[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ54538.1


[Show Plain Result]

## Summary of Sequence Search
   1::490
  22::314    2e-64 33.7% 0038659 00386591 1/1   in kinase-like (PK-like)                
  31::381  4.5e-64 29.5% 0041927 00419271 1/1   in kinase-like (PK-like)                
  18::343  2.2e-63 31.2% 0040302 00403021 1/1   in kinase-like (PK-like)                
  11::307  2.9e-61 33.3% 0044924 00449241 1/1   in kinase-like (PK-like)                
  31::341  1.1e-60 32.5% 0037714 00377141 1/1   in kinase-like (PK-like)                
  30::358  1.5e-60 29.8% 0041710 00417101 1/1   in kinase-like (PK-like)                
  26::325  8.1e-60 33.0% 0034801 00348011 1/1   in kinase-like (PK-like)                
   9::352  9.4e-60 28.2% 0040179 00401791 1/1   in kinase-like (PK-like)                
   6::352  9.6e-60 29.2% 0040180 00401801 1/1   in kinase-like (PK-like)                
  15::306  1.1e-59 34.4% 0037369 00373691 1/1   in kinase-like (PK-like)                
  29::306  2.7e-59 34.7% 0049348 00493481 1/1   in kinase-like (PK-like)                
   3::338  4.6e-58 29.4% 0035157 00351571 1/1   in kinase-like (PK-like)                
  25::308  5.7e-58 34.9% 0038373 00383731 1/1   in kinase-like (PK-like)                
   6::291  3.6e-57 31.3% 0035371 00353711 1/1   in kinase-like (PK-like)                
  30::341  8.5e-57 32.6% 0044036 00440361 1/1   in kinase-like (PK-like)                
  21::303  9.5e-57 34.2% 0039145 00391451 1/1   in kinase-like (PK-like)                
   8::306  1.7e-56 30.6% 0043074 00430741 1/1   in kinase-like (PK-like)                
  28::306  4.9e-56 33.0% 0036031 00360311 1/1   in kinase-like (PK-like)                
  24::307    1e-55 33.6% 0049347 00493471 1/1   in kinase-like (PK-like)                
  22::283  1.8e-55 34.2% 0040670 00406701 1/1   in kinase-like (PK-like)                
  25::304  1.9e-55 34.8% 0039603 00396031 1/1   in kinase-like (PK-like)                
  19::298  2.1e-55 34.2% 0042707 00427071 1/1   in kinase-like (PK-like)                
  33::347  6.7e-55 29.2% 0050990 00509901 1/1   in kinase-like (PK-like)                
  33::297  9.4e-55 33.8% 0047088 00470881 1/1   in kinase-like (PK-like)                
  28::290  1.4e-54 38.0% 0041719 00417191 1/1   in kinase-like (PK-like)                
  22::291  2.9e-54 35.1% 0042918 00429181 1/1   in kinase-like (PK-like)                
  27::282  3.2e-54 35.8% 0047734 00477341 1/1   in kinase-like (PK-like)                
  28::299  3.9e-54 35.9% 0041048 00410481 1/1   in kinase-like (PK-like)                
  17::281  4.2e-54 34.7% 0046180 00461801 1/1   in kinase-like (PK-like)                
  27::281  9.6e-54 34.3% 0048785 00487851 1/1   in kinase-like (PK-like)                
  19::281  1.5e-53 36.0% 0044407 00444071 1/1   in kinase-like (PK-like)                
   9::295    2e-53 34.0% 0039686 00396861 1/1   in kinase-like (PK-like)                
  18::300  2.1e-53 33.8% 0037668 00376681 1/1   in kinase-like (PK-like)                
  20::324  2.2e-53 30.6% 0049795 00497951 1/1   in kinase-like (PK-like)                
  22::291  2.4e-53 34.3% 0037572 00375721 1/1   in kinase-like (PK-like)                
  25::312    3e-53 31.6% 0037803 00378031 1/1   in kinase-like (PK-like)                
  30::293    3e-53 35.2% 0048206 00482061 1/1   in kinase-like (PK-like)                
  22::291  3.2e-53 34.3% 0044907 00449071 1/1   in kinase-like (PK-like)                
  22::290  3.4e-53 34.8% 0046998 00469981 1/1   in kinase-like (PK-like)                
  27::287  4.1e-53 37.3% 0044203 00442031 1/1   in kinase-like (PK-like)                
  15::281    5e-53 35.9% 0038477 00384771 1/1   in kinase-like (PK-like)                
  29::296  6.3e-53 37.2% 0038940 00389401 1/1   in kinase-like (PK-like)                
  28::294  6.4e-53 35.6% 0035615 00356151 1/1   in kinase-like (PK-like)                
  18::281  1.2e-52 32.8% 0051877 00518771 1/1   in kinase-like (PK-like)                
  31::280  1.3e-52 35.7% 0053164 00531641 1/1   in kinase-like (PK-like)                
  32::283  1.7e-52 37.8% 0042315 00423151 1/1   in kinase-like (PK-like)                
  27::292  2.8e-52 35.9% 0044547 00445471 1/1   in kinase-like (PK-like)                
  33::281  2.9e-52 36.8% 0041767 00417671 1/1   in kinase-like (PK-like)                
  31::300  3.2e-52 34.6% 0051133 00511331 1/1   in kinase-like (PK-like)                
  27::309  3.9e-52 34.8% 0049786 00497861 1/1   in kinase-like (PK-like)                
  17::281  4.3e-52 33.2% 0052889 00528891 1/1   in kinase-like (PK-like)                
  20::335  4.7e-52 29.4% 0040727 00407271 1/1   in kinase-like (PK-like)                
  31::283  2.3e-51 37.1% 0041095 00410951 1/1   in kinase-like (PK-like)                
  24::282  2.4e-51 36.0% 0049538 00495381 1/1   in kinase-like (PK-like)                
  30::305  4.1e-51 34.0% 0050905 00509051 1/1   in kinase-like (PK-like)                
  14::283    6e-51 33.2% 0042354 00423541 1/1   in kinase-like (PK-like)                
  19::289  8.8e-51 35.2% 0037731 00377311 1/1   in kinase-like (PK-like)                
  33::283  9.5e-51 36.9% 0043269 00432691 1/1   in kinase-like (PK-like)                
  37::301  1.2e-50 33.6% 0049834 00498341 1/1   in kinase-like (PK-like)                
  33::292  1.8e-50 34.0% 0048011 00480111 1/1   in kinase-like (PK-like)                
  34::284  1.8e-50 35.1% 0046210 00462101 1/1   in kinase-like (PK-like)                
  33::298  2.2e-49 36.3% 0039792 00397921 1/1   in kinase-like (PK-like)                
  29::291  3.4e-49 35.7% 0046042 00460421 1/1   in kinase-like (PK-like)                
  34::281  4.8e-49 37.4% 0038413 00384131 1/1   in kinase-like (PK-like)                
  30::290  5.8e-49 35.8% 0043658 00436581 1/1   in kinase-like (PK-like)                
  31::283  1.4e-47 36.5% 0039870 00398701 1/1   in kinase-like (PK-like)                
  35::219  8.5e-42 42.5% 0044090 00440901 1/1   in kinase-like (PK-like)                
  24::223  1.8e-23 29.5% 0041315 00413151 1/1   in kinase-like (PK-like)                
  19::206  3.4e-22 32.7% 0039408 00394081 1/1   in kinase-like (PK-like)                
  35::180  9.5e-13 25.5% 0041592 00415921 1/1   in kinase-like (PK-like)                
   1::490


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPAASQDNDGGPSQSGGPMADPAPLIDTDPARIGEYTLLGRLGQGGQGVVYLGSAPDGARVAVKTLHRDA
00386591   1/1  ---------------------glfsllelelltdryellkklGeGgfGtVylardlltgrlvAvKvlkk.
00419271   1/1  ------------------------------latddyellellGkGgfGvVylardkltgelvAvKvlkke
00403021   1/1  -----------------ddellllsllelellldryellkllGeGgfGvVylardlltgrlvAvKvlkke
00449241   1/1  ----------dssllllllllllllllelllllddyellkllGeGgfGvVylarlkllsstgrlvAvKvl
00377141   1/1  ------------------------------lalddyellkllGeGgfGvVylarlkltgrlvAvKvlkks
00417101   1/1  -----------------------------elllddyellkllGeGgfGvVylarlkltgrlvAvKvlkke
00348011   1/1  -------------------------leelelllddyellkllGeGgfGvVylarlkltgrlvAvKvlkks
00401791   1/1  --------lsssssllllllllllsllelelllddyellkvlGeGgfGvVylardkltgrlvAvKvlkke
00401801   1/1  -----lsslslllsllllllllllsllelelltddyellkvLGeGgfGvVylardlltgrlvAvKvlkke
00373691   1/1  --------------sslllllllllllelllllddyellellGeGgfGvVylarlkltgrlvAvKvlkke
00493481   1/1  ----------------------------lelllddyellellGeGgfGvVylardlktgrlvAvKvlkks
00351571   1/1  --sssllllllllllllllllllllllelelllddyellkllGeGgfGkVylardkstgrlvAvKvlkke
00383731   1/1  ------------------------slselllllddyellkllGeGgfGvVylarlkltgrlvAvKvlkke
00353711   1/1  -----ssllsllllllllllllllsllelelatddfellellGeGgfGtVykarl.tgelvAvKvlk...
00440361   1/1  -----------------------------ellldryellkllGeGgfGvVylardlltgrlvAvKvlkk.
00391451   1/1  --------------------lklfsleelelatddyellellGeGgfGvVylarlklllgsltgrlvAvK
00430741   1/1  -------ssslslllllllllllfsllelelatddyellellGeGgfGtVykarlkdtgllgrlvAvKvl
00360311   1/1  ---------------------------elellldryellkllGeGgfGtVylardlltgrlvAvKvlkkd
00493471   1/1  -----------------------fsleelllalddyellellGeGgfGvVylardlktgrlvAvKvlkks
00406701   1/1  ---------------------klfsleelelatddyellellGeGgfGvVykarlklllgsstgrlvAvK
00396031   1/1  ------------------------slselelllddyellkllGeGgfGvVylarlkltgrlvAvKvlkks
00427071   1/1  ------------------ssllllsllelelatddyellellGeGgfGvVylarlktgrlvAvKvlkk..
00509901   1/1  --------------------------------lddyellkllGeGgfGvVylardkltgrlvAvKvlkks
00470881   1/1  --------------------------------lddyellellGeGgfGvVylardlltgrlvAvKvlkks
00417191   1/1  ---------------------------elelllddyellkllgeGgfgvVylarlkltgrlvAvKvlkkd
00429181   1/1  ---------------------klfslselllatddyellellGeGgfGvVylavlktgrlvAvKvlkk..
00477341   1/1  --------------------------ldseleialddyellkllGeGgfgtVylardkkllglltgrlva
00410481   1/1  ---------------------------elelatddyellellGeGgfGvVykavlkdtggllgrlvAvKv
00461801   1/1  ----------------esgllplsllselgeildryellkklGeGgfgtVylardkktgelvAvKvlkks
00487851   1/1  --------------------------selellldryellkklGeGgfgtVylardkktgrlvAvKvlkks
00444071   1/1  ------------------dslrlfsllelelltdryellkllGeGgfGvVylardkktgrlvAvKvlkke
00396861   1/1  --------ssslllllllllllllsllelelatddfellellGeGgfGtVylarlkllsstgrlvAvKvl
00376681   1/1  -----------------sssllllsllelelatddyellellGeGgfGvVylarlktgrlvAvKvlkk..
00497951   1/1  -------------------llllfsleelllalddyellkllGeGgfGvVylardlltgrlvAvKvlkks
00375721   1/1  ---------------------klfslselelatddyellellGeGgfGvVylarlkllsllllstgrlvA
00378031   1/1  ------------------------sleelelatddyellellGeGgfGvVykarlkdtgssrlvAvKvlk
00482061   1/1  -----------------------------elelllddyellkllgeGgfgtvylardklldktgrlvavK
00449071   1/1  ---------------------klfsleelelatddyellellGeGgfGvVykarllllldlltgrlvAvK
00469981   1/1  ---------------------elpllseleillddyellkllGeGgfgtVylardkglldllsktgelva
00442031   1/1  --------------------------eelllatddyellellGeGgfGvVylavlkllsltgrlvAvKvl
00384771   1/1  --------------sslllelllfsllelelatdryellkvlGeGgfGtVylarlketgrlvAvKvlkkd
00389401   1/1  ----------------------------lelllddyellkllGeGgfGvVylavlkltgrlvAvKvlkks
00356151   1/1  ---------------------------elelltddyellellGeGgfGvVylarlkdtsgrlvAvKvlkk
00518771   1/1  -----------------ldllgllsllllellldryellkllGeGgfGvVylardlktgrlvAiKvlkks
00531641   1/1  ------------------------------lllddyellellGeGgfgvVylardlltgrlvAvKvlkks
00423151   1/1  -------------------------------llddyellkllgeGgfgvVylarlkltgrlvAvKvlkks
00445471   1/1  --------------------------eelelatddyellellgeGgfgvVylavl..grlvAvKvlkksl
00417671   1/1  --------------------------------lddyellellGeGgfGvVylarlktgrlvAvKvlkksl
00511331   1/1  ------------------------------lllddyellkllgeGgfgvVylardlltgrlvAiKvlkks
00497861   1/1  --------------------------selllalddyellklllGeGgfgtVylardkktgelllvavKvl
00528891   1/1  ----------------lldllglllllllellldryellkllGeGgfGvVylardlktgrlvAvKvlkke
00407271   1/1  -------------------glklfsleelelatddyellkllGeGgfGtVykarlkltgellellvAvKv
00410951   1/1  ------------------------------lllddyellkllgeGgfgvVylavlkltgrlvAvKvlkks
00495381   1/1  -----------------------llslsegellgdyel..llgeGgfgtVylardlktgelvavKvlkks
00509051   1/1  -----------------------------leldlddyelelkllgeGgfgtVylardkktgelllvavKv
00423541   1/1  -------------sllllslllllsllelelatddyellellGeGgfGkVykarlkgllgsltgrlvAvK
00377311   1/1  ------------------ssllllsllelllatddyellellGeGgfGvVylavlkltgrlvAvKvlkk.
00432691   1/1  --------------------------------tddyellkvlGeGgfGkVykarlklllgsstgrlvAvK
00498341   1/1  ------------------------------------ellkllGeGgfGvVylarlkltgrlvAvKvlkks
00480111   1/1  --------------------------------ssssllldlellllldlllllsllelellldryellkk
00462101   1/1  ---------------------------------DllggrykllkklgeGgfgtvylardlktgelvavKv
00397921   1/1  --------------------------------ldryellkklGeGgfGtVylardlltgelvAvKvlkk.
00460421   1/1  ----------------------------glelalddyellkllgeGgfgtVylard.tgelvavKvlk..
00384131   1/1  ---------------------------------ddyellellGeGgfGvVylarlkltgrlvAvKvlkkd
00436581   1/1  -----------------------------elalddyellellGeGgfGvVylavlktgrlvavKvlkk..
00398701   1/1  ------------------------------lalddyellellgeGgfgvVylavlktgrlvAvKvlkk..
00440901   1/1  ----------------------------------ryellkllgsGsfgvvylardktgrlvavKvlrkgl
00413151   1/1  -----------------------ellaellpllggllvlevlgggssnrvyrvttddggdyvlKvappg.
00394081   1/1  ------------------Msvlt..idelfellggyeivellgggsfnkvylvtl.dggkvvlKvlrpg.
00415921   1/1  ----------------------------------gvvllvsvklgldpvlpldvfpedalelilellvpl


                         -         -         *         -         -         -         -:140
query           LDLPGLREQLAEEVEMARRVARFCTAQVLAADLDADPPYVVSEYVEGPSLQAVVRERGPLRGASLERLAV
00386591   1/1  ...sekllerflrEieilkrlseldlslllllghpnivrllgvfeegdsnglhlylvmEyl.ggsLfdll
00419271   1/1  lllseellerflrEieilkrlsslnhpnivrllgvfededelylvmEyveggsLfdllkkrgplseeeal
00403021   1/1  ........erflrEieilkrlsnhpnivrllgvfedlldgegelylvmEyveggsLfdllkkrgglplse
00449241   1/1  kksllllseellerflrEieilkrlrghpnivkllgvfededelylvmEyveggsLfdllkkrgplseee
00377141   1/1  lllsekllerflrEieilkrlnhpnivkllgvfldedelylvmEyveggsLldllrkrgplseeealria
00417101   1/1  lllseellerflrEieilkrlrhpnivkllgvfedddelylvmEyveggsLfdllkkrgplseeealria
00348011   1/1  s..degllerflrEieilkrlnhpnivkllgvfeddgelylvmEyveggsLldllkkrgplseeealria
00401791   1/1  ...sekllerflrEieilkrlnhpnivrllgvfedddelylvmEympggsLfdllkkrggplseeealki
00401801   1/1  ...sekllerflrEieilkrlnhpnivkllgvfedddelylvmEyveggsLldllkkrglplseeealri
00373691   1/1  ...seellerflrEieilkrlnhpnivkllgvfldddelylvmEyveggsLldllkk.gplseelalkia
00493481   1/1  l..degllerflrEieilarlnhpnivkllgvfeddgelylvmEyleggsLldllkkrgplseeealkia
00351571   1/1  llldekllerflrEieilkrlnhpnivkllgvfedegelylvmEyveggsLfdllrkrgplseeealria
00383731   1/1  lllsekllerflrEieilkrlnhpnivkllgvfldddelylvmEyveggsLldllkkrgplseelalria
00353711   1/1  ...kellkeflrEieilelkrlrhpnivrllgvcldedggllelylvmEympggsLldllrk.gplseee
00440361   1/1  ...sekllerflrEieilkrlnhpnivrllgvfedddelylvmEyveggsLldllkkrggplseeealri
00391451   1/1  vlkksl..seelleeflrEveilkrlrhpnivrllgvcldgdelylvmEymeggsLldllrkrgllllll
00430741   1/1  kksl..seelleeflrEieilsrlrhpnivkllgvcldeedelylvmEympggsLldllrkrggplseel
00360311   1/1  .....kllerflrEieilkrlnhhpnivkllgvfleddylylvmeyl.ggsLldllkkrggplseetvlr
00493471   1/1  l..degllerflrEieilarlnhpnivklygvfedegelylvmEyleggsLldllkkrgplseeealkia
00406701   1/1  vlkksl..seellkeflrEieilsrlrhpnivrllgvcleggelylvmEympggsLldllrkrgllllll
00396031   1/1  lldlllsekllerflrEieilkrlnhpnivkllgvfedddelylvmEyveggsLldllkkrgplseeeal
00427071   1/1  ..seelleeflrEieilkrlrhpnivkllgvf.eedelylvmEymeggsLldllrkrkggplseelllri
00509901   1/1  llldekllerflrEieilkrllnhpnivklygvfedegllylvmEyleggdLldllkkrgplseeealli
00470881   1/1  ll.seellerflrEikilkklnhpnivklldvfedegllylvmEyl.ggdLldllkklkggplseelall
00417191   1/1  llldeellerflrEveilkrlrhpnivrllgvfleedldllllylvmEyveggsLldllrkrgplseela
00429181   1/1  ..seelleeflrEieilkrlrhpnivrllgvc.eddelylvmEymeggsLldllrkrgglplseelllri
00477341   1/1  vKvlkks..lseellerflrEieilkklrhpnivkllgvfededelylvmeyleggsLldllkkrgrkgl
00410481   1/1  lkksl..seellkeflrEieilsrlrhpnivrllgvcldddelylvmEymeggsLldllrkrkgplseel
00461801   1/1  l.lseellerflrEieilkklnhpnivkllgvfedesllgllgylylvmEyc.ggsLldll.kkgplsee
00487851   1/1  l..seellerflrEieilkrlnhpnivkllgvfededlnglgelylvmEyl.ggsLldllkk.gklseee
00444071   1/1  ll.dekllerflrEieilkrlnhpnivrllgvfededslglllelylvmEym.ggsLldll..kgplsee
00396861   1/1  kksl..seelleeflrEveilsrlrhpnivrllgvcldedelylvmEymeggsLldllrkrkgplseela
00376681   1/1  ..seelleeflrEieilkrlrhpnivrllgvc.eddelylvmEymeggsLldllrkrrggplseelllri
00497951   1/1  lllseellerflrEieilsrlnhpnivkllgvfedegelylvmEyveggsLldllkkrgplseeealkia
00375721   1/1  vKvlkksl..seellkeflrEieilsklsrhpnivrllgvcleddelylvmEymeggsLldllrkrglll
00378031   1/1  ksl..seelleeflrEieilsrlsrhpnivkllgvcldegelylvmEympggsLldllrkrgllllllll
00482061   1/1  vlkksll..eellerflrEieilkrlrhpnivkllgvfed.delylvmeyleggsLldllkkrgkklsee
00449071   1/1  vlkksl..seellkeflrEieilsrlsrhpnivrllgvcleglgelylvmEymeggsLldllrkrgllll
00469981   1/1  vKvlkksl..seellerflrEieilkrlsnhpnivkllgvfededelylvmeyleggsLldllkkrgkll
00442031   1/1  kkelllseelleeflrEveilkklrhpnivrllgvfldgd.lylvmEymeggsLldllrkrggplseell
00384771   1/1  k.......eeflrEieilkrlnhpnivrllgvfldedelsgllllylvmEympggsLldllkglrkkgpl
00389401   1/1  l..legllerflrEieilkrlnhpnivkllgvfleedllylvmEyveggsLldllrkrgplseelalria
00356151   1/1  ell.seellerflrEieilkrlselnhpnivrllgvflllllseggelylvmEym.ggsLldllkkrklg
00518771   1/1  ll.dekllerflrEikilkklnhpnivklldvfededslgllghlylvmEyl.ggdLfdllk..gplsee
00531641   1/1  ll.seellerflrEieilaklnhpnivkllgvfldeddgllylvmEyleggsLldllkkllkskgllsee
00423151   1/1  lllslllllsekllerflrEieilkrlsnhpnivkllgvfededelylvmEyveggsLldllkkrgplse
00445471   1/1  l.seelleeflrEveilkrlrhpnivrllgvc.egdelylvmeymeggsLldllrkrggplseelllria
00417671   1/1  l.seellerflrEieilkrlnhpnivkllgvfleddllylvmEyl.ggsLldllkkrggplseelvllia
00511331   1/1  llldlllekllerflrEieilkrlnlghpnivklldvfededllylvmEylesggdLldllkkrgrlsee
00497861   1/1  kksll..eellerflrEieilkklnhpnivkllgvf.dedelylvmeyleggsLldllkkrgkplseeev
00528891   1/1  ll.seellerflrEikilkklnhpnivklldvfededslgslgelylvmEyl.ggdLldllkk.gplsee
00407271   1/1  lkkel..seelleeflrEieilkrlrhpnivrllgvfldgd.lylvmEympggsLldllrkrkgplseel
00410951   1/1  lllseellerflrEieilsrlnhpnivrllgvfldedllylvmEyvpggsLldllkkrgplseelallia
00495381   1/1  ll.seellerflrEieilkklnhpnivkllgvflllledgdelylvmeyleggsLldllkkrgplseeei
00509051   1/1  lkksll.deellerflrEieilkklnhpnivkllgvfe.ddelylvmeyleggsLldllkkrgplseeea
00423541   1/1  vlkksl..seellkeflrEieilsklsrhpnivrllgvcleegelylvmEymeggsLldllrkrglllll
00377311   1/1  ...seelleeflrEieilkrlrhpnivkllgvcldedelylvmEympggsLldllrkrkggplseelllr
00432691   1/1  vlkksl..seelleeflrEieilsrlsrhpnivrllgvcldedelylvmEymeggsLldllrkrglllll
00498341   1/1  lllllseqllkrflrEikilkrlnhpnivkllgvfedegllylvmEyleggdLldllkkrgllseeeall
00480111   1/1  lGeGgfgtVylardlktgrlvAvKvlkksslse......flrEieilkrlsnhpnivkllgvfedenlde
00462101   1/1  lkkdsl.....lerllrEikilkklsdhpnivkllgyfededylylvmeyl.ggsLedllrkkggrlsee
00397921   1/1  .....kllerflrEieilkrlnghpnivkllgvfedpnedelylvmEyleggsLldll...gklseeeal
00460421   1/1  ...seellerflrEieilkrlnhpnivkllgvfededlelylvmeyleggsLldllkklkkgplseeeil
00384131   1/1  ll.seellerflrEieilkrlnhpnivrllgvfleddllylvmEyle.gsLldllkkrggplseelvlli
00436581   1/1  ..seellkeflrEieilsklrhpnivkllgvfleedelylvmEymeggsLldllrkrkgplseelllkia
00398701   1/1  ..seellkeflrEieilsklrhpnivkllgvfldedelylvmEymeggsLldllrkrglplseelllkia
00440901   1/1  lsflllllyllrlkllllllllerllrEarilkrlshpnipklydvf...d.lylvmeyieggslldll.
00413151   1/1  .....aaedlerEarllraLaeagvpvPrvlavgedggrpwlvmeylpGetladlll........dpaal
00394081   1/1  ..vseeaedlerEarilerlakgvpvPkvlgfgegdgypylvmeyleGgtladll.....lseellkell
00415921   1/1  wkvlnegdleikriggGltnevykvelpdgllkqggeprkvllriygngte.....lidrerEleilklL


                         +         -         -         -         -         *         -:210
query           GTLTALAAIHQAGIVHRDFKPANVLMAPGGPRVIDFGIARALEGTAILTSRIAGTPAYMAPEQITGGPLG
00386591   1/1  kklkggplseeevlrialqilraLeyLHsklgiiHrDlKPeNiLldlldslledgvvklaDFGlarlldd
00419271   1/1  rialqilsaLeyLHslgiiHRDlKpeNiLldedgvvklaDFGlarllsdge..lttvvgTpgYmAPEvll
00403021   1/1  eealrialqilsaLeyLHslgiiHRDlKpeNiLldsldsdgvvklaDFGlarllsdg.tllttvvgtpgY
00449241   1/1  alrialqillaLeyLHslgiiHRDlKpeNiLldedgvvklaDFGlarllssdeltllttvvgtpgYmAPE
00377141   1/1  lqillaLeyLHslgiiHrDlKpeNiLldedgvvklaDFGlarllddg...lttvvgtpgYmAPEvllggp
00417101   1/1  lqilsaLeyLHskgiiHRDlKpeNiLldedgvvklaDFGlarllssgetllttvvgtpgYmAPEvllggp
00348011   1/1  lqilsaLaylhslgiiHrDlKpeNiLllsldedgvvklaDFGlarlldsd.tllttvvgtpgYmAPEvll
00401791   1/1  alqilsgLayLHslgiiHRDlKpeNiLldedllgvvklaDFGlarllsdg.tllttvvgTpgYmAPEvll
00401801   1/1  alqilsgLeyLHslgiiHrDlKpeNiLldeddlgvvklaDFGlarllsdd.tllttvvgTpgYmAPEvll
00373691   1/1  lqilsaLaylhslgiiHrDlKpeNiLldedgvvklaDFGlarllssdetllttvvgtpgYmAPEvllggg
00493481   1/1  lqillaLaylhselgiiHrDlKPeNiLldsdgvvklaDFGlarllddd..llttvvgTpgYmAPEvllgg
00351571   1/1  lqillaLeyLHskgiiHRDlKpeNiLldedgvvklaDFGlarllgdg...lttvvgtpgYmAPEvllggp
00383731   1/1  lqilsaLeylhslgiiHrDlKpeNiLldedgvvklaDFGlarllsdgelllllttvvgtpgYmAPEvllg
00353711   1/1  rlkialqiargLayLHelllgllgskgiiHrDlKpeNiLldedgvvklaDFGlarllssdettllllltt
00440361   1/1  alqilsaLeyLHslgiiHrDlKpeNiLldlledgvvklaDFGlarllssg.tllttvvgtpgYmAPEvll
00391451   1/1  slglplseelllrialqiargLayLhskgiiHrDLKpeNiLldedgvvklaDFGlarllssgeltllltt
00430741   1/1  rlkialqiargLayLhskgiiHrDlKpeNiLldedgvvklaDFGlarllssgesllllllttvvgtpgYm
00360311   1/1  ialqilsaLeylHskgiiHrDlKpeNilldlldedgvvklaDFGlarllldgettlllllrllttlvgtp
00493471   1/1  lqilrgLaylHsklgiiHrDlKPeNiLldedgvvklaDFGlarllddd..llttvvgTpgYmAPEvllgg
00406701   1/1  llllllllllllllllllplseelrlkialqiargLayLhskgiiHrDlKpeNiLldedgvvklaDFGla
00396031   1/1  lialqilsaLaylhslgiiHrDlKpeNiLldsdglsllvvklaDFGlarllssd.tllttvvgtpgYmAP
00427071   1/1  alqiargLayLhslgiiHrDlKpeNiLldedgvvklaDFGlarllssdellllttvvgtpgYmAPEvllg
00509901   1/1  alqillaLeylhslgiiHRDlKpeNiLldedgvvklaDFGlarllssgetllttvvgTpgYmAPEvllgk
00470881   1/1  ialqillaLaylhslgiiHrDlKpeNiLldedgvvklaDFGlarllssdltllttvvgTpgYmAPEvllg
00417191   1/1  lrialqilsaLeylhslgiiHrDlKpeNiLldedgvvklaDFGlarllldglltllllttvvgtpgYmaP
00429181   1/1  alqiargLayLhslgiiHrDlKpeNiLldedgvvklaDFGlarllsddellllttvvgtpgYmAPEvllg
00477341   1/1  llllllllseeealrialqilsaLeyLHskgiiHrDlkpeNilldedgvvkliDFGlarllsdselllll
00410481   1/1  llrialqiargLayLhslgiiHrDlKpsNiLldedgvvklaDFGlarllssdellllllttvvgtpgYmA
00461801   1/1  eilrialqilsaLeyLHskgiiHrDlKpeNilldedgvvkliDFGlarllddd...lttlvgtpgYmAPE
00487851   1/1  alrialqilsgLeyLHskgiiHrDlKpeNilldsdgvvklaDFGlarllsddeltltllttlvgtpgYmA
00444071   1/1  evlkialqilsgLayLHslgiiHRDlKpeNiLldsdgvvklaDFGlarllsdg.tllttvvgTpgYmAPE
00396861   1/1  lkialqiargLayLhslgiiHrDlKpeNiLldedgvvklaDFGlarllsssellllllllttvvgtpgYm
00376681   1/1  alqiargLayLhslgiiHrDlKpsNiLldedgvvklaDFGlarllsddellllttvvgtpgYmAPEvllg
00497951   1/1  lqillgLaylhslgiiHRDlKpeNiLldedgvvklaDFGlarllssd....ttvvgtpgYmAPEvllllg
00375721   1/1  lllllllllslglplseelllkialqiargLayLhskgiiHrDlKpeNiLldedgvvklaDFGlarllss
00378031   1/1  llllslglplseelrlkialqiargLayLhskgiiHrDlKpeNiLldedgvvklaDFGlarllssddll.
00482061   1/1  evlrialqilsaleyLHskgiiHrDlkpeNilldedgvvkliDfGlarllsddeltllttlvgtpgYmaP
00449071   1/1  llllllllllllplseelllkialqiargLayLhskgiiHrDlKpeNiLldedgvvklaDFGlarllssg
00469981   1/1  lllllllllllllvlseeevlkialqilsaLeyLHskgiiHrDlKpeNilldedgvvkliDFGlarllsd
00442031   1/1  lrialqiasgLayLhslgiiHrDlKpeNiLldedgvvklaDFGlarllsddlllllllttvvgtpgYmAP
00384771   1/1  seeealkialqilrgLayLHslgiiHrDlKpeNiLldedlgvvklaDFGlarllsdg.tllttvvgTpgY
00389401   1/1  lqilsaLaylhslgiiHrDlKpeNiLldedgvvklaDFGlarllsdgetllllttvvgtpgYmAPEvllg
00356151   1/1  plseelvlkialqilrgLayLhslgiiHrDlKpeNiLldedgvvklaDFGlarllssd.tllttvvgtpg
00518771   1/1  ealkialqillgLaylHslgiiHRDlKPeNiLldsdgvvklaDFGlArllsdd.tllttvvgTpgYmAPE
00531641   1/1  eallialqillaLaylhsllslllgiiHrDlKpeNiLldedgvvklaDFGlarllssdltllttvvgtpg
00423151   1/1  eealkialqilsaLaylhslgiiHrDlKpeNiLldedgvvklaDFGlarlldsg.tllttvvgtpgYmAP
00445471   1/1  lqiargLayLhslgiiHrDlKpeNiLldedgvvklaDFGlarllssslsllllttvvgtpgYmAPEvllg
00417671   1/1  lqilrgLaylhslgiiHrDlKpeNiLldedgvvklaDFGlarllssgltllttvvgtpgYmAPEvllggl
00511331   1/1  eallialqillaleylhslgiiHrDlKpeNiLldledgvvklaDFGlarlldde..llttlvgtpgYmAP
00497861   1/1  lrialqilsaLeyLHskgiiHrDlkpeNilldedgvvkliDFGlarllsdseltllllttlvgtpgYmaP
00528891   1/1  ealkialqillgLaylHslgiiHRDlKpeNiLldedgvvklaDFGlArllddt...lttvvgTpgYmAPE
00407271   1/1  alrialqiargLayLhskgiiHrDlKpeNiLldedgvvklaDFGlarllssgettlllttvvgtpgYmAP
00410951   1/1  lqillaLaylhslgiiHrDlKpeNiLldedgvvklaDFGlarllsssl..lttvvgtpgYmaPEvllggl
00495381   1/1  lkialqilsaleyLHslgppiiHrDlkpeNilldedlgvvkliDfGlarllsdd..llttlvgtpgYmaP
00509051   1/1  lkialqilsaLeyLHskgiiHrDlkpeNilldedgvvkliDfGlarllsddeltllllttlvgtpgYmaP
00423541   1/1  lllllllllllllplseelllkialqiargLayLhskgiiHrDlKpeNiLldedgvvklaDFGlarllss
00377311   1/1  ialqiasglayLhslgiiHrDlKpeNiLldedgvvklaDFGlarlllsgellllttvvgtpgYmAPEvll
00432691   1/1  llllllllllllllllllplseeealkialqiargLayLhskgiiHrDLKpeNiLldedgvvklaDFGla
00498341   1/1  ialqillaLaylhslgiiHrDlKpeNiLldedgvvklaDFGlArllssdgtllttvvgTpgYmAPEvllg
00480111   1/1  lylvmEyl.ggsLldllkkr..lseeevlrialqilsgLeyLHskgiiHrDlKpeNilldledgvvklaD
00462101   1/1  evlrialqllsaleylHskgivHrDlkpsNillglgdsdedgrvkliDFGlarllldpksgklityrekk
00397921   1/1  kialqilsaLeyLHslgiiHrDlKpeNiLldedlgvvklaDFGlarllsdd.tllttvvgtpgYmAPEvl
00460421   1/1  rialqilsaleyLHskgiiHrDlkpeNilldedgvvkliDfGl.....lsltllttlvgtpgllYmaPEv
00384131   1/1  alqilsgLaylhslgiiHrDlKpeNiLldedgvvklaDFGlarllsdgltllttvvgtpgYmAPEvllgg
00436581   1/1  lqiargLayLhslgiiHrDlkpeNiLldedgvvklaDFGlarllssdlllllttvvgtpgYmAPEvllgg
00398701   1/1  lqiargLayLhslgiiHrDlkpeNiLldedgvvklaDFGlarlllsdellllttvvgtpgYmaPEvllgg
00440901   1/1  ......eeealkilrqllealaylhsagivHrDlkpeNilldedgvkliDFglarlldepedlalllrdl
00413151   1/1  aralaealarLHaldpadcpflgrlvtylerllarleallaalddlleedllalleellelllallpdsl
00394081   1/1  rqlaealaklHsidlsdlpfagslelslaellalleellvdlalsdllklllldlleelldlleal----
00415921   1/1  shrglvPklygffed....glvmeyiegrtltdedlldpe------------------------------


                         -         -         -         +         -         -         -:280
query           PAVDMFAWGATLVYAANGRGPFGHGSLKAVVQRVINDEPDFGELSGTLREIAERCLNKDAAQRPTAAETL
00386591   1/1  t...lttvvgtpgYmAPEvllggpyspksDvWSlGvilyelltgrppfdglsasdllleldqlalilell
00419271   1/1  ggpyygpksDvWSlGvvlyelltgrppfdgesplelllkilkllglplplppglspelkdlilkclqkdp
00403021   1/1  mAPEvllgkpytpksDvWSlGvvlyelltgrppfpglsplelllkilkglgtpdlllrlplppglspelk
00449241   1/1  vllggplyyspksDvwSlGvvlyelltgrppfdglsplellllilkglltpplplppglspelldlilkc
00377141   1/1  yteksDvWSlGvvlyelltgrppfdglsplellllilkgllplpeelspelkdlilkclqkdpekRptma
00417101   1/1  yspksDvWSlGvvlyelltgrppfdglsplelllkilkgllplpellspelkdlilkclqkdpekRpgsl
00348011   1/1  ggpyspksDvwSlGvvlyelltgrppfdglsllellllilkglllpllelppllspelldlilkclqkdp
00401791   1/1  ggpyspksDvWSlGvvlyelltgrppfdgesplelllkilkglglpplelppglspelldlilkclqkdp
00401801   1/1  ggpyspksDvWSlGvvlyelltgrppfdgesplelllkilkglglppeelppglspelkdlilkclqkdp
00373691   1/1  yspksDvwSlGvvlyelltgrppfdglsllellllilkglglllplppllspelldlilkclqkdpekRp
00493481   1/1  pydtksDvwSlGvvlyelltgrppfpgesllellllilkgklslllgtpslellllllslllllllllll
00351571   1/1  yspksDvWSlGvvlyelltgrppfpglsplelllkilkgllplpeglspelkdlilkclqkdpekRptsa
00383731   1/1  gkyspksDvwSlGvvlyelltgrppfdglsllellllilkgllplpeelspelldlilkclakdpekRpt
00353711   1/1  vvgtpgYmAPEvllgglgllllkyttksDvwSlGvvlyelltgrppfdglsplelllkilkgllllpeev
00440361   1/1  ggpyspksDvWSlGvvlyelltgrppfpglsllelllkilkglllpllelppglspelldlilkclqkdp
00391451   1/1  vvgtpgYmAPEvllggkyttksDvwSlGvvlyelltlgrppfdglsplellelilkglrlplpellspel
00430741   1/1  APEvllggkyttksDvwSfGvvlyelltlgrppfdglsplellelilkglrlplpeelspelldlilkcl
00360311   1/1  gYmaPEvllggpysrksDvwSlGvvlyelltgrlpfpglselelllkilkglglllllllpllppglspe
00493471   1/1  pydtksDvwSlGvvlyelltgrppfpgesllelllkilkglgtpseellplllsllllllllllllllll
00406701   1/1  rllssgesllllttvvgtpgYmAPEvllggkyttksDvwSlGvvlyelltlgrppfpglsplellllilk
00396031   1/1  EvllggpyspksDvwSlGvvlyelltgrppfpglsllellllilkglllpllelppllspelldlilkcl
00427071   1/1  gkyttksDvwSlGvvlyelltlgrppfdglsllellllilkglrlplpellspelldlilkclakdpekR
00509901   1/1  pydakvDvWSlGvilyelltgrppfpgesllelllkilkgllplpedlspelkdlilkllqkdpekRpta
00470881   1/1  lkyystkvDvWSlGvilyelltgrppfpglsllellllilkllgtpslelllllllllllllllllldpl
00417191   1/1  EvllggpystksDvwslGvvlyelltgrppfdglsllellllilkglllpllelppglspelldlilkcl
00429181   1/1  gkyttksDvwSlGvvlyelltlgrppfdglsllellllilkglrlplpellspelldlilkclaldpekR
00477341   1/1  ttlvgtpgYmaPEvllggpyspksDvwslGvvlyelltlgklpfdglsplellekilegllpplpedlsp
00410481   1/1  PEvllggkyttksDvwSlGvvlyelltlgrppfdglsllellllilkglrlplpellspelldlilrcla
00461801   1/1  vllglgpyspksDvwslGvilyelltgkppfdgesplellekilkllgtpplelllklllllllllldll
00487851   1/1  PEvllglgpyspksDvwslGvilyelltgkppfpglsplellekilkllgtpslellllllslllldllk
00444071   1/1  vllggpystksDvWSlGvvlyelltgrppfpgeselelllkilkglgtpplellllllllllllllllll
00396861   1/1  APEvllggkyttksDvwSlGvvlyelltlgrppfdglsllellllilkglrlplpeelspelldlilkcl
00376681   1/1  gkyttksDvwSlGvvlyelltlgrppfdglsllellllilkglrlplpellspelldlilkclakdpekR
00497951   1/1  ggkydeksDvwSlGvvlyelltgrppfdglsllellllilkgllrpllppllspelkdlilkclqkdpek
00375721   1/1  gestlllttvvgtpgYmAPEvllggkyttksDvwSlGvvlyelltlgrppfdglsplellllilkglrlp
00378031   1/1  ttvvgtpgYmAPEvllggkyteksDvwSlGvvlyelltlgrppfdglsplellelilkglrlplpedlsp
00482061   1/1  EvllggpyspksDvwslGvilyelltlgklpfpglsllellekileglllplpedlspelldlilkclql
00449071   1/1  eltlllttvvgtpgYmAPEvllggkyttksDvwSlGvvlyelltlgrppfpglsllellllilkgllrpp
00469981   1/1  deltlllttlvgtpgYmaPEvllggpyspksDvwslGvilyelltlgklpfdglsplellekilkglrlp
00442031   1/1  EvllggkystksDvwSlGvvlyelltlgrppfdglsllellllilkgllrlplppelspelldlilkcla
00384771   1/1  mAPEvllgglkyttksDvWSlGvvlyelltgrppfdgeselelllkilkglgtpslellllvlsllllgl
00389401   1/1  gpyyslksDvwSlGvvlyelltgrppfdglsllellllilkglllllllppllspelldlilkclaldpe
00356151   1/1  YmAPEvllggkystksDvWSlGvvlyelltgrppfdglselellllilkglgtpslelllllllllllll
00518771   1/1  vllgkpydtkvDiWSlGvilyelltgrppfpgeselelllkilkglgtppeelllsllllllllllllll
00531641   1/1  YmAPEvllgkpydlksDvwslGvvlyelltgrppfpglsllellllilkglllplpellspelldlilkc
00423151   1/1  EvllgllslllgkyslksDvwSlGvvlyelltgrppfdglsllellllilrglllpllelppllspelld
00445471   1/1  llggkyttksDvwSlGvvlyelltgrlpfdglsllellllilkglllpllllllppllspelldlilkcl
00417671   1/1  kystksDvwSlGvvlyelltgrppfpglsllellllilkllgtpslelllllllllllllllllldllll
00511331   1/1  EvllglpyyglkvDvwslGvilyelltgrlpfpglsllelllli.....lppllspelldlilkllqkdp
00497861   1/1  EvllggpyspksDvwslGvvlyelltlgklpfdglsllellekilkgllpplpedlspelkdlilkclql
00528891   1/1  vllglkgydtkvDiWSlGvilyelltgrppfpgeselelllkilkglgtppeelllllllllllllllll
00407271   1/1  EvllggkyteksDvwSlGvvlyelltlgrppfdglsplellekilkglrlplpedlspelldlilkclqk
00410951   1/1  yslksDvwslGvvlyelltgrppfdglsllellllilkgllplpeelspelldlilkclaldpekRpsas
00495381   1/1  Evllg.pyspksDvwslGvilyelltgklpfdglldldellekilelglplplpellspelkdlilkclq
00509051   1/1  EvllggpyspksDvwslGvilyelltlgklpfdglsplellekilkglrpplppglspelldlilkclql
00423541   1/1  getllllttvvgtpgYmAPEvllggkyttksDvwSlGvvlyelltlgrppfpglsllelllkildgllrp
00377311   1/1  ggkystksDvwSlGvvlyelltlgrppfdglsllellllilkglrlplpellspelldlilkclqldpek
00432691   1/1  rllssgettlllttvvgtpgYmAPEvllggkyttksDvWSlGvvlyelltlgrppfpglsplellekild
00498341   1/1  lkyystkvDvWSlGvilyelltgrppfpglsllellllilkllgtpslelllsllllllllllllldlll
00480111   1/1  FGlarllsddel.lttlvgtpgYmAPEvllggpyyspksDvwslGvilyelltgklPlfdglsplellel
00462101   1/1  slvgtpgYmapevllgkeysrksDiwslGvilyelltgklpfqglsdlellekikkilelklptppeell
00397921   1/1  lglgkyspksDvWSlGvvlyelltgrppfdpgeselelllkilkglgtpslelllkllllllllllllll
00460421   1/1  llggpyspksDvwslGvilyelltlgklpfdglsllellelilkglllplppelspelldlilkclqldp
00384131   1/1  kyystksDvwSlGvvlyelltgrppflpglsllellllilkglgtpslelllllllllllllllllldll
00436581   1/1  kyttksDvwSlGvvlyelltlgrppfdglsllellllilkglrlplpellspelldlilkclakdpekRp
00398701   1/1  kytlksDvwSlGvvlyelltlgkppfpglsllellllilkglrlplpellseelldlilkclaldpekRp
00440901   1/1  vgtpaymaP-------------------------------------------------------------
00413151   1/1  plvlvHgDlhpgN---------------------------------------------------------
00394081   1/1  ----------------------------------------------------------------------
00415921   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           MLVLGIEGPPPTEEPSTDTAIPVTHQTLVAGAIAAADTGEQESAAELYRSYPPAPPPPHSNVAAQPSPTP
00386591   1/1  gtpplellllllllrlllllllllllllglllel------------------------------------
00419271   1/1  ekRptmaevvaeellehpffrglllllllllllppplvpllsslldlssldllllsllllllllllllsl
00403021   1/1  dlilkclakdpekRptaeellehpflkgllllllllllllppllplllsllllslllllllss-------
00449241   1/1  lqkdpekRptmaevvaeellehpfflg-------------------------------------------
00377141   1/1  evvaeellehpfllgllllllllllllllllpllllllllslllllllllllllllllssl---------
00417101   1/1  eetaeellehpfllgllllllllllllppllplllslldlslldllllslllllslssssllsllllsll
00348011   1/1  ekRptaeellehlffllllllllllllllllllllllllsllssl-------------------------
00401791   1/1  ekRptaeellehpflkgllllllllllllppllpllssllslslllllllssslslslsssslsssslls
00401801   1/1  ekRptaeellehpflkgllllllllllppllplllslldtslfdllllslllslslslsslllssslsls
00373691   1/1  tasellehlfflllllplllllllll--------------------------------------------
00493481   1/1  lleglllelldpllllelppelspel--------------------------------------------
00351571   1/1  evvaeellehpfflgllllllllllllppllplllslldlslldllllslllllllls------------
00383731   1/1  aeellkhlfflllllpllllllllllll------------------------------------------
00353711   1/1  lplllslrlle-----------------------------------------------------------
00440361   1/1  ekRptaeellehpflkglllllllllllllllllllllllllslllllllslllllsllsl---------
00391451   1/1  ldlilkclqkdpekRptasevle-----------------------------------------------
00430741   1/1  qkdpekRptasevlehlfflllllel--------------------------------------------
00360311   1/1  lldlllkclaldpekRpsaeellell--------------------------------------------
00493471   1/1  vllllleglllelldpplllplppels-------------------------------------------
00406701   1/1  glr-------------------------------------------------------------------
00396031   1/1  akdpekRpsaeellehlfflllll----------------------------------------------
00427071   1/1  ptasevlehlflllllle----------------------------------------------------
00509901   1/1  aeellehpfflgllllllllllllllllpllllllllslllllllllllllllllslllllllllll---
00470881   1/1  lllllppllspelldll-----------------------------------------------------
00417191   1/1  akdpekRpsa------------------------------------------------------------
00429181   1/1  ptasevlehlf-----------------------------------------------------------
00477341   1/1  el--------------------------------------------------------------------
00410481   1/1  kdpekRptasevlehlffl---------------------------------------------------
00461801   1/1  l---------------------------------------------------------------------
00487851   1/1  l---------------------------------------------------------------------
00444071   1/1  l---------------------------------------------------------------------
00396861   1/1  qkdpekRptasevle-------------------------------------------------------
00376681   1/1  ptasevlehlfflllllell--------------------------------------------------
00497951   1/1  Rpsaeellehlffllllllllllllllllllllllllllllsll--------------------------
00375721   1/1  lpellspelld-----------------------------------------------------------
00378031   1/1  elldlilkclqkdpekRptasevlehlfflll--------------------------------------
00482061   1/1  dpekRpsaeelle---------------------------------------------------------
00449071   1/1  lppllspelld-----------------------------------------------------------
00469981   1/1  lpedlspelk------------------------------------------------------------
00442031   1/1  kdpekRp---------------------------------------------------------------
00384771   1/1  l---------------------------------------------------------------------
00389401   1/1  kRptasevlehlffls------------------------------------------------------
00356151   1/1  llldlllllplppl--------------------------------------------------------
00518771   1/1  l---------------------------------------------------------------------
00531641   1/1  ----------------------------------------------------------------------
00423151   1/1  lil-------------------------------------------------------------------
00445471   1/1  akdpekRpsase----------------------------------------------------------
00417671   1/1  l---------------------------------------------------------------------
00511331   1/1  ekRptaeellehpffkglll--------------------------------------------------
00497861   1/1  dpekRpsaeelle.......pllalllsl-----------------------------------------
00528891   1/1  l---------------------------------------------------------------------
00407271   1/1  dpekRptasellehlffllllllllllllllllllllllllllllslllllllll---------------
00410951   1/1  ell-------------------------------------------------------------------
00495381   1/1  ld--------------------------------------------------------------------
00509051   1/1  dpekRpsaeel.........ellll---------------------------------------------
00423541   1/1  plp-------------------------------------------------------------------
00377311   1/1  Rptasevle-------------------------------------------------------------
00432691   1/1  gll-------------------------------------------------------------------
00498341   1/1  llelppllspelldlllkllq-------------------------------------------------
00480111   1/1  ilkglglpppel----------------------------------------------------------
00462101   1/1  kglp------------------------------------------------------------------
00397921   1/1  lllllelldpllllplpp----------------------------------------------------
00460421   1/1  ekRpsaeellk-----------------------------------------------------------
00384131   1/1  l---------------------------------------------------------------------
00436581   1/1  tasevlehlf------------------------------------------------------------
00398701   1/1  tas-------------------------------------------------------------------
00440901   1/1  ----------------------------------------------------------------------
00413151   1/1  ----------------------------------------------------------------------
00394081   1/1  ----------------------------------------------------------------------
00415921   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           PPHPQTASGPQPSLPSTGAQHSGYGYATGPHQSGYGYATGPQQGGYAPPPGPHQHAYPTPHSGNAAIPPH
00386591   1/1  ----------------------------------------------------------------------
00419271   1/1  llllslllsssslsllllsssllsslssllp---------------------------------------
00403021   1/1  ----------------------------------------------------------------------
00449241   1/1  ----------------------------------------------------------------------
00377141   1/1  ----------------------------------------------------------------------
00417101   1/1  lllsllsl--------------------------------------------------------------
00348011   1/1  ----------------------------------------------------------------------
00401791   1/1  ss--------------------------------------------------------------------
00401801   1/1  ll--------------------------------------------------------------------
00373691   1/1  ----------------------------------------------------------------------
00493481   1/1  ----------------------------------------------------------------------
00351571   1/1  ----------------------------------------------------------------------
00383731   1/1  ----------------------------------------------------------------------
00353711   1/1  ----------------------------------------------------------------------
00440361   1/1  ----------------------------------------------------------------------
00391451   1/1  ----------------------------------------------------------------------
00430741   1/1  ----------------------------------------------------------------------
00360311   1/1  ----------------------------------------------------------------------
00493471   1/1  ----------------------------------------------------------------------
00406701   1/1  ----------------------------------------------------------------------
00396031   1/1  ----------------------------------------------------------------------
00427071   1/1  ----------------------------------------------------------------------
00509901   1/1  ----------------------------------------------------------------------
00470881   1/1  ----------------------------------------------------------------------
00417191   1/1  ----------------------------------------------------------------------
00429181   1/1  ----------------------------------------------------------------------
00477341   1/1  ----------------------------------------------------------------------
00410481   1/1  ----------------------------------------------------------------------
00461801   1/1  ----------------------------------------------------------------------
00487851   1/1  ----------------------------------------------------------------------
00444071   1/1  ----------------------------------------------------------------------
00396861   1/1  ----------------------------------------------------------------------
00376681   1/1  ----------------------------------------------------------------------
00497951   1/1  ----------------------------------------------------------------------
00375721   1/1  ----------------------------------------------------------------------
00378031   1/1  ----------------------------------------------------------------------
00482061   1/1  ----------------------------------------------------------------------
00449071   1/1  ----------------------------------------------------------------------
00469981   1/1  ----------------------------------------------------------------------
00442031   1/1  ----------------------------------------------------------------------
00384771   1/1  ----------------------------------------------------------------------
00389401   1/1  ----------------------------------------------------------------------
00356151   1/1  ----------------------------------------------------------------------
00518771   1/1  ----------------------------------------------------------------------
00531641   1/1  ----------------------------------------------------------------------
00423151   1/1  ----------------------------------------------------------------------
00445471   1/1  ----------------------------------------------------------------------
00417671   1/1  ----------------------------------------------------------------------
00511331   1/1  ----------------------------------------------------------------------
00497861   1/1  ----------------------------------------------------------------------
00528891   1/1  ----------------------------------------------------------------------
00407271   1/1  ----------------------------------------------------------------------
00410951   1/1  ----------------------------------------------------------------------
00495381   1/1  ----------------------------------------------------------------------
00509051   1/1  ----------------------------------------------------------------------
00423541   1/1  ----------------------------------------------------------------------
00377311   1/1  ----------------------------------------------------------------------
00432691   1/1  ----------------------------------------------------------------------
00498341   1/1  ----------------------------------------------------------------------
00480111   1/1  ----------------------------------------------------------------------
00462101   1/1  ----------------------------------------------------------------------
00397921   1/1  ----------------------------------------------------------------------
00460421   1/1  ----------------------------------------------------------------------
00384131   1/1  ----------------------------------------------------------------------
00436581   1/1  ----------------------------------------------------------------------
00398701   1/1  ----------------------------------------------------------------------
00440901   1/1  ----------------------------------------------------------------------
00413151   1/1  ----------------------------------------------------------------------
00394081   1/1  ----------------------------------------------------------------------
00415921   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           GGPSGPYAPAQPWMPSTGGYPQTSQPYSGQQYQQQAEGTSTAFVLGVVSIAVIAGVLLFILLFLLIGSLG
00386591   1/1  ----------------------------------------------------------------------
00419271   1/1  ----------------------------------------------------------------------
00403021   1/1  ----------------------------------------------------------------------
00449241   1/1  ----------------------------------------------------------------------
00377141   1/1  ----------------------------------------------------------------------
00417101   1/1  ----------------------------------------------------------------------
00348011   1/1  ----------------------------------------------------------------------
00401791   1/1  ----------------------------------------------------------------------
00401801   1/1  ----------------------------------------------------------------------
00373691   1/1  ----------------------------------------------------------------------
00493481   1/1  ----------------------------------------------------------------------
00351571   1/1  ----------------------------------------------------------------------
00383731   1/1  ----------------------------------------------------------------------
00353711   1/1  ----------------------------------------------------------------------
00440361   1/1  ----------------------------------------------------------------------
00391451   1/1  ----------------------------------------------------------------------
00430741   1/1  ----------------------------------------------------------------------
00360311   1/1  ----------------------------------------------------------------------
00493471   1/1  ----------------------------------------------------------------------
00406701   1/1  ----------------------------------------------------------------------
00396031   1/1  ----------------------------------------------------------------------
00427071   1/1  ----------------------------------------------------------------------
00509901   1/1  ----------------------------------------------------------------------
00470881   1/1  ----------------------------------------------------------------------
00417191   1/1  ----------------------------------------------------------------------
00429181   1/1  ----------------------------------------------------------------------
00477341   1/1  ----------------------------------------------------------------------
00410481   1/1  ----------------------------------------------------------------------
00461801   1/1  ----------------------------------------------------------------------
00487851   1/1  ----------------------------------------------------------------------
00444071   1/1  ----------------------------------------------------------------------
00396861   1/1  ----------------------------------------------------------------------
00376681   1/1  ----------------------------------------------------------------------
00497951   1/1  ----------------------------------------------------------------------
00375721   1/1  ----------------------------------------------------------------------
00378031   1/1  ----------------------------------------------------------------------
00482061   1/1  ----------------------------------------------------------------------
00449071   1/1  ----------------------------------------------------------------------
00469981   1/1  ----------------------------------------------------------------------
00442031   1/1  ----------------------------------------------------------------------
00384771   1/1  ----------------------------------------------------------------------
00389401   1/1  ----------------------------------------------------------------------
00356151   1/1  ----------------------------------------------------------------------
00518771   1/1  ----------------------------------------------------------------------
00531641   1/1  ----------------------------------------------------------------------
00423151   1/1  ----------------------------------------------------------------------
00445471   1/1  ----------------------------------------------------------------------
00417671   1/1  ----------------------------------------------------------------------
00511331   1/1  ----------------------------------------------------------------------
00497861   1/1  ----------------------------------------------------------------------
00528891   1/1  ----------------------------------------------------------------------
00407271   1/1  ----------------------------------------------------------------------
00410951   1/1  ----------------------------------------------------------------------
00495381   1/1  ----------------------------------------------------------------------
00509051   1/1  ----------------------------------------------------------------------
00423541   1/1  ----------------------------------------------------------------------
00377311   1/1  ----------------------------------------------------------------------
00432691   1/1  ----------------------------------------------------------------------
00498341   1/1  ----------------------------------------------------------------------
00480111   1/1  ----------------------------------------------------------------------
00462101   1/1  ----------------------------------------------------------------------
00397921   1/1  ----------------------------------------------------------------------
00460421   1/1  ----------------------------------------------------------------------
00384131   1/1  ----------------------------------------------------------------------
00436581   1/1  ----------------------------------------------------------------------
00398701   1/1  ----------------------------------------------------------------------
00440901   1/1  ----------------------------------------------------------------------
00413151   1/1  ----------------------------------------------------------------------
00394081   1/1  ----------------------------------------------------------------------
00415921   1/1  ----------------------------------------------------------------------