------------------------------------------------
00358481   1/3  ----------------------------------------------------------------------
00381631   1/1  ----------------------------------------------------------------------
00363171   1/3  ----------------------------------------------------------------------
00432581   1/2  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00513321   1/1  ----------------------------------------------------------------------
00363172   2/3  ----------------------------------------------------------------------
00527952   2/2  ----------------------------------------------------------------------
00414421   1/1  ------------------llvedvdlsllllleelllkklklledrelkkllklvkqineleddlaelsd
00525501   1/1  ----------------------------------------------------------------------
00527961   1/1  ---------------------------Likkllkdllilllklgellleallellleellllallllell
00514851   1/1  ----------------------------------------------------------------------
00425531   1/2  ----------------------------------------------------------------------
00439011   1/2  ----------------------------------------------------------------------
00481111   1/1  ---------------------------------------lelllkllgllnlrelkkllkivdkinslep
00506761   1/2  ----------------------------------------------------------------------
00531472   2/2  ----------------------------------------------------------------------
00493012   2/2  ----------------------------------------------------------------------
00528232   2/2  ----------------------------------------------------------------------
00514981   1/1  ----------------------------------------------------------------------
00387401   1/2  ----------------------------------------------------------------------
00420892   2/2  ----------------------------------------------------------------------
00528551   1/2  ----------------------------------------------------------------lvegld
00361551   1/1  ----------------------------------------------------------------------
00531461   1/2  ----------------------------------------------------------elllllvllsdl
00493001   1/2  ----------------------------------------------------------------------
00438872   2/2  ----------------------------------------------------------------------
00427201   1/2  -----------------------------------------------------------------llsel
00381422   2/2  ----------------------------------------------------------------------
00348331   1/1  ----------------------------------------------------------------------
00358483   3/3  ----------------------------------------------------------------------
00358492   2/2  ----------------------------------------------------------------------
00377872   2/2  ----------------------------------------------------------------------
00363182   2/2  ----------------------------------------------------------------------
00513311   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00447141   1/2  ----------------------------------------------------------------------
00387412   2/2  ----------------------------------------------------------------------
00525451   1/1  ylvley......adgdklyvPvdnldlvsryvgadgeevkld----------------------------
00414432   2/2  ----------------------------------------------------------------------
00408262   2/2  ----------------------------------------------------------------------
00381421   1/2  ----------------------------------------------------------------------
00420881   1/2  ----------------------------------------------------------------------
00397151   1/1  ----------------------------------------------------------------------
00525472   2/2  ----------------------------------------------------------------------
00525461   1/1  ----------------------------------------------------------------------
00525492   2/3  ----------------------------------------------------------------------
00363173   3/3  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00506911   1/2  ------------------------------------------------------lllllellilvegllv
00427202   2/2  ----------------------------------------------------------------------
00363181   1/2  ----------------------------------------------------------------------
00381622   2/2  ----------------------------------------------------------------------
00439012   2/2  ----------------------------------------------------------------------
00425532   2/2  ----------------------------------------------------------------------
00387411   1/2  ----------------------------------------------------------------------
00387402   2/2  ----------------------------------------------------------------------
00377871   1/2  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00420882   2/2  ----------------------------------------------------------------------
00438871   1/2  ----------------------------------------------------------------------
00420891   1/2  ----------------------------------------------------------------------
00358491   1/2  ----------------------------------------------------------------------
00447142   2/2  ----------------------------------------------------------------------
00432582   2/2  ----------------------------------------------------------------------
00527951   1/2  ----------------------------------------------------------------------
00528231   1/2  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00493002   2/2  ----------------------------------------------------------------------
00531471   1/2  ----------------------------------------------------------------------
00506762   2/2  ----------------------------------------------------------------------
00414431   1/2  ----------------------------------------------------------------------
00531462   2/2  ----------------------------------------------------------------------
00528552   2/2  ----------------------------------------------------------------------
00493011   1/2  ----------------------------------------------------------------------
00525491   1/3  ----------------------------------------------------------------------
00408261   1/2  ----------------------------------------------------------------------
00506912   2/2  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           ARHASPGHAFSPDTPWQRELEDAFPYVETPDQLAAIEEVKRDMEKPVPMDRLICGDVGYGKTEVAVRAAF
00525481   1/1  ----------------------------------------------------------------------
00514861   1/1  krelldllrl.pdlflllelpellpfelrpyQleavnwllervldlllgkgrgglladetGsGKTlvall
00381621   1/2  lellrllisfedlglleelleelkellplkltpiQkeaipelleglesgkpknvllagptGsGKTlvall
00381411   1/2  lrkplesfedlglpelllealkklgfeltpiQkeaipailk......gedvllvapTGsGKTlaallpal
00525493   3/3  ----------------------------------------------------------------------
00506771   1/1  ----------------------------------------------------------------------
00381511   1/2  ilpeesfeelgldpellealkk.gffeltpiQkeaipailk......grdlllvapTGsGKTlaallpal
00525471   1/2  lldllsfeelgldeellealkklgffelrpyQleaipallegresglpmdvllaaptGsGKTlvallail
00520041   1/1  --------------------------------------iipallsgrd.vvllaaptGsGKTlaallpil
00358482   2/3  -------------------lkalgpfeltpiQqeaipaileglesg.prdvllvgptGtGKTltaaalal
00358481   1/3  ----------------------------------------------------------------------
00381631   1/1  -----------------------------------------------grdvllaapTGsGKTlaallpil
00363171   1/3  ----------------------------------------------------------------------
00432581   1/2  -----mdillknlnelilveelkdelllelldlllfevkgdkpllllksgeldgelelalkelllpegll
00514991   1/1  ---------------lellidlglpfelrpyQleaveallell..ekgrgglladptGsGKTlvalllil
00513321   1/1  ----------------------------------------------------------------------
00363172   2/3  ----------------ikplklispfeprpyQqeaiealleglekgk.knvllvgptGtGKTltaaalaa
00527952   2/2  ----------------------------------------------------------------------
00414421   1/1  eelkaktlelklrladlvpgelldflllelsaellealkrllffrltpiQleaipall........sgrl
00525501   1/1  ----------------------------------------------------------------------
00527961   1/1  elleklllflllllpelleellkllgfelrpyQleaiealleg......rdvllagptGsGKTlvallli
00514851   1/1  ----------------------------------------------------------------------
00425531   1/2  ----ksfeelglseellkalkklgflkptpiQaeaipaileg......rdvlvqapTGsGKTlafllpil
00439011   1/2  ----ksfeelglseellkallelgfleltpiQleaiplilsg......rdvllqapTGsGKTlafllpil
00481111   1/1  alerlsdeellaktlelklrlaegesldflllelsalllealkrllffrptpiQllaipall........
00506761   1/2  -------------------lllelgflelrpyQleaipalle......g.dvllaaptGsGKTlaallpi
00531472   2/2  ----------------------------------------------------------------------
00493012   2/2  ----------------------------------------------------------------------
00528232   2/2  ----------------------------------------------------------------------
00514981   1/1  ----------------------------------------------------------------------
00387401   1/2  -epllsfeelglseellealkklgflkptpiQleaipaileg.....drdvlvvapTGsGKTlaallpll
00420892   2/2  ----------------------------------------------------------------------
00528551   1/2  lplpllsfedlglspellealkklgfekptpiQaeaipaileg......rdvlvqapTGsGKTlafllpi
00361551   1/1  ----------------------------------------------------------------------
00531461   1/2  plpllsfedlglseellkalkk.lgfekptpiQaeaipaileg......rdvlvqapTGsGKTlafllpi
00493001   1/2  ----lsfedlglseellkalke.lgfekptpiQaeaipaileg......rdvlvqapTGsGKTlafllpi
00438872   2/2  ----------------------------------------------------------------------
00427201   1/2  llpvlsfedlglseellkalkklgfeeptpiQaeaipaileg......rdvlvqapTGsGKTlafllpll
00381422   2/2  ----------------------------------------------------------------------
00348331   1/1  ----------------------------------------------------------------------
00358483   3/3  ----------------------------------------------------------------------
00358492   2/2  ----------------------------------------------------------------------
00377872   2/2  ----------------------------------------------------------------------
00363182   2/2  ----------------------------------------------------------------------
00513311   1/1  -----------------------------------------elalesgrdvllvaptGsGKTlaallpil
00503561   1/1  ------------------------kPydrLldivgigfltaddialalgiagdsperlllalallsellg
00447141   1/2  --pvlsfeelglseellkalkklgfleptpiQaeaipaile......grdvlvvapTGsGKTlafllpll
00387412   2/2  ----------------------------------------------------------------------
00525451   1/1  ----------------------------------------------------------------------
00414432   2/2  ----------------------------------------------------------------------
00408262   2/2  ----------------------------------------------------------------------
00381421   1/2  ----------------------------------------------rpnltqlviyvgseekleallsll
00420881   1/2  ---llsfedlglseelldalkelfgfteltpiQaeaipaile......grdvlvvapTGsGKTlayllpa
00397151   1/1  ----------------------------------------------------------------------
00525472   2/2  ----------------------------------------------------------------------
00525461   1/1  ----------------------------------------------------------------------
00525492   2/3  -----------------------------------------------rPvdrlqlvivvgsgkklvllla
00363173   3/3  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00506911   1/2  ptpllsfeelglspellealkklgfekptpiQaeaipaileg......rdvlvvapTGsGKTlafllpil
00427202   2/2  ----------------------------------------------------------------------
00363181   1/2  ----------------------------------------------egkdvllvapTGsGKTlvallpal
00381622   2/2  ----------------------------------------------------------------------
00439012   2/2  ----------------------------------------------------------------------
00425532   2/2  ----------------------------------------------------------------------
00387411   1/2  ------------------------------------------------rdvlvqaptgsgktlkllplle
00387402   2/2  ----------------------------------------------------------------------
00377871   1/2  -----------------------------------------------grdvllvaptgsgKtlallplla
00348321   1/1  ---------------------------------------------------llvgptGsGKTtlalalal
00420882   2/2  ----------------------------------------------------------------------
00438871   1/2  ----------------------------------------------sgrdvlvvaptgsgktllfllpal
00420891   1/2  ---------------------------------------------ppdrlrqvlvvvgtgkklslllqll
00358491   1/2  ----------------------------------------------sgrdvlvvapTGsGKTlaallpal
00447142   2/2  ----------------------------------------------------------------------
00432582   2/2  ----------------------------------------------------------------------
00527951   1/2  -------------Tpirevlllallllldpvvievlpelikqvvlvvp.........ssgkleallellk
00528231   1/2  -------------------------------------------llppgllqqllvvvtesgkleallell
00473291   1/1  ----------------------------------------------------------------------
00494911   1/1  ---------------------------------llveklrpvllddlvgqeeakeallealaagrpghvl
00394721   1/1  ----lvslleslelplleklrp.....vllddvvgreealeallealrrgpprnvlLvGppGvGKTtlak
00493002   2/2  ----------------------------------------------------------------------
00531471   1/2  --------------------------------------------esltpenllqivlvvveesgklelll
00506762   2/2  ----------------------------------------------------------------------
00414431   1/2  --------------------------------------------------------tgsgkklalllell
00531462   2/2  ----------------------------------------------------------------------
00528552   2/2  ----------------------------------------------------------------------
00493011   1/2  ------------------------------------------sltppnlkqivivveesdklelllellk
00525491   1/3  ----------------------------------------------------------------------
00408261   1/2  ----------------------------------------------iplvrlikqdvlvvteegklkall
00506912   2/2  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           KAVQDGKQVAVLVPTTLLVQQHLSTFTERYASFPVTVRPLSRFQSDAEIERIREGMRTGEVDVVIGTHRL
00525481   1/1  ----------------------------------------------------------------------
00514861   1/1  lilelllrgklkgplakrvlvvvPt.sLaeqwleefkkffpgl.lkvlvltgglsakerkelleklasge
00381621   1/2  ailelllrgkqvlvlvPtralaeqlaeefkklfgllglrvgllhgglskkereeileklrsgeadilvgT
00381411   1/2  eallkgkrvlvlaptrelaeqiaeelrkllgelggdlklkvallhgglslkereealerf..geadilva
00525493   3/3  ----------------------------------------------------------------------
00506771   1/1  ----kgkralvlaPtreLalqiveelkkllpllglglrvallvggtslkerleilkkllsg.adilvaTp
00381511   1/2  elllkgkrvlvlaPtrelaeqiaeelrkllgflgldlelkvallhgglslkereealedl..geadilva
00525471   1/2  elllrgkrvlvlvPtrelaeqwaeelkkllpelglkvallhgglsqkereealekfksgeadilvaTpgr
00520041   1/1  elllegggrvlvlaPtralaeqvaeelr...............gltggervrllerllsgeadilvgtpg
00358482   2/3  el...gkqvlvlaptrelaeqlaeelrelfpelpvilfldeidalpperlspssdviirvallhgglsea
00358481   1/3  ----------------------------------------------------------------------
00381631   1/1  llllrgkrvlvlaPtreLaeqiaeelkkllg.......................................
00363171   1/3  ----------------------------------------------------------------------
00432581   1/2  dallklleelgilvleedevlldellsfedlgldeelleallkfgffelrpyQkeaiealleg......k
00514991   1/1  ellergpakrvlvvvP.rslaeqwaeelkkflpglkvgvltgglkl...........lllgkadivitty
00513321   1/1  ----------------------------------------------------------------------
00363172   2/3  el...gkpvlivaptkeladqlyeelkkllp..elkvellhggldylqkealfpeidtlpykdaspneei
00527952   2/2  ----------------------------------------------------------------------
00414421   1/1  leapTGsGKTlaallpallallngkgvlvitPtreLaeqiaeelrellkflglkvglltgglslkerr..
00525501   1/1  ----------------------------------------------------------------------
00527961   1/1  lel...gkrvlvlaPtraLaeqwaeel.kf...lglklvglltgglslke.............divitTp
00514851   1/1  ----------------------------------------------------------------------
00425531   1/2  eallkllkggkalvfaptrelaeqlaeelrklgkelglllgikvallhgglsqkerlralk....gkadi
00439011   1/2  qlllkklkggqvlifvptrelaeqlaevlrellkflpglkvallhgglsqker...leafkkgkvdilva
00481111   1/1  egrlaqapTGsGKTlaallpallallagkqvlvvtptreLaeqvaevlkklleflglsvglltgglslke
00506761   1/2  lelllrggkrvlvlvPtrelaeqwaeelrkllgllglkvglltgglslkerleal.....ggadilvttp
00531472   2/2  ----------------------------------------------------------------------
00493012   2/2  ----------------------------------------------------------------------
00528232   2/2  ----------------------------------------------------------------------
00514981   1/1  ----------------------------------------------------------------------
00387401   1/2  elllkepggkvlvfvptrelaeqlaerlkkllkllglkvgllhgglsqkerlral.....gkadilvaTp
00420892   2/2  ----------------------------------------------------------------------
00528551   1/2  lqlllklpkgpralvlaPtrelalqiaeelkkllkllglrvalltgglslkerleall...rggadilva
00361551   1/1  ----------------------------------------------------------------------
00531461   1/2  lqlllklpkgpralvlaPtrelalqiaeelkkllkllgirvalltgglsikerlralk....ggadilva
00493001   1/2  lllllkepkgpralvlaptrelalqiaevlrkllkllglrvalltgglslkerlralk....ggadilva
00438872   2/2  ----------------------------------------------------------------------
00427201   1/2  elllkllkggqalvfvptrelaeqlaeelrkllkllgikvallhgglsqkerleil.....gkvdilvaT
00381422   2/2  ----------------------------------------------------------------------
00348331   1/1  ----------------------------------------------------------------------
00358483   3/3  ----------------------------------------------------------------------
00358492   2/2  ----------------------------------------------------------------------
00377872   2/2  ----------------------------------------------------------------------
00363182   2/2  ----------------------------------------------------------------------
00513311   1/1  ellllrggrvlvlaPtrelalqvaeelr......glkvglltgglslkerletl.........ilvatpg
00503561   1/1  eghlylplddlveellklleldelllelieleellkelleeilvellkedlelvlderrlyleeleldel
00447141   1/2  elllkepkggkalvfvptrelaeqlaevlrkllklllgikvallhgglsqeerlrvlk....gkvdilva
00387412   2/2  ----------------------------------------------------------------------
00525451   1/1  ----------------------------------------------------------------------
00414432   2/2  ----------------------------------------------------------------------
00408262   2/2  ----------------------------------------------------------------------
00381421   1/2  .....gkkvlifvptrklaeelaelL..........vavlhgglsqeeReeilekfrngeidvLvaTasl
00420881   1/2  ll...rggkvlvfvptrelaeqlaeelrkl....girvallhgglsqeerervleafrsgkadilvaTpg
00397151   1/1  ----------------------------------------------------------------------
00525472   2/2  ----------------------------------------------------------------------
00525461   1/1  ----------------------------------------------------------------------
00525492   2/3  llkelekggqvlvfvptrklaeqlaelLrellpgir..vallhgdlsqeereevleafrngeidvLvaTd
00363173   3/3  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00506911   1/2  qlllklllllllllklkgpralilaPtreLalqiaeelkkllkllglrvalltggtsldeqiralkk...
00427202   2/2  ----------------------------------------------------------------------
00363181   1/2  lrllekgkrvlvlvptrelalqlaeelkkl....gikvavlhgdlsqkereeiledfrngeidvLva---
00381622   2/2  ----------------------------------------------------------------------
00439012   2/2  ----------------------------------------------------------------------
00425532   2/2  ----------------------------------------------------------------------
00387411   1/2  lllekggrvlvfvptrelaeqlaellrkl....gikvavlhgglsqeereevleafrsgkidvLvaT.dv
00387402   2/2  ----------------------------------------------------------------------
00377871   1/2  kl..kggrvlvlaptrelaeqlaellke....lgikvavlhgglsqeereeilerfrsgeikvlvaT---
00348321   1/1  el...ggrvlvlvptralaeqlaerlakllglrvgllvgylirfestrilvvtyglllrll.........
00420882   2/2  ----------------------------------------------------------------------
00438871   1/2  l...kggrvlvltptrelaeqlaevlrkl....gikvavlhgglsqeereeileafrngeidvLvaT.dv
00420891   1/2  kll.kggqvlvfvptrelaeqlaelLrel....gikvaalhgglsqeereevlerfrsgeidvLvaTd--
00358491   1/2  llllalgkqvlvlvPtrktaeelaellre....lgikvaalhgdlsqeereeiledfrngeidvLva---
00447142   2/2  ----------------------------------------------------------------------
00432582   2/2  ----------------------------------------------------------------------
00527951   1/2  el..kgkqvlvfvntrelaeqlaell.........gvallhgdlsqkereeiledfrngeidvLvatdvl
00528231   1/2  kel.kggqvlvfvptrelaeqlaelLrel....gikvallhgglsqeeReeilerfrsgeidvLvaTd--
00473291   1/1  ----------------------------------------------------------------------
00494911   1/1  lvGppGtGKTtlaralanellrlgvlglpfvrvnasellealllsdlfgell..................
00394721   1/1  alakelaag..sgpilldgvpvvrldlsellsvsdlvgel.............................e
00493002   2/2  ----------------------------------------------------------------------
00531471   1/2  ellkel..rggkvlvfcntrklaellaelLrel....gikvavlhgglsqkereeiledfrsgeidvL--
00506762   2/2  ----------------------------------------------------------------------
00414431   1/2  ellergqpvLvftptrelaeqlaelLrkl....gikalvlhgglsqeereivleafrkg..dvlvAT---
00531462   2/2  ----------------------------------------------------------------------
00528552   2/2  ----------------------------------------------------------------------
00493011   1/2  el..rggkvlvfcntrktaeelaelLrel....gikvaalhgglsqeeReeiledfrngeidvLvaT---
00525491   1/3  ----------------------------------------------------------------------
00408261   1/2  ellkellaegeqvlvftptielaellaelLkel....gipaavlhgdlsqeereivleafrsg..dv---
00506912   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           LSPETQFKDLGLVIIDEEQRFGVEHKEALKRLRTQVDVLSMSATPIPRTLEMGLTGIREMTTILTPPEER
00525481   1/1  ----------------------------------------------------------------------
00514861   1/1  pllkadivittyqlllkdleflslrnldlviiDEaHrlknfgsklrkalkrl.kaarrlllTATPiqnnl
00381621   1/2  pellfdllrlknlglviiDEahrlgvkqreillslldnvqvlllsATpipntldlalsllrfllvid---
00381411   1/2  TpgrlldgldrlknldlviiDEahrlldsqrgpllellllgflsqlreilralppdvqvlllSATppp--
00525493   3/3  -----------------------------------------------------------------rPvdr
00506771   1/1  grlldllelsnldllviDEaHrlldmgfrkllrrlpdrqvlllsATpipnvlelllsllgllv....pdl
00381511   1/2  TpgrlldllrdlknldlvilDEahrlldeqrgpllelllmgflsqlreilralpadvqvlllSATppp--
00525471   1/2  llrgldlpnldlviiDEahrlgfrdlaqllgrlpraqvlllSATPipntlaellfglldflli..dl---
00520041   1/1  rlldlllrdlllrnldlviiDEahrldlgfgpllrlllellprpdlqllllSATpppe............
00358482   2/3  erlealrallegeadilvaTvgrlldlldpallrlgrldllvgdeadldellktllelGydrv-------
00358481   1/3  ----------------------------------------------------------------------
00381631   1/1  ......................................................................
00363171   1/3  ----------------------------------------------------------------------
00432581   1/2  nvllvapTGsGKTlvallailellerngkkvlvlvPtraLaeqiaeelkklfgilglkv-----------
00514991   1/1  elllrllelknlkfdlviiDEaHrlknrgsklrealkal.kaarrlllTATPipndl.lelfslldflip
00513321   1/1  ----------------------------------------------------------Grlspvetlyrp
00363172   2/3  dlerlsallallegepdivvatvqalldlpkpellllltltllvgdeldldellerLvelgYe-------
00527952   2/2  ------lsnlgllvlDEahrlldgfgpqlrkilellpkarqvlllsATpirevlllallllldpvvievl
00414421   1/1  ....laggadilvgTpgrllddllrdnlalslgllvlrnldllviDEahrllvde.......gfrplils
00525501   1/1  ----------------------------------------------------------------------
00527961   1/1  grlldlldlllknldlviiDEaHrllnsqlkkilkrlpdlqvlllsAT----------------------
00514851   1/1  -----TkkdvlkdLppkieivvyvelspeqkelyeallkgkdllliiideagktlvlnlllllrkicnhp
00425531   1/2  lvaTpgrllddlaargldlpnvdlvilDeahrigrtgrggdlglillllppdrqtlllSATlpnev----
00439011   1/2  TpgrllddllargldlpnvdlvildeahrigrtgrfgrkglaillllpkerqtlllSATlpeell-----
00481111   1/1  rr......laggadivvgTpgrllddylrdnhllrqedlvlrnlsllviDEaDrllddgfrtllii----
00506761   1/2  grlldlllrdllllsnldlvilDEaHrlldlgfgplllkilrrlrpdlrvlllsATpiqnvlelasllgl
00531472   2/2  -------------------------------------------------------------esltpenll
00493012   2/2  ---------------------------------------------------------------sltppnl
00528232   2/2  ----------------------------------------------------------------llppgl
00514981   1/1  -----klsnwdllvlDEahrllnmgfrsqirkilkllpkarqrllltaTpiq............llllll
00387401   1/2  grllddlaargldlpnvdlvilDeahrlgrtgrggllgkillllppdlqvlllSATlppnvlelakl---
00420892   2/2  -----------------------------------------------------------------ppdrl
00528551   1/2  TpgrlldllrrglldlsnlkllvlDEadrlldmgfgpdlrkilrrlpkdrqtlllSATlpnevlela---
00361551   1/1  ---------------------------------------llSATfpr.......................
00531461   1/2  TpgrlldlllrglldlsnlklvvlDEadrlldmgfgpdlrlilrrlppdrqtllfSATlpnevlela---
00493001   1/2  TpgrlldlllrrgldlsnlkllvlDEadrlldlgfgpdlrlilrrlpkdrqtlllSATlpnevlela---
00438872   2/2  --------------------------------------------------------------------sg
00427201   1/2  pgrllddlaargldlpnvdlvilDEadrllnydfplslesylqrlgrtgrtlllSATagnegl-------
00381422   2/2  ---------------------------------------------------------------------r
00348331   1/1  ---------------------------------------llSATp.p.......................
00358483   3/3  ----------------------------------------------------------------------
00358492   2/2  ----------------------------------------------------------------------
00377872   2/2  ---------------------------------------------------------------------g
00363182   2/2  ----------------------------------------------------------------------
00513311   1/1  rlldlllrdlllsnldllvlDEahlldlgfrlllelllellplpdlq-----------------------
00503561   1/1  glaellkelleeleideklldkilddlegilp--------------------------------------
00447141   1/2  TpgrllddlaargldlpdvdlvvlDeahrigrtgragdlgkillllppdrqtlllSATlpnevl------
00387412   2/2  --------------------------------------------------------------------rd
00525451   1/1  ----------------------------------------------------------------------
00414432   2/2  --------------------------------------------------------------rpvtrkdi
00408262   2/2  ---------------------------------------------------------------iplvrli
00381421   1/2  l....dvlarGlDipdrvdlVinydapkflvklkellkllgllldlllllatliddllrllllllevie-
00420881   1/2  rllddlla.rgldlpdvdlvilDEahrlldlgksfepyvqrigragragkdgqalllsATltpevle---
00397151   1/1  -------------------------------------------------------------llesltlen
00525472   2/2  ----------------------------------------------------------------------
00525461   1/1  ----------------------------------------------------------------------
00525492   2/3  .vaarGldipdvdlViiydlpr------------------------------------------------
00363173   3/3  -------------------------------------------------------------------ikp
00381412   2/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00506911   1/2  .gpdilvaTpgrlldllrrgkldlsnlkllvlDEadrlldmgfgpdlelilsrlprllgkdrqtll----
00427202   2/2  ----------------------------------------------------------------llsell
00363181   1/2  ----------------------------------------------------------------------
00381622   2/2  ----------------------------------------------------------------------
00439012   2/2  ----------------------------------------------------------------------
00425532   2/2  ----------------------------------------------------------------------
00387411   1/2  lgrGidlpdvdlVii-------------------------------------------------------
00387402   2/2  ----------------------------------------------------------------------
00377871   1/2  ----------------------------------------------------------------------
00348321   1/1  ...dlllsdfdliiiDEahelsaetdlllglllellelrpdlkvl-------------------------
00420882   2/2  ----------------------------------------------------------------------
00438871   1/2  lgrGldipdvdlVinyd-----------------------------------------------------
00420891   1/2  ----------------------------------------------------------------------
00358491   1/2  ----------------------------------------------------------------------
00447142   2/2  ----------------------------------------------------------------------
00432582   2/2  ----------------------------------------------------------------------
00527951   1/2  ----------------------------------------------------------------------
00528231   1/2  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00494911   1/1  ...........gallralfellrgalelakggvlflDEidrlspdvqnaLlrllee.........lpsnv
00394721   1/1  gglrglltealalakpsvlflDEidrlldardsesslevlnaLlrlledgnvlviattnrp........e
00493002   2/2  ----------------------------------------------------------------------
00531471   1/2  ----------------------------------------------------------------------
00506762   2/2  ----------------------------------------------------------------------
00414431   1/2  ----------------------------------------------------------------------
00531462   2/2  ----------------------------------------------------------------------
00528552   2/2  ----------------------------------------------------------------------
00493011   1/2  ----------------------------------------------------------------------
00525491   1/3  ----------------------------------------------------------------------
00408261   1/2  ----------------------------------------------------------------------
00506912   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           HPVLTFVGPYDEKQIAAAIRRELMREGQVFFVHNRVASIERAAATVSRLVPEARVAWAHGQMNEHQLERV
00525481   1/1  ----------------------------------------------------------------------
00514861   1/1  .eelyslldfldpgll.............gsleafrerflkpierggvvdll------------------
00381621   1/2  ----------------------------------------------------------------------
00381411   1/2  ----------------------------------------------------------------------
00525493   3/3  lqlvivvgsgkklvlllallkelekggqvlvfvptrklaeqlaelLrellpgirvallhgdlsqeereev
00506771   1/1  lkqfvlvvlkeekleallellkellalgrggkvlvfvntrktaellaelLre..lgikvaalhgllssss
00381511   1/2  ----------------------------------------------------------------------
00525471   1/2  ----------------------------------------------------------------------
00520041   1/1  ..eltlpllrldvllveeslklelllellelllelggkvlvfvnsreeaellaellre..lgikvlvlhg
00358482   2/3  ----------------------------------------------------------------------
00358481   1/3  ----------------------------------------------------------------------
00381631   1/1  ..........................................aeelaellkgikvallhgglsqeereev
00363171   1/3  ----------------------------------------------------------------------
00432581   1/2  ----------------------------------------------------------------------
00514991   1/1  gllgslrlfvetflvpi.....................................elldvealeelrkllk
00513321   1/1  ilsvevvvleekleallellkel...ggsvlvFvnsrkeveelaelLrkl..gikvavlhGg....erek
00363172   2/3  ----------------------------------------------------------------------
00527952   2/2  pelikqvvlvvpssgkleallellkel.kgkqvlvfvntrelaeqlaell.......gvallhgdlsqke
00414421   1/1  ivdtvinydlpn..........................................................
00525501   1/1  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00514851   1/1  vLllekllsa....................sqgfedflpdilqllplllllveesgKleallellkelli
00425531   1/2  ----------------------------------------------------------------------
00439011   1/2  ----------------------------------------------------------------------
00481111   1/1  ----------------------------------------------------------------------
00506761   1/2  pvpiilgrlapvd---------------------------------------------------------
00531472   2/2  qivlvvveesgklelllellkel.rggkvlvfcntrklaellaelLrel..gikvavlhgglsqkereei
00493012   2/2  kqivivveesdklelllellkel.rggkvlvfcntrktaeelaelLrel..gikvaalhgglsqeeReei
00528232   2/2  lqqllvvvtesgkleallellkelkggqvlvfvptrelaeqlaelLrel..gikvallhgglsqeeReei
00514981   1/1  dpvlidqllllveesgKleallellkellekgekvliFsqtkdtldllaelLrkl.lgikvarlhgdlsq
00387401   1/2  ----------------------------------------------------------------------
00420892   2/2  rqvlvvvgtgkklslllqllkll.kggqvlvfvptrelaeqlaelLrel..gikvaalhgglsqeereev
00528551   1/2  ----------------------------------------------------------------------
00361551   1/1  pnieqevlpvdeevkldlllrllevlrggsalvFcptreeaeqlaeeLrel..glkalalhGgls..qrr
00531461   1/2  ----------------------------------------------------------------------
00493001   1/2  ----------------------------------------------------------------------
00438872   2/2  rdvlvvaptgsgktllfllpall.kggrvlvltptrelaeqlaevlrkl..gikvavlhgglsqeereei
00427201   1/2  ----------------------------------------------------------------------
00381422   2/2  pnltqlviyvgseekleallsll..gkkvlifvptrklaeelaelL........vavlhgglsqeeReei
00348331   1/1  rpviaqavtgtgkafklplllrllevlkggqalvfcptreladqlaeeLrk..rglkvlalhggls..qr
00358483   3/3  ---lkalgpfeltpiQqeaipaileglesgprdvllvgptGtGKTltaaalalelgkqvlvlaptrelae
00358492   2/2  ----------------palllllalgkqvlvlvPtrktaeelaellre..lgikvaalhgdlsqeereei
00377872   2/2  rdvllvaptgsgKtlallpllaklkggrvlvlaptrelaeqlaellke..lgikvavlhgglsqeereei
00363182   2/2  ----------------pallrllekgkrvlvlvptrelalqlaeelkkl..gikvavlhgdlsqkereei
00513311   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00447141   1/2  ----------------------------------------------------------------------
00387412   2/2  vlvqaptgsgktlkllpllelllekggrvlvfvptrelaeqlaellrkl..gikvavlhgglsqeereev
00525451   1/1  ----------------------------------------------------------------------
00414432   2/2  pqlvyvtgsgkklalllellellergqpvLvftptrelaeqlaelLrkl..gikalvlhgglsqeereiv
00408262   2/2  kqdvlvvteegklkallellkellaegeqvlvftptielaellaelLkel..gipaavlhgdlsqeerei
00381421   1/2  ----------------------------------------------------------------------
00420881   1/2  ----------------------------------------------------------------------
00397151   1/1  iaqlvllvdgslklllllllllllrggqalvfvptrelaeqlaellrkl..gikvlalhgglsqee....
00525472   2/2  -------------vallailelllrgkrvlvlvPtrelaeqwaeelkkllpelglkvallhgglsqkere
00525461   1/1  ----------------------------------------------------------------------
00525492   2/3  ----------------------------------------------------------------------
00363173   3/3  lklispfeprpyQqeaiealleglekgkknvllvgptGtGKTltaaalaaelgkpvlivaptkeladqly
00381412   2/2  --------------allpaleallkgkrvlvlaptrelaeqiaeelrkllgelggdlklkvallhgglsl
00381512   2/2  --------------allpalelllkgkrvlvlaPtrelaeqiaeelrkllgflgldlelkvallhgglsl
00506911   1/2  ----------------------------------------------------------------------
00427202   2/2  lpvlsfedlglseellkalkklgfeeptpiQaeaipailegrdvlvqapTGsGKTlafllpllelllkll
00363181   1/2  ----------------------------------------------------------------------
00381622   2/2  -------------vallailelllrgkqvlvlvPtralaeqlaeefkklfgllglrvgllhgglskkere
00439012   2/2  -------------afllpilqlllkklkggqvlifvptrelaeqlaevlrellkflpglkvallhgglsq
00425532   2/2  -------------afllpileallkllkggkalvfaptrelaeqlaeelrklgkelglllgikvallhgg
00387411   1/2  ----------------------------------------------------------------------
00387402   2/2  -------------aallpllelllkepggkvlvfvptrelaeqlaerlkkllkllglkvgllhgglsqke
00377871   1/2  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00420882   2/2  ------llsfedlglseelldalkelfgfteltpiQaeaipailegrdvlvvapTGsGKTlayllpallr
00438871   1/2  ----------------------------------------------------------------------
00420891   1/2  ----------------------------------------------------------------------
00358491   1/2  ----------------------------------------------------------------------
00447142   2/2  --------------pvlsfeelglseellkalkklgfleptpiQaeaipailegrdvlvvapTGsGKTla
00432582   2/2  ---------------llailellerngkkvlvlvPtraLaeqiaeelkklfgilglkvavltgglskker
00527951   1/2  ----------------------------------------------------------------------
00528231   1/2  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00494911   1/1  rviattnrpel...ldpallsRflvielpppsleerleilklllekl.glelsdealealaelspgnpre
00394721   1/1  llgrleldpallrrfdv.ie--------------------------------------------------
00493002   2/2  ------------------------kgpralvlaptrelalqiaevlrkllkllglrvalltgglslkerl
00531471   1/2  ----------------------------------------------------------------------
00506762   2/2  -------------aallpilelllrggkrvlvlvPtrelaeqwaeelrkllgllglkvglltgglslker
00414431   1/2  ----------------------------------------------------------------------
00531462   2/2  --------------fllpilqlllklpkgpralvlaPtrelalqiaeelkkllkllgirvalltgglsik
00528552   2/2  --------------fllpilqlllklpkgpralvlaPtrelalqiaeelkkllkllglrvalltgglslk
00493011   1/2  ----------------------------------------------------------------------
00525491   1/3  ----------------------------------------------------------------------
00408261   1/2  ----------------------------------------------------------------------
00506912   2/2  -----------------------------------------------------rvalltggtsldeqira


                         -         -         -         +         -         -         -:980
query           MVDFWEKKFDVLVCTTIVESGLDVPNANTLIVDRADTYGLAQLHQLRGRVGRGRERAYAYFLYPPDKPLT
00525481   1/1  ----------------------------------------------------------------------
00514861   1/1  ----------------------------------------------------------------------
00381621   1/2  ----------------------------------------------------------------------
00381411   1/2  ----------------------------------------------------------------------
00525493   3/3  leafrngeidvLvaTdvaarGldipdvdlViiydlprslesylhQraGRagRagkkglaillvtpddlll
00506771   1/1  llglsqeereeiledfrngeidvLvatdvlerGlDipdvdlvinydlp.kslasyiQriGRagRagk.gl
00381511   1/2  ----------------------------------------------------------------------
00525471   1/2  ----------------------------------------------------------------------
00520041   1/1  glsqeereevle....geikvlvatdvlerGlDi.dvdlViiydlvkldvllldldlglvllllrplsla
00358482   2/3  ----------------------------------------------------------------------
00358481   1/3  ----------------------------------------------------------------------
00381631   1/1  leafrsgeidvLvaTdvlerGlDipdvdlViiydlpkslesylQrirGRagRagrdglaillvspe....
00363171   1/3  ----------------------------------------------------------------------
00432581   1/2  ----------------------------------------------------------------------
00514991   1/1  pfll------------------------------------------------------------------
00513321   1/1  vlelfkngkikvlvATdvaerGiDi.dvdlVidyglplkvkvfdgrtgverletrpislasyiQraGRaG
00363172   2/3  ----------------------------------------------------------------------
00527952   2/2  reeiledfrngeidvLvatdvlerGiDipdvdlvinldlp.kslesyvQriGRagRagkkglaillv---
00414421   1/1  ....................................................................sl
00525501   1/1  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00514851   1/1  ergekvlvFsntretlellaelLrel..gikvarlhGglsqeeReeiierFrdpdgeirvfLvstdagge
00425531   1/2  ----------------------------------------------------------------------
00439011   1/2  ----------------------------------------------------------------------
00481111   1/1  ----------------------------------------------------------------------
00506761   1/2  ----------------------------------------------------------------------
00531472   2/2  ledfrsgeidvLvaTdvlarGlDipdvdlVinydlp.kslelyiQriGRagRagqkgeaillvlpedltl
00493012   2/2  ledfrngeidvLvaTdvlarGiDipdvdlVinydlpk.slesyvQriGRagRagqkglaillvtpedlsl
00528232   2/2  lerfrsgeidvLvaTdvaarGlDipnvdlVinydlprnpalelslesyvqriGRagRagkkglaillvtp
00514981   1/1  keReeildrfrngedviviLvstdaagrGlnltganhVinydlp.wnpavyvQrigRagRiGqkgdvtvy
00387401   1/2  ----------------------------------------------------------------------
00420892   2/2  lerfrsgeidvLvaTdvlarGiDipnvdlVinydlp.kspedyiQriGRagRagqkglaillvtpe....
00528551   1/2  ----------------------------------------------------------------------
00361551   1/1  .....flngkvdvlVATdvaerGiD.pdvdfVidydlvkvpvldpdtrptlvislvvvpislesyiQRiG
00531461   1/2  ----------------------------------------------------------------------
00493001   1/2  ----------------------------------------------------------------------
00438872   2/2  leafrngeidvLvaTdvlgrGldipdvdlVinydlp.kspesyiQriGRagRagqkglailllspe....
00427201   1/2  ----------------------------------------------------------------------
00381422   2/2  lekfrngeidvLvaTaslldvlarGlDipdrvdlVinydapkflvklkellkllgllldlllllatlidd
00348331   1/1  r.....flkgkvdvlVATdvaerGiD.pdvdlVidydlvkvpvldvdtgptlllllvtlpislesyvQRi
00358483   3/3  qlaeelrelfpelpvilfldeidalpperlspssdviirvallhgglseaerlealrallegead-----
00358492   2/2  ledfrngeidvLvatdvlarGlDipdvdlvinldlpkllllqslelyiQriGRagRagkkglaillvlld
00377872   2/2  lerfrsgeikvlvaTdvlerGlDipdvdlViiydlp.kslasyiQriGRagRagqkglvillldeadlll
00363182   2/2  ledfrngeidvLvatdvlarGlDipnvdlViildlpklllllslelyiQriGRagRagkkglaillvtle
00513311   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00447141   1/2  ----------------------------------------------------------------------
00387412   2/2  leafrsgkidvLvaTdvlgrGidlpdvdlViiydlp.kspesyiQriGRagRagqkglaillldeadrtl
00525451   1/1  ----------------------------------------------------------------------
00414432   2/2  leafrkg..dvlvATdvagrGlDivLgpgvdlvinydlpkspesyvhrildllrigqlklvlvkllvlde
00408262   2/2  vleafrsg..dvlvaTdvagrGlDipnvsvvlelGgllVinydlpksleiyvQriGRagRagdkglailf
00381421   1/2  ----------------------------------------------------------------------
00420881   1/2  ----------------------------------------------------------------------
00397151   1/1  ...flsggvdvlvATdvaerGld.pdvdlVinydldlllplslesyvqriGRtGR.gkpglaillvs---
00525472   2/2  ealekfksgeadilvaTpgrllrgldlpnldlviiDEahrlgfrdlaqllgr------------------
00525461   1/1  ----------------------------------------------------------------------
00525492   2/3  ----------------------------------------------------------------------
00363173   3/3  eelkkllpelkvellhggldylqkealfpeidtlpykdaspneeidlerls-------------------
00381412   2/2  kereealerf..geadilvaTpgrlldgldrlknldlviiDEahrlldsqrgpllellllgf--------
00381512   2/2  kereealedl..geadilvaTpgrlldllrdlknldlvilDEahrlldeqrgpllelllmgf--------
00506911   1/2  ----------------------------------------------------------------------
00427202   2/2  kggqalvfvptrelaeqlaeelrkllkllgikvallhgglsqkerleil.....gkvdilvaTpgrlldd
00363181   1/2  ----------------------------------------------------------------------
00381622   2/2  eileklrsgeadilvgTpellfdllrlknlglviiDEahrlgvkqreillslld----------------
00439012   2/2  ker...leafkkgkvdilvaTpgrllddllargldlpnvdlvildeahrig.........rtgrfgr---
00425532   2/2  lsqkerlralk....gkadilvaTpgrllddlaargldlpnvdlvilDeahri.........grtg----
00387411   1/2  ----------------------------------------------------------------------
00387402   2/2  rlral.....gkadilvaTpgrllddlaargldlpnvdlvilD........eah.rlgrtgrggll----
00377871   1/2  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00420882   2/2  ggkvlvfvptrelaeqlaeelrkl..girvallhgglsqeerervleafrsgkadilvaTpg--------
00438871   1/2  ----------------------------------------------------------------------
00420891   1/2  ----------------------------------------------------------------------
00358491   1/2  ----------------------------------------------------------------------
00447142   2/2  fllpllelllkep.kggkalvfvptrelaeqlaevlrkllklllgikvallhgglsqeerlrvlk.----
00432582   2/2  lr.......gdadivvaTperldsllrrl..lddlglviiDEaHrlldkgfgpilelilknaqvlgls--
00527951   1/2  ----------------------------------------------------------------------
00528231   1/2  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00494911   1/1  llnlleraall-----------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00493002   2/2  ralk....ggadilvaTpgrlldlllrrgldlsnlkl---------------------------------
00531471   1/2  ----------------------------------------------------------------------
00506762   2/2  leal.....ggadilvttpgrlldlllrdllllsnl----------------------------------
00414431   1/2  ----------------------------------------------------------------------
00531462   2/2  erlralk....ggadilvaTpgrlldlllrglldlsnl--------------------------------
00528552   2/2  erleall...rggadilvaTpgrlldllrrglldlsnl--------------------------------
00493011   1/2  ----------------------------------------------------------------------
00525491   1/3  ----------------------------------------------------------------------
00408261   1/2  ----------------------------------------------------------------------
00506912   2/2  lkk....gpdilvaTpgrlldllrrgkldlsnlkllvl--------------------------------


                         -         *         -         -         -         -         +:1050
query           ETAHERLATVAQHTESGAGMYVAMKDLEIRGAGNILGTEQSGSIAGVGFDLYVRMVGEAVRELKGDQSAA
00525481   1/1  ----------------------------------------------------------------------
00514861   1/1  ----------------------------------------------------------------------
00381621   1/2  ----------------------------------------------------------------------
00381411   1/2  ----------------------------------------------------------------------
00525493   3/3  lralerleilrealdllpgfllalldleirglgdllgleqsgllgllgadllldlleeavellkle----
00506771   1/1  villvtp---------------------------------------------------------------
00381511   1/2  ----------------------------------------------------------------------
00525471   1/2  ----------------------------------------------------------------------
00520041   1/1  ----------------------------------------------------------------------
00358482   2/3  ----------------------------------------------------------------------
00358481   1/3  ----------------------------------------------------------------------
00381631   1/1  ..dlkllkaleellelllelllleldlllllagelllellsglielllldlflellellg----------
00363171   1/3  ----------------------------------------------------------------------
00432581   1/2  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00513321   1/1  RagkpvGtailly...deldldaipeilr.teleelvlqlkllgnllgdllslalldppirgallalgll
00363172   2/3  ----------------------------------------------------------------------
00527952   2/2  ----------------------------------------------------------------------
00414421   1/1  edyl------------------------------------------------------------------
00525501   1/1  --------------------------------------------------------------elkgeeve
00527961   1/1  ----------------------------------------------------------------------
00514851   1/1  GlDlpdadtviildpp.wnpaqyiQriGRagRiGqkkp.vtvyllvtegtiEerilellekklk------
00425531   1/2  ----------------------------------------------------------------------
00439011   1/2  ----------------------------------------------------------------------
00481111   1/1  ----------------------------------------------------------------------
00506761   1/2  ----------------------------------------------------------------------
00531472   2/2  leaieell..........gfklalldlelrglg-------------------------------------
00493012   2/2  lealeel..........lgfklalldlelrglgellgt--------------------------------
00528232   2/2  d........dlelllallellklglee-------------------------------------------
00514981   1/1  rlvtegtieekilellekklklaeqvld...glllllkdlsle---------------------------
00387401   1/2  ----------------------------------------------------------------------
00420892   2/2  .dltllekllellleklsllelaledlllrgilellgcrragllsylgedfrpdylr-------------
00528551   1/2  ----------------------------------------------------------------------
00361551   1/1  RaGRggkgsayrlvtpeedlllirieilteaalllfayeeleeatlpeilrsdleslvle----------
00531461   1/2  ----------------------------------------------------------------------
00493001   1/2  ----------------------------------------------------------------------
00438872   2/2  .....dllllralielllgkklalldlelrgigellgte-------------------------------
00427201   1/2  ----------------------------------------------------------------------
00381422   2/2  llrllllllevieeirellkellldeevlekllnl-----------------------------------
00348331   1/1  GRaGR.gkpGvaillyspedllllraldllteaalll---------------------------------
00358483   3/3  ----------------------------------------------------------------------
00358492   2/2  .....................dllllallelllrralellglell-------------------------
00377872   2/2  leallell..........rrklelldlelrglge------------------------------------
00363182   2/2  dllllrallellkralellvllllglilaell--------------------------------------
00513311   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00447141   1/2  ----------------------------------------------------------------------
00387412   2/2  lekllellekklellp------------------------------------------------------
00525451   1/1  ----------------------------------------------------------------------
00414432   2/2  adevld----------------------------------------------------------------
00408262   2/2  vsledl----------------------------------------------------------------
00381421   1/2  ----------------------------------------------------------------------
00420881   1/2  ----------------------------------------------------------------------
00397151   1/1  ----------------------------------------------------------------------
00525472   2/2  ----------------------------------------------------------------------
00525461   1/1  ----------------------------------------------------------------------
00525492   2/3  ----------------------------------------------------------------------
00363173   3/3  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00506911   1/2  ----------------------------------------------------------------------
00427202   2/2  ----------------------------------------------------------------------
00363181   1/2  ----------------------------------------------------------------------
00381622   2/2  ----------------------------------------------------------------------
00439012   2/2  ----------------------------------------------------------------------
00425532   2/2  ----------------------------------------------------------------------
00387411   1/2  ----------------------------------------------------------------------
00387402   2/2  ----------------------------------------------------------------------
00377871   1/2  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00420882   2/2  ----------------------------------------------------------------------
00438871   1/2  ----------------------------------------------------------------------
00420891   1/2  ----------------------------------------------------------------------
00358491   1/2  ----------------------------------------------------------------------
00447142   2/2  ----------------------------------------------------------------------
00432582   2/2  ----------------------------------------------------------------------
00527951   1/2  ----------------------------------------------------------------------
00528231   1/2  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00493002   2/2  ----------------------------------------------------------------------
00531471   1/2  ----------------------------------------------------------------------
00506762   2/2  ----------------------------------------------------------------------
00414431   1/2  ----------------------------------------------------------------------
00531462   2/2  ----------------------------------------------------------------------
00528552   2/2  ----------------------------------------------------------------------
00493011   1/2  ----------------------------------------------------------------------
00525491   1/3  ----------------------------------------------------------------------
00408261   1/2  ----------------------------------------------------------------------
00506912   2/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:1120
query           QEVETKVELPINAHIPHDYVPGERLRLEAYRRIAEVASEDDIAAIREELLDRYGEPPQPVDNLLAVARFR
00525481   1/1  ----------------------------------------------------------------------
00514861   1/1  ----------------------------------------------------------------------
00381621   1/2  ----------------------------------------------------------------------
00381411   1/2  ----------------------------------------------------------------------
00525493   3/3  ----------------------------------------------------------------------
00506771   1/1  ----------------------------------------------------------------------
00381511   1/2  ----------------------------------------------------------------------
00525471   1/2  ----------------------------------------------------------------------
00520041   1/1  ----------------------------------------------------------------------
00358482   2/3  ----------------------------------------------------------------------
00358481   1/3  ----------------------------------------------------------------------
00381631   1/1  ----------------------------------------------------------------------
00363171   1/3  ----------------------------------------------------------------------
00432581   1/2  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00513321   1/1  qslgalddleltdlglhlailpllkllslvllipdffklldlvllivallvlklllrleld---------
00363172   2/3  ----------------------------------------------------------------------
00527952   2/2  ----------------------------------------------------------------------
00414421   1/1  ----------------------------------------------------------------------
00525501   1/1  evveteidlgvdaliPedYipdvrlRlelYkrlasaeseeeleelaeeliDRFGelPeevenLlevarlk
00527961   1/1  ----------------------------------------------------------------------
00514851   1/1  ----------------------------------------------------------------------
00425531   1/2  ----------------------------------------------------------------------
00439011   1/2  ----------------------------------------------------------------------
00481111   1/1  ----------------------------------------------------------------------
00506761   1/2  ----------------------------------------------------------------------
00531472   2/2  ----------------------------------------------------------------------
00493012   2/2  ----------------------------------------------------------------------
00528232   2/2  ----------------------------------------------------------------------
00514981   1/1  ----------------------------------------------------------------------
00387401   1/2  ----------------------------------------------------------------------
00420892   2/2  ----------------------------------------------------------------------
00528551   1/2  ----------------------------------------------------------------------
00361551   1/1  ----------------------------------------------------------------------
00531461   1/2  ----------------------------------------------------------------------
00493001   1/2  ----------------------------------------------------------------------
00438872   2/2  ----------------------------------------------------------------------
00427201   1/2  ----------------------------------------------------------------------
00381422   2/2  ----------------------------------------------------------------------
00348331   1/1  ----------------------------------------------------------------------
00358483   3/3  ----------------------------------------------------------------------
00358492   2/2  ----------------------------------------------------------------------
00377872   2/2  ----------------------------------------------------------------------
00363182   2/2  ----------------------------------------------------------------------
00513311   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00447141   1/2  ----------------------------------------------------------------------
00387412   2/2  ----------------------------------------------------------------------
00525451   1/1  ----------------------------------------------------------------------
00414432   2/2  ----------------------------------------------------------------------
00408262   2/2  ----------------------------------------------------------------------
00381421   1/2  ----------------------------------------------------------------------
00420881   1/2  ----------------------------------------------------------------------
00397151   1/1  ----------------------------------------------------------------------
00525472   2/2  ----------------------------------------------------------------------
00525461   1/1  ----------------------------------------------------------------------
00525492   2/3  ----------------------------------------------------------------------
00363173   3/3  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00506911   1/2  ----------------------------------------------------------------------
00427202   2/2  ----------------------------------------------------------------------
00363181   1/2  ----------------------------------------------------------------------
00381622   2/2  ----------------------------------------------------------------------
00439012   2/2  ----------------------------------------------------------------------
00425532   2/2  ----------------------------------------------------------------------
00387411   1/2  ----------------------------------------------------------------------
00387402   2/2  ----------------------------------------------------------------------
00377871   1/2  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00420882   2/2  ----------------------------------------------------------------------
00438871   1/2  ----------------------------------------------------------------------
00420891   1/2  ----------------------------------------------------------------------
00358491   1/2  ----------------------------------------------------------------------
00447142   2/2  ----------------------------------------------------------------------
00432582   2/2  ----------------------------------------------------------------------
00527951   1/2  ----------------------------------------------------------------------
00528231   1/2  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00493002   2/2  ----------------------------------------------------------------------
00531471   1/2  ----------------------------------------------------------------------
00506762   2/2  ----------------------------------------------------------------------
00414431   1/2  ----------------------------------------------------------------------
00531462   2/2  ----------------------------------------------------------------------
00528552   2/2  ----------------------------------------------------------------------
00493011   1/2  ----------------------------------------------------------------------
00525491   1/3  ----------------------------------------------------------------------
00408261   1/2  ----------------------------------------------------------------------
00506912   2/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:1190
query           VLARSAGLTDVVLQGTQIRFAPVELRESQQLRLRRLYPKAVVKAATRTLMVPVPKSGGLGGKQLRDRELL
00525481   1/1  ----------------------------------------------------------------------
00514861   1/1  ----------------------------------------------------------------------
00381621   1/2  ----------------------------------------------------------------------
00381411   1/2  ----------------------------------------------------------------------
00525493   3/3  ----------------------------------------------------------------------
00506771   1/1  ----------------------------------------------------------------------
00381511   1/2  ----------------------------------------------------------------------
00525471   1/2  ----------------------------------------------------------------------
00520041   1/1  ----------------------------------------------------------------------
00358482   2/3  ----------------------------------------------------------------------
00358481   1/3  ----------------------------------------------------------------------
00381631   1/1  ----------------------------------------------------------------------
00363171   1/3  ----------------------------------------------------------------------
00432581   1/2  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00513321   1/1  ----------------------------------------------------------------------
00363172   2/3  ----------------------------------------------------------------------
00527952   2/2  ----------------------------------------------------------------------
00414421   1/1  ----------------------------------------------------------------------
00525501   1/1  llakklgiekielggkgivlefledasldpllllkllqklplrlklk.....gdlklvlllklldleerl
00527961   1/1  ----------------------------------------------------------------------
00514851   1/1  ----------------------------------------------------------------------
00425531   1/2  ----------------------------------------------------------------------
00439011   1/2  ----------------------------------------------------------------------
00481111   1/1  ----------------------------------------------------------------------
00506761   1/2  ----------------------------------------------------------------------
00531472   2/2  ----------------------------------------------------------------------
00493012   2/2  ----------------------------------------------------------------------
00528232   2/2  ----------------------------------------------------------------------
00514981   1/1  ----------------------------------------------------------------------
00387401   1/2  ----------------------------------------------------------------------
00420892   2/2  ----------------------------------------------------------------------
00528551   1/2  ----------------------------------------------------------------------
00361551   1/1  ----------------------------------------------------------------------
00531461   1/2  ----------------------------------------------------------------------
00493001   1/2  ----------------------------------------------------------------------
00438872   2/2  ----------------------------------------------------------------------
00427201   1/2  ----------------------------------------------------------------------
00381422   2/2  ----------------------------------------------------------------------
00348331   1/1  ----------------------------------------------------------------------
00358483   3/3  ----------------------------------------------------------------------
00358492   2/2  ----------------------------------------------------------------------
00377872   2/2  ----------------------------------------------------------------------
00363182   2/2  ----------------------------------------------------------------------
00513311   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00447141   1/2  ----------------------------------------------------------------------
00387412   2/2  ----------------------------------------------------------------------
00525451   1/1  ----------------------------------------------------------------------
00414432   2/2  ----------------------------------------------------------------------
00408262   2/2  ----------------------------------------------------------------------
00381421   1/2  ----------------------------------------------------------------------
00420881   1/2  ----------------------------------------------------------------------
00397151   1/1  ----------------------------------------------------------------------
00525472   2/2  ----------------------------------------------------------------------
00525461   1/1  ----------------------------------------------------------------------
00525492   2/3  ----------------------------------------------------------------------
00363173   3/3  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00506911   1/2  ----------------------------------------------------------------------
00427202   2/2  ----------------------------------------------------------------------
00363181   1/2  ----------------------------------------------------------------------
00381622   2/2  ----------------------------------------------------------------------
00439012   2/2  ----------------------------------------------------------------------
00425532   2/2  ----------------------------------------------------------------------
00387411   1/2  ----------------------------------------------------------------------
00387402   2/2  ----------------------------------------------------------------------
00377871   1/2  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00420882   2/2  ----------------------------------------------------------------------
00438871   1/2  ----------------------------------------------------------------------
00420891   1/2  ----------------------------------------------------------------------
00358491   1/2  ----------------------------------------------------------------------
00447142   2/2  ----------------------------------------------------------------------
00432582   2/2  ----------------------------------------------------------------------
00527951   1/2  ----------------------------------------------------------------------
00528231   1/2  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00493002   2/2  ----------------------------------------------------------------------
00531471   1/2  ----------------------------------------------------------------------
00506762   2/2  ----------------------------------------------------------------------
00414431   1/2  ----------------------------------------------------------------------
00531462   2/2  ----------------------------------------------------------------------
00528552   2/2  ----------------------------------------------------------------------
00493011   1/2  ----------------------------------------------------------------------
00525491   1/3  ----------------------------------------------------------------------
00408261   1/2  ----------------------------------------------------------------------
00506912   2/2  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:1260
query           TWCTELVEAIFEPQRKPPQE--------------------------------------------------
00525481   1/1  ----------------------------------------------------------------------
00514861   1/1  ----------------------------------------------------------------------
00381621   1/2  ----------------------------------------------------------------------
00381411   1/2  ----------------------------------------------------------------------
00525493   3/3  ----------------------------------------------------------------------
00506771   1/1  ----------------------------------------------------------------------
00381511   1/2  ----------------------------------------------------------------------
00525471   1/2  ----------------------------------------------------------------------
00520041   1/1  ----------------------------------------------------------------------
00358482   2/3  ----------------------------------------------------------------------
00358481   1/3  ----------------------------------------------------------------------
00381631   1/1  ----------------------------------------------------------------------
00363171   1/3  ----------------------------------------------------------------------
00432581   1/2  ----------------------------------------------------------------------
00514991   1/1  ----------------------------------------------------------------------
00513321   1/1  ----------------------------------------------------------------------
00363172   2/3  ----------------------------------------------------------------------
00527952   2/2  ----------------------------------------------------------------------
00414421   1/1  ----------------------------------------------------------------------
00525501   1/1  elllellelLaelle-------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00514851   1/1  ----------------------------------------------------------------------
00425531   1/2  ----------------------------------------------------------------------
00439011   1/2  ----------------------------------------------------------------------
00481111   1/1  ----------------------------------------------------------------------
00506761   1/2  ----------------------------------------------------------------------
00531472   2/2  ----------------------------------------------------------------------
00493012   2/2  ----------------------------------------------------------------------
00528232   2/2  ----------------------------------------------------------------------
00514981   1/1  ----------------------------------------------------------------------
00387401   1/2  ----------------------------------------------------------------------
00420892   2/2  ----------------------------------------------------------------------
00528551   1/2  ----------------------------------------------------------------------
00361551   1/1  ----------------------------------------------------------------------
00531461   1/2  ----------------------------------------------------------------------
00493001   1/2  ----------------------------------------------------------------------
00438872   2/2  ----------------------------------------------------------------------
00427201   1/2  ----------------------------------------------------------------------
00381422   2/2  ----------------------------------------------------------------------
00348331   1/1  ----------------------------------------------------------------------
00358483   3/3  ----------------------------------------------------------------------
00358492   2/2  ----------------------------------------------------------------------
00377872   2/2  ----------------------------------------------------------------------
00363182   2/2  ----------------------------------------------------------------------
00513311   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00447141   1/2  ----------------------------------------------------------------------
00387412   2/2  ----------------------------------------------------------------------
00525451   1/1  ----------------------------------------------------------------------
00414432   2/2  ----------------------------------------------------------------------
00408262   2/2  ----------------------------------------------------------------------
00381421   1/2  ----------------------------------------------------------------------
00420881   1/2  ----------------------------------------------------------------------
00397151   1/1  ----------------------------------------------------------------------
00525472   2/2  ----------------------------------------------------------------------
00525461   1/1  ----------------------------------------------------------------------
00525492   2/3  ----------------------------------------------------------------------
00363173   3/3  ----------------------------------------------------------------------
00381412   2/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00506911   1/2  ----------------------------------------------------------------------
00427202   2/2  ----------------------------------------------------------------------
00363181   1/2  ----------------------------------------------------------------------
00381622   2/2  ----------------------------------------------------------------------
00439012   2/2  ----------------------------------------------------------------------
00425532   2/2  ----------------------------------------------------------------------
00387411   1/2  ----------------------------------------------------------------------
00387402   2/2  ----------------------------------------------------------------------
00377871   1/2  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00420882   2/2  ----------------------------------------------------------------------
00438871   1/2  ----------------------------------------------------------------------
00420891   1/2  ----------------------------------------------------------------------
00358491   1/2  ----------------------------------------------------------------------
00447142   2/2  ----------------------------------------------------------------------
00432582   2/2  ----------------------------------------------------------------------
00527951   1/2  ----------------------------------------------------------------------
00528231   1/2  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00493002   2/2  ----------------------------------------------------------------------
00531471   1/2  ----------------------------------------------------------------------
00506762   2/2  ----------------------------------------------------------------------
00414431   1/2  ----------------------------------------------------------------------
00531462   2/2  ----------------------------------------------------------------------
00528552   2/2  ----------------------------------------------------------------------
00493011   1/2  ----------------------------------------------------------------------
00525491   1/3  ----------------------------------------------------------------------
00408261   1/2  ----------------------------------------------------------------------
00506912   2/2  ----------------------------------------------------------------------