[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ54591.1


[Show Plain Result]

## Summary of Sequence Search
   1::553
 367::547  2.8e-48 33.3% 0052450 00524502 2/2   in diphosphate-binding fold (THDP-bindi 
 367::547    6e-46 32.8% 0045130 00451302 2/2   in diphosphate-binding fold (THDP-bindi 
 368::548  1.6e-45 32.6% 0051271 00512711 1/1   in diphosphate-binding fold (THDP-bindi 
 365::547  2.1e-45 32.4% 0042102 00421022 2/2   in diphosphate-binding fold (THDP-bindi 
 365::547  2.1e-45 33.7% 0042488 00424882 2/2   in diphosphate-binding fold (THDP-bindi 
 364::547  5.7e-45 32.1% 0042411 00424112 2/2   in diphosphate-binding fold (THDP-bindi 
 365::548  4.6e-44 33.0% 0042045 00420452 2/2   in diphosphate-binding fold (THDP-bindi 
 359::548  1.5e-43 32.1% 0041167 00411672 2/2   in diphosphate-binding fold (THDP-bindi 
   1::196  4.5e-42 34.9% 0051270 00512701 1/2   in diphosphate-binding fold (THDP-bindi 
 363::554  6.4e-42 30.4% 0049968 00499682 2/2   in diphosphate-binding fold (THDP-bindi 
 358::541  3.8e-41 30.1% 0048897 00488972 2/2   in diphosphate-binding fold (THDP-bindi 
   9::196  8.7e-40 32.3% 0052103 00521031 1/2   in diphosphate-binding fold (THDP-bindi 
  11::191  6.2e-39 30.3% 0045129 00451291 1/2   in diphosphate-binding fold (THDP-bindi 
  12::184  2.3e-38 34.1% 0048896 00488961 1/2   in diphosphate-binding fold (THDP-bindi 
  12::199  1.1e-37 27.0% 0044478 00444781 1/2   in diphosphate-binding fold (THDP-bindi 
   9::183  5.1e-37 31.6% 0052449 00524491 1/2   in diphosphate-binding fold (THDP-bindi 
 190::374    9e-37 39.2% 0042100 00421001 1/1   ike NAD/FAD-binding domain              
   8::190  3.7e-36 32.6% 0042101 00421011 1/2   in diphosphate-binding fold (THDP-bindi 
 364::547  4.7e-36 29.8% 0052104 00521042 2/2   in diphosphate-binding fold (THDP-bindi 
   3::191  4.9e-36 28.7% 0039738 00397381 1/2   in diphosphate-binding fold (THDP-bindi 
  10::183  9.6e-36 28.7% 0042487 00424871 1/2   in diphosphate-binding fold (THDP-bindi 
 370::547  1.9e-35 30.2% 0042044 00420442 2/2   in diphosphate-binding fold (THDP-bindi 
 165::363  2.7e-35 40.9% 0048796 00487961 1/1   ike NAD/FAD-binding domain              
  13::184  3.4e-35 30.4% 0042410 00424101 1/2   in diphosphate-binding fold (THDP-bindi 
 191::384  1.4e-34 39.4% 0044477 00444771 1/1   ike NAD/FAD-binding domain              
  13::182  5.1e-33 28.9% 0042044 00420441 1/2   in diphosphate-binding fold (THDP-bindi 
 189::366  1.9e-32 37.6% 0052448 00524481 1/1   ike NAD/FAD-binding domain              
 366::543  5.9e-32 29.2% 0042410 00424102 2/2   in diphosphate-binding fold (THDP-bindi 
 191::375  2.5e-31 39.5% 0051269 00512691 1/1   ike NAD/FAD-binding domain              
 192::375    8e-31 36.9% 0052102 00521021 1/1   ike NAD/FAD-binding domain              
 169::354    1e-27 36.8% 0042917 00429171 1/1   ike NAD/FAD-binding domain              
 384::546  1.6e-27 30.8% 0042487 00424872 2/2   in diphosphate-binding fold (THDP-bindi 
 188::365  3.3e-27 39.2% 0051605 00516051 1/1   ike NAD/FAD-binding domain              
 363::546    2e-25 27.4% 0039738 00397382 2/2   in diphosphate-binding fold (THDP-bindi 
 182::338  2.1e-25 39.5% 0048650 00486501 1/1   ike NAD/FAD-binding domain              
 372::546  2.3e-25 28.0% 0044478 00444782 2/2   in diphosphate-binding fold (THDP-bindi 
 190::356  1.2e-19 34.1% 0047672 00476721 1/1   ike NAD/FAD-binding domain              
 359::548  1.1e-18 32.4% 0036596 00365961 1/1   in diphosphate-binding fold (THDP-bindi 
 421::541  1.4e-18 34.3% 0042101 00421012 2/2   in diphosphate-binding fold (THDP-bindi 
 423::541    3e-18 34.2% 0045129 00451292 2/2   in diphosphate-binding fold (THDP-bindi 
 421::546  3.5e-18 31.0% 0052449 00524492 2/2   in diphosphate-binding fold (THDP-bindi 
 359::540  7.1e-18 30.7% 0044439 00444391 1/1   in diphosphate-binding fold (THDP-bindi 
 421::541  4.1e-16 32.1% 0048896 00488962 2/2   in diphosphate-binding fold (THDP-bindi 
 420::549  4.3e-15 32.5% 0041402 00414021 1/1   in diphosphate-binding fold (THDP-bindi 
 423::541  4.4e-14 28.3% 0051270 00512702 2/2   in diphosphate-binding fold (THDP-bindi 
 421::541  1.3e-13 28.7% 0052103 00521032 2/2   in diphosphate-binding fold (THDP-bindi 
 191::345  1.8e-12 32.0% 0048895 00488951 1/1   ike NAD/FAD-binding domain              
   7::240  4.8e-10 20.9% 0045857 00458571 1/1   in diphosphate-binding fold (THDP-bindi 
 191::334  5.1e-10 30.4% 0051405 00514051 1/1   ike NAD/FAD-binding domain              
 192::276  7.6e-09 43.6% 0036754 00367541 1/1   ike NAD/FAD-binding domain              
 394::540  1.1e-08 26.7% 0044101 00441011 1/1   in diphosphate-binding fold (THDP-bindi 
 405::540  1.4e-08 29.8% 0039197 00391971 1/1   in diphosphate-binding fold (THDP-bindi 
 413::540  1.1e-07 29.3% 0042762 00427621 1/1   in diphosphate-binding fold (THDP-bindi 
 418::477  4.8e-06 31.0% 0045858 00458581 1/1   in diphosphate-binding fold (THDP-bindi 
 420::540  8.5e-06 30.3% 0050394 00503941 1/1   in diphosphate-binding fold (THDP-bindi 
 420::540  2.4e-05 31.2% 0049028 00490281 1/1   in diphosphate-binding fold (THDP-bindi 
 420::540  9.9e-05 31.7% 0049136 00491361 1/1   in diphosphate-binding fold (THDP-bindi 
 192::277  0.00034 34.2% 0036270 00362701 1/1   ike NAD/FAD-binding domain              
 420::540  0.00095 29.4% 0040412 00404121 1/1   in diphosphate-binding fold (THDP-bindi 
 122::202   0.0011 20.5% 0042411 00424111 1/2   in diphosphate-binding fold (THDP-bindi 
 121::174     0.12 26.9% 0052450 00524501 1/2   in diphosphate-binding fold (THDP-bindi 
 139::174     0.15 36.4% 0042488 00424881 1/2   in diphosphate-binding fold (THDP-bindi 
  91::185     0.21 25.6% 0049968 00499681 1/2   in diphosphate-binding fold (THDP-bindi 
 138::190     0.36 24.5% 0045130 00451301 1/2   in diphosphate-binding fold (THDP-bindi 
 137::173     0.91 28.1% 0048897 00488971 1/2   in diphosphate-binding fold (THDP-bindi 
 138::189     0.97 23.4% 0042102 00421021 1/2   in diphosphate-binding fold (THDP-bindi 
 137::174      1.1 30.3% 0041167 00411671 1/2   in diphosphate-binding fold (THDP-bindi 
 137::174      2.7 30.3% 0042045 00420451 1/2   in diphosphate-binding fold (THDP-bindi 
  91::179       12 24.4% 0052104 00521041 1/2   in diphosphate-binding fold (THDP-bindi 
   1::553


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGSPSFSGKLTGHGGNHAVEVARHHGVDTLFTLSGGHIFPIYDGAVKADPPMRLLDVRHEQTAVFAAEAV
00524502   2/2  ----------------------------------------------------------------------
00451302   2/2  ----------------------------------------------------------------------
00512711   1/1  ----------------------------------------------------------------------
00421022   2/2  ----------------------------------------------------------------------
00424882   2/2  ----------------------------------------------------------------------
00424112   2/2  ----------------------------------------------------------------------
00420452   2/2  ----------------------------------------------------------------------
00411672   2/2  ----------------------------------------------------------------------
00512701   1/2  llllelmlkllltgaealveaLlaagvdhvfgvpGtpnlplldalaks.pgirfilvrhEqaAafaAiGa
00499682   2/2  ----------------------------------------------------------------------
00488972   2/2  ----------------------------------------------------------------------
00521031   1/2  --------lmkltgadalveaLkalgvdtvfgvpGgsilplldalld..sgirlilvrhEgaAlpaAiGy
00451291   1/2  ----------kltgaealverLvelgvdtvfgvpGdsilplldalars.ggirlilvrhElgAapaAiGa
00488961   1/2  -----------mtgaellveaLkelgvdtvfgvpGsrilplldalad...girlilvrhEggAapaAdGy
00444781   1/2  -----------ltvaealverLkelgvdivfgdpGdsnlpladalrr...girfiltrgegyalpaAlGa
00524491   1/2  --------mmlltgaealveaLlaagvdtvfgvpgtpnlplldalaellpgirfilvrhEgaAlpaAiGa
00421001   1/1  ----------------------------------------------------------------------
00421011   1/2  -------etllltgaealveaLkalgvdtvfgvpGssnlplldaladsg..irvilvrhEgaaapaAiGa
00521042   2/2  ----------------------------------------------------------------------
00397381   1/2  --mssdlplllmtgaealveaLkelgvdivfgdpGssnlpladalrar.pgirfilsghegaalpaAlGa
00424871   1/2  ---------ekitvaealverLlelgvdivfgdpGdsilwladallar.kgirfilsghegyalpaAiGa
00420442   2/2  ----------------------------------------------------------------------
00487961   1/1  ----------------------------------------------------------------------
00424101   1/2  ------------kpltvaealvealkelgvdivfgdpGtsilpladalraprpgirsiglghegyalpaA
00444771   1/1  ----------------------------------------------------------------------
00420441   1/2  ------------kpqtvaealvellpedgvdivfgdpGssvlwladalrasg.pirfiglghegyalpaA
00524481   1/1  ----------------------------------------------------------------------
00424102   2/2  ----------------------------------------------------------------------
00512691   1/1  ----------------------------------------------------------------------
00521021   1/1  ----------------------------------------------------------------------
00429171   1/1  ----------------------------------------------------------------------
00424872   2/2  ----------------------------------------------------------------------
00516051   1/1  ----------------------------------------------------------------------
00397382   2/2  ----------------------------------------------------------------------
00486501   1/1  ----------------------------------------------------------------------
00444782   2/2  ----------------------------------------------------------------------
00476721   1/1  ----------------------------------------------------------------------
00365961   1/1  ----------------------------------------------------------------------
00421012   2/2  ----------------------------------------------------------------------
00451292   2/2  ----------------------------------------------------------------------
00524492   2/2  ----------------------------------------------------------------------
00444391   1/1  ----------------------------------------------------------------------
00488962   2/2  ----------------------------------------------------------------------
00414021   1/1  ----------------------------------------------------------------------
00512702   2/2  ----------------------------------------------------------------------
00521032   2/2  ----------------------------------------------------------------------
00488951   1/1  ----------------------------------------------------------------------
00458571   1/1  ------dgkrvlltGneavalaalaag.dvvagYPitPsteileildellaegglnllgnvivviqaesE
00514051   1/1  ----------------------------------------------------------------------
00367541   1/1  ----------------------------------------------------------------------
00441011   1/1  ----------------------------------------------------------------------
00391971   1/1  ----------------------------------------------------------------------
00427621   1/1  ----------------------------------------------------------------------
00458581   1/1  ----------------------------------------------------------------------
00503941   1/1  ----------------------------------------------------------------------
00490281   1/1  ----------------------------------------------------------------------
00491361   1/1  ----------------------------------------------------------------------
00362701   1/1  ----------------------------------------------------------------------
00404121   1/1  ----------------------------------------------------------------------
00424111   1/2  ----------------------------------------------------------------------
00524501   1/2  ----------------------------------------------------------------------
00424881   1/2  ----------------------------------------------------------------------
00499681   1/2  ----------------------------------------------------------------------
00451301   1/2  ----------------------------------------------------------------------
00488971   1/2  ----------------------------------------------------------------------
00421021   1/2  ----------------------------------------------------------------------
00411671   1/2  ----------------------------------------------------------------------
00420451   1/2  ----------------------------------------------------------------------
00521041   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           GKLTRRAGWAALTAGPGVTNGVSGIATAHFNGSPLVVVGGRAPDNRWGQGLLQELDQSPLFTTITKRAWT
00524502   2/2  ----------------------------------------------------------------------
00451302   2/2  ----------------------------------------------------------------------
00512711   1/1  ----------------------------------------------------------------------
00421022   2/2  ----------------------------------------------------------------------
00424882   2/2  ----------------------------------------------------------------------
00424112   2/2  ----------------------------------------------------------------------
00420452   2/2  ----------------------------------------------------------------------
00411672   2/2  ----------------------------------------------------------------------
00512701   1/2  aratgkpgvvlvtsgpGalnlltglatavrdglPvvvivgqrptlglgrgafqeldfvglaepvgkyalr
00499682   2/2  ----------------------------------------------------------------------
00488972   2/2  ----------------------------------------------------------------------
00521031   1/2  aratgkpgVvlvtggpGalnlltelatavrdslPvvvivgnvprvllglgrgafqeldfvklaeavgkyg
00451291   1/2  aratg.pgvvlvtgdggflnlltelatavreglPvlvivgqvnngllgmvallqellygfqepdfvklae
00488961   1/2  aratgkpgvvlvtggpGflnlltelatavrdglPvlvivgnngtlglgrgaqqelpdfvklaeaygkyga
00444781   1/2  aratgkrgvvlvtgdggflnllqelatavreglPvlvivgnnpgygivgrgaqqepdfvklaeaygkygv
00524491   1/2  aratgkpgvvlvtggpGflnlltelatavrdglPvvvivgnnggygigrgaqqevdfvalaeaygkyalr
00421001   1/1  ----------------------------------------------------------------------
00421011   1/2  aratgkpgvvlvtggpgflnllqelatavreglPvvvivgnngglglgrgaqqeldfvklaeafgkyglr
00521042   2/2  ----------------------------------------------------------------------
00397381   1/2  alatgkpgvvlvtgdggflnllqelatavryglPvvvivgnnggygigrgaqqeldfvklaeafgkkgvr
00424871   1/2  aratg.rgvvlvtgdggflnllqelatavreglpvvvivgnnggygigrgaqqepdfvklaeafgkkgar
00420442   2/2  ----------------------------------------------------------------------
00487961   1/1  ----------------------------------------------------------------------
00424101   1/2  iGaalatgdrgvvlltgdggflnllqelatavryglpvvvivgnnggygigrgaqqevdfaklaeafgkk
00444771   1/1  ----------------------------------------------------------------------
00420441   1/2  iGaalatg.rgvvlvtgdggflnllqelatavryglpvlvivgnnggygigrgaqqelyggdlpnpdfvk
00524481   1/1  ----------------------------------------------------------------------
00424102   2/2  ----------------------------------------------------------------------
00512691   1/1  ----------------------------------------------------------------------
00521021   1/1  ----------------------------------------------------------------------
00429171   1/1  ----------------------------------------------------------------------
00424872   2/2  ----------------------------------------------------------------------
00516051   1/1  ----------------------------------------------------------------------
00397382   2/2  ----------------------------------------------------------------------
00486501   1/1  ----------------------------------------------------------------------
00444782   2/2  ----------------------------------------------------------------------
00476721   1/1  ----------------------------------------------------------------------
00365961   1/1  ----------------------------------------------------------------------
00421012   2/2  ----------------------------------------------------------------------
00451292   2/2  ----------------------------------------------------------------------
00524492   2/2  ----------------------------------------------------------------------
00444391   1/1  ----------------------------------------------------------------------
00488962   2/2  ----------------------------------------------------------------------
00414021   1/1  ----------------------------------------------------------------------
00512702   2/2  ----------------------------------------------------------------------
00521032   2/2  ----------------------------------------------------------------------
00488951   1/1  ----------------------------------------------------------------------
00458571   1/1  iaAagaaiGAsaaGaravt..atsgpGlllmiealglaagtelplvlvvvqrggpstglstqneqddlla
00514051   1/1  ----------------------------------------------------------------------
00367541   1/1  ----------------------------------------------------------------------
00441011   1/1  ----------------------------------------------------------------------
00391971   1/1  ----------------------------------------------------------------------
00427621   1/1  ----------------------------------------------------------------------
00458581   1/1  ----------------------------------------------------------------------
00503941   1/1  ----------------------------------------------------------------------
00490281   1/1  ----------------------------------------------------------------------
00491361   1/1  ----------------------------------------------------------------------
00362701   1/1  ----------------------------------------------------------------------
00404121   1/1  ----------------------------------------------------------------------
00424111   1/2  ---------------------------------------------------lpnpdfaklaeafGakgvr
00524501   1/2  --------------------------------------------------dlpnpdfaklaeafGakgvr
00424881   1/2  --------------------------------------------------------------------vr
00499681   1/2  --------------------glqelataaryklpvlivvlnNggygitgqlqettaggrysttdllgnpd
00451301   1/2  -------------------------------------------------------------------gvr
00488971   1/2  ------------------------------------------------------------------kgvr
00421021   1/2  -------------------------------------------------------------------gvr
00411671   1/2  ------------------------------------------------------------------kgvr
00420451   1/2  ------------------------------------------------------------------lgir
00521041   1/2  --------------------glqelstaarlklpvlivvln..Nggygitggqeraggrpsgtdlpppdf


                         +         -         -         -         -         *         -:210
query           VHDTAQIGPALDEAFTLANTAHRGPVFLDIPMDRLYDQAEITVTGQAAAEDRSPDPDAVAAVARLLSEAE
00524502   2/2  ----------------------------------------------------------------------
00451302   2/2  ----------------------------------------------------------------------
00512711   1/1  ----------------------------------------------------------------------
00421022   2/2  ----------------------------------------------------------------------
00424882   2/2  ----------------------------------------------------------------------
00424112   2/2  ----------------------------------------------------------------------
00420452   2/2  ----------------------------------------------------------------------
00411672   2/2  ----------------------------------------------------------------------
00512701   1/2  vtspeelpealarAfrlalsgrpGPvlldlpvdvllapvpvplplppllpllpprp--------------
00499682   2/2  ----------------------------------------------------------------------
00488972   2/2  ----------------------------------------------------------------------
00521031   1/2  vrvtspedlpealarAlaialsgrpGPvlidlpvdvllaevplpllllvllvlllp--------------
00451291   1/2  algkygvrvtdpeelpealdrAlaaals.rpgPvlldvpvdvleapvpppp-------------------
00488961   1/2  rvtdpeelpealdrAlaialsgrpGPvlldvpvdvllaevplpl--------------------------
00444781   1/2  rvtdpeelpealaralaaalsgrpgpvlievpvdvleapvpmvplglvllvlllprpep-----------
00524491   1/2  vtspeelpealarAlrlal.grpgPvlievpvdvleapvpvvl---------------------------
00421001   1/1  -------------------------------------------------prpapdpeaieeaaellaeAk
00421011   1/2  vtdpeelpealdrAlalalsgrpgPvlldvpvdvllapvpvplllppplp--------------------
00521042   2/2  ----------------------------------------------------------------------
00397381   1/2  vtspeelpealdeAlalalsgrpgpvlievpvdvleapvplpplllpplpr-------------------
00424871   1/2  vtdpeelpealdralaaal.grpgpvllevpvdvleapvplvp---------------------------
00420442   2/2  ----------------------------------------------------------------------
00487961   1/1  ------------------------PVvldlPkdvl...............rpppdpeaieeaaelLaaak
00424101   1/2  gvrvtdpeelpealkealalal.grpgpvlievpvdvldapvpl--------------------------
00444771   1/1  --------------------------------------------------rpapdpeaieeaaelLaaAk
00420441   1/2  laeafgkkgvrvttpeelpealdealaaal..rpgpvlievp----------------------------
00524481   1/1  ------------------------------------------------pprpapdpeaieeaaelLaaAk
00424102   2/2  ----------------------------------------------------------------------
00512691   1/1  --------------------------------------------------rpapdpealeeaaelLaaAk
00521021   1/1  ---------------------------------------------------ApapdpeaideaaelLana
00429171   1/1  ----------------------------dlPkDvllaevdpp...........pdeaaideaaellkeAk
00424872   2/2  ----------------------------------------------------------------------
00516051   1/1  -----------------------------------------------pvsrpapdpeaideaaelLaaAk
00397382   2/2  ----------------------------------------------------------------------
00486501   1/1  -----------------------------------------eplllplpvvrpapdpeaidaaaelLaaA
00444782   2/2  ----------------------------------------------------------------------
00476721   1/1  -------------------------------------------------plleldlkqikkalellleak
00365961   1/1  ----------------------------------------------------------------------
00421012   2/2  ----------------------------------------------------------------------
00451292   2/2  ----------------------------------------------------------------------
00524492   2/2  ----------------------------------------------------------------------
00444391   1/1  ----------------------------------------------------------------------
00488962   2/2  ----------------------------------------------------------------------
00414021   1/1  ----------------------------------------------------------------------
00512702   2/2  ----------------------------------------------------------------------
00521032   2/2  ----------------------------------------------------------------------
00488951   1/1  --------------------------------------------------evrpdpealeelaealdaak
00458571   1/1  arlaghivlapssvqeafdltleAfelAekyrt.PVivlldgfrlshsvepvelpdleelkkllpdekle
00514051   1/1  --------------------------------------------------pkaavivkpkvaaelikkAk
00367541   1/1  ---------------------------------------------------kevkeisveeaaelLknAk
00441011   1/1  ----------------------------------------------------------------------
00391971   1/1  ----------------------------------------------------------------------
00427621   1/1  ----------------------------------------------------------------------
00458581   1/1  ----------------------------------------------------------------------
00503941   1/1  ----------------------------------------------------------------------
00490281   1/1  ----------------------------------------------------------------------
00491361   1/1  ----------------------------------------------------------------------
00362701   1/1  ---------------------------------------------------gevkeisveeaaellknak
00404121   1/1  ----------------------------------------------------------------------
00424111   1/2  vddpeeleealkealai...grdgpvlievlvdpgegvpplvplgdlavdmvllleeielal--------
00524501   1/2  vedpeeleaalkealaaak..gdgpvlievlvdp------------------------------------
00424881   1/2  vedveeleaalkeale...ragdgpvlievvtdr------------------------------------
00499681   1/2  faklaeafGakgvrvddpeeleealkeal.....asdgpvlievl-------------------------
00451301   1/2  vdtpdeleealkeala....ksdgpvlievvtdrgdgvlplvplgyrlke--------------------
00488971   1/2  vdgpdeleealeeala.....gdgpvlievltd-------------------------------------
00421021   1/2  vddpeeleealkeala.....adgpvlievlvdpgtgvlplvplgkkid---------------------
00411671   1/2  vedpeeleealkeala.....adgpvlievltdp------------------------------------
00420451   1/2  vetpdeleealkeal.....aadgpvlievltdk------------------------------------
00521041   1/2  aalaeafGapgvrvdgpdeleealeeala.....gdgpv-------------------------------


                         -         -         -         +         -         -         -:280
query           RPVLVYGSDVWLDHAEQAALEAAEELGVPVVTNGQGRGVLPAGHPLLATRARGLALGRADLVIVVGTPLD
00524502   2/2  ----------------------------------------------------------------------
00451302   2/2  ----------------------------------------------------------------------
00512711   1/1  ----------------------------------------------------------------------
00421022   2/2  ----------------------------------------------------------------------
00424882   2/2  ----------------------------------------------------------------------
00424112   2/2  ----------------------------------------------------------------------
00420452   2/2  ----------------------------------------------------------------------
00411672   2/2  ----------------------------------------------------------------------
00512701   1/2  ----------------------------------------------------------------------
00499682   2/2  ----------------------------------------------------------------------
00488972   2/2  ----------------------------------------------------------------------
00521031   1/2  ----------------------------------------------------------------------
00451291   1/2  ----------------------------------------------------------------------
00488961   1/2  ----------------------------------------------------------------------
00444781   1/2  ----------------------------------------------------------------------
00524491   1/2  ----------------------------------------------------------------------
00421001   1/1  rPvilvGggalrsgaleelrelaeklgiPvvttlmgkgalpedheplflGmlGllgtpaanealeeaDlv
00421011   1/2  ----------------------------------------------------------------------
00521042   2/2  ----------------------------------------------------------------------
00397381   1/2  ----------------------------------------------------------------------
00424871   1/2  ----------------------------------------------------------------------
00420442   2/2  ----------------------------------------------------------------------
00487961   1/1  rPlilaGggar..gaaeelrelaeklgiPvvttlmgkgalpedhplylgmlgllgtpaanealeeaDlvl
00424101   1/2  ----------------------------------------------------------------------
00444771   1/1  rPvilvGggvlrsgaleelrelaeklgiPvvttlmgkgvvpedhplflgmypllllgllgtpaanealee
00420441   1/2  ----------------------------------------------------------------------
00524481   1/1  rPvilaGggai..gaaeelrelaeklgiPvvttlmgkgalpddhplylgmlGllgtaaanealeeaDlvl
00424102   2/2  ----------------------------------------------------------------------
00512691   1/1  rPvilvGggalrag..eelrelaeklgiPvvttlmgkgalpedhplylGmlGllgtpaanealeeaDlvl
00521021   1/1  krPvilvGggvrrsgaseelrelaeklgiPvvttlmgkgalpedhplylGpaanealeeaDlvlalGarl
00429171   1/1  rPvilvGggviragaseelrelaeklgiPvvttlmgkgalpedhplflgvylGllgtpaaneaveeaDlv
00424872   2/2  ----------------------------------------------------------------------
00516051   1/1  rPvilvGggvlrsgaseelrelaeklgiPvvttlmgkgalpedhplflGmllGllgtpaanealeeaDlv
00397382   2/2  ----------------------------------------------------------------------
00486501   1/1  krPvilvGggvlragaveelrelaeklgiPvvttlmgkgalpedhplflGmylGllgtpaanealeeaDl
00444782   2/2  ----------------------------------------------------------------------
00476721   1/1  rPvlyvGgGvinlsgaseelrelaellgiPvvttlmGlGafpaddplllgmlGmhGtyaanlavqeaDll
00365961   1/1  ----------------------------------------------------------------------
00421012   2/2  ----------------------------------------------------------------------
00451292   2/2  ----------------------------------------------------------------------
00524492   2/2  ----------------------------------------------------------------------
00444391   1/1  ----------------------------------------------------------------------
00488962   2/2  ----------------------------------------------------------------------
00414021   1/1  ----------------------------------------------------------------------
00512702   2/2  ----------------------------------------------------------------------
00521032   2/2  ----------------------------------------------------------------------
00488951   1/1  rPalvvGpdvdragavddavrlAerlrapvwvaPlssrcsFPedHplfaGflpaaiealselleghDlvl
00458571   1/1  aflpllldpirpvllggllglevyaegleh----------------------------------------
00514051   1/1  rPllivGpgllsde..elllelaeklnipvvatahslklllergilpdakplllveltnllldpdwpGld
00367541   1/1  rpvivaGgGvavaqAqeelrelaell......targkgvlpaihpl.agrmlghlnvllaeagvpy----
00441011   1/1  ----------------------------------------------------------------------
00391971   1/1  ----------------------------------------------------------------------
00427621   1/1  ----------------------------------------------------------------------
00458581   1/1  ----------------------------------------------------------------------
00503941   1/1  ----------------------------------------------------------------------
00490281   1/1  ----------------------------------------------------------------------
00491361   1/1  ----------------------------------------------------------------------
00362701   1/1  svvIvpGyGvavaqaqheltelaell......kakgknvkfaihpv.agrmpghlnvllaeagvpyd---
00404121   1/1  ----------------------------------------------------------------------
00424111   1/2  ----------------------------------------------------------------------
00524501   1/2  ----------------------------------------------------------------------
00424881   1/2  ----------------------------------------------------------------------
00499681   1/2  ----------------------------------------------------------------------
00451301   1/2  ----------------------------------------------------------------------
00488971   1/2  ----------------------------------------------------------------------
00421021   1/2  ----------------------------------------------------------------------
00411671   1/2  ----------------------------------------------------------------------
00420451   1/2  ----------------------------------------------------------------------
00521041   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           FRLNHGLFGGRDGAPLARTVHITDSPAQLATHLTLAGAVSGDLSAILRALAEQAKPKREVAQWRTEVAEA
00524502   2/2  ----------------------------------------------------------------------
00451302   2/2  ----------------------------------------------------------------------
00512711   1/1  ----------------------------------------------------------------------
00421022   2/2  ----------------------------------------------------------------------
00424882   2/2  ----------------------------------------------------------------------
00424112   2/2  ----------------------------------------------------------------------
00420452   2/2  ----------------------------------------------------------------------
00411672   2/2  ----------------------------------------------------------------------
00512701   1/2  ----------------------------------------------------------------------
00499682   2/2  ----------------------------------------------------------------------
00488972   2/2  ----------------------------------------------------------------------
00521031   1/2  ----------------------------------------------------------------------
00451291   1/2  ----------------------------------------------------------------------
00488961   1/2  ----------------------------------------------------------------------
00444781   1/2  ----------------------------------------------------------------------
00524491   1/2  ----------------------------------------------------------------------
00421001   1/1  lavGarlddrvtggf.....fapdakiihididpaeigkvylpdlalvgdakavLeaLlellegksalse
00421011   1/2  ----------------------------------------------------------------------
00521042   2/2  ----------------------------------------------------------------------
00397381   1/2  ----------------------------------------------------------------------
00424871   1/2  ----------------------------------------------------------------------
00420442   2/2  ----------------------------------------------------------------------
00487961   1/1  alGarlddrvtggl.....fapdakiihididpaeigknypvdlaivgdakavleaLlellkel.dlsew
00424101   1/2  ----------------------------------------------------------------------
00444771   1/1  aDlvlalGarlddrv...tgglslfapdakvihididpaeigkvyfpdlaivgdakavleaLlellkew.
00420441   1/2  ----------------------------------------------------------------------
00524481   1/1  alGarlddrvtggl.....fapdakiihididpaeigknypvdlpivgdakavleaLlellegke.dsew
00424102   2/2  ----------------------------------------------------------------------
00512691   1/1  avGarlddrvtgglsl...fapdakiihididpaeigknyppdvpivgdakavleaLlelleglslalll
00521021   1/1  ddrvtggkpllfap.kdakiihididpaeigknypadlaivgdakavleaLlellkelkldlsewlelia
00429171   1/1  laiGarlddrvtgglsl...fapgakvihididpaeigkvyfpdvpivgdakavleaLlellekls.lsa
00424872   2/2  ----------------------------------------------------------------------
00516051   1/1  laiGarlddr....vtgglslfapdakiihididpaeigknyppdv....dakavleaLlellker...s
00397382   2/2  ----------------------------------------------------------------------
00486501   1/1  vlalGarfddrv...tgglslfapdakiihididpaeigknyfpdlai.gdakaalea------------
00444782   2/2  ----------------------------------------------------------------------
00476721   1/1  ialGaRfddrvtgkl...dkfapnakkaaaegrggiihididpaeigklvkvdvpivgdvklvleallel
00365961   1/1  ----------------------------------------------------------------------
00421012   2/2  ----------------------------------------------------------------------
00451292   2/2  ----------------------------------------------------------------------
00524492   2/2  ----------------------------------------------------------------------
00444391   1/1  ----------------------------------------------------------------------
00488962   2/2  ----------------------------------------------------------------------
00414021   1/1  ----------------------------------------------------------------------
00512702   2/2  ----------------------------------------------------------------------
00521032   2/2  ----------------------------------------------------------------------
00488951   1/1  vlGapv..ftyhvegpgellpegaellqltddpaeaarapvgdalvadvrlaleallelveeser-----
00458571   1/1  ----------------------------------------------------------------------
00514051   1/1  g..lgnyDlviflGvryy.ladrvlsglkkfapdvktvsldrly.hpnadlsfp----------------
00367541   1/1  ----------------------------------------------------------------------
00441011   1/1  ----------------------------------------------------------------------
00391971   1/1  ----------------------------------------------------------------------
00427621   1/1  ----------------------------------------------------------------------
00458581   1/1  ----------------------------------------------------------------------
00503941   1/1  ----------------------------------------------------------------------
00490281   1/1  ----------------------------------------------------------------------
00491361   1/1  ----------------------------------------------------------------------
00362701   1/1  ----------------------------------------------------------------------
00404121   1/1  ----------------------------------------------------------------------
00424111   1/2  ----------------------------------------------------------------------
00524501   1/2  ----------------------------------------------------------------------
00424881   1/2  ----------------------------------------------------------------------
00499681   1/2  ----------------------------------------------------------------------
00451301   1/2  ----------------------------------------------------------------------
00488971   1/2  ----------------------------------------------------------------------
00421021   1/2  ----------------------------------------------------------------------
00411671   1/2  ----------------------------------------------------------------------
00420451   1/2  ----------------------------------------------------------------------
00521041   1/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           AAATAAKDREVLDSDASPIHPARIYGELNRILDDDAVVIGDGGDFVSYAGKYIQPRRPGNWLDPGPFGCL
00524502   2/2  ----------------ppltpqrvlralrealpedaivvsdvGtsqlwaarylrlpkprrfltsgglgtm
00451302   2/2  ----------------splgpqevlralaellpddaivvtdvGssqfw.arylrlprprrfltsgglgtm
00512711   1/1  -----------------eplgpaevlralaealpedaivvsdvGcsqrwaaryltlrrprtfllsgglgt
00421022   2/2  --------------lcpglgpqevlaalsealpedaivvsdvGcsqlwaarylrlrgprtfltsgglgtm
00424882   2/2  --------------lggplgpaevlralaellpddaivvtdvGtsqfwaarlllpk.prslltsgglgsm
00424112   2/2  -------------sdgpplgpqyvllalsealpedaivvsdvgtsqlwgarllrlrgprtfltsgglgtm
00420452   2/2  --------------dgdpltpayvlkalsellpddaivvtdvglsqfwa.rylrfpgprtfltsgglgtm
00411672   2/2  --------plrpplldpglgpqyvlkalsealpelpddaivvsdvGcsqfwaarylrlrrprsfltsggl
00512701   1/2  ----------------------------------------------------------------------
00499682   2/2  ------------pprlcpglgpaavlralskalpelglledaivvsdvgcsqrwaarylrfdkprtflts
00488972   2/2  -------rpgllghlglglgpeavlvalaaalpeddivvsdvgchqrwaarlltgrgprtllnsg.lgsm
00521031   1/2  ----------------------------------------------------------------------
00451291   1/2  ----------------------------------------------------------------------
00488961   1/2  ----------------------------------------------------------------------
00444781   1/2  ----------------------------------------------------------------------
00524491   1/2  ----------------------------------------------------------------------
00421001   1/1  wlaaleelrealelll........----------------------------------------------
00421011   1/2  ----------------------------------------------------------------------
00521042   2/2  -------------tdggplspghvlralyellllpedaivvsdvgcsqrwgarllgfpeprtflvsgglg
00397381   1/2  ----------------------------------------------------------------------
00424871   1/2  ----------------------------------------------------------------------
00420442   2/2  -------------------kpqtvaealvellpedgvdivfgdpGssvlwladalrasgpirfi...glg
00487961   1/1  leeiaelkeelll---------------------------------------------------------
00424101   1/2  ----------------------------------------------------------------------
00444771   1/1  .........................ldsgpltpq------------------------------------
00420441   1/2  ----------------------------------------------------------------------
00524481   1/1  leelleliaewreeld------------------------------------------------------
00424102   2/2  ---------------kpltvaealvealkel..gvdivfgdpGtsilpladalraprp..girsiglghe
00512691   1/1  alaewleeleelr............---------------------------------------------
00521021   1/1  elke...............pikpql---------------------------------------------
00429171   1/1  wlde------------------------------------------------------------------
00424872   2/2  ---------------------------------ekitvaealverLlelgvdivfgdpGdsilwladall
00516051   1/1  ewleeiaelreelll-------------------------------------------------------
00397382   2/2  ------------mssdlplllmtgaealveaLkelgvdivfgdpGssnlpladalrarpgirfilsg...
00486501   1/1  ----------------------------------------------------------------------
00444782   2/2  ---------------------ltvaealverLkelgvdivfgdpGdsnlpladalrr.girfiltrge..
00476721   1/1  lldled----------------------------------------------------------------
00365961   1/1  --------Rdhglllalgvdllkifrelggklpg....hpeggggsmhlg....setpgvepttgplGtg
00421012   2/2  ----------------------------------------------------------------------
00451292   2/2  ----------------------------------------------------------------------
00524492   2/2  ----------------------------------------------------------------------
00444391   1/1  --------Rgrlnvlalgvplleifaellgklpgh....pgggdvkmhlg....seslgvlfntghlgtg
00488962   2/2  ----------------------------------------------------------------------
00414021   1/1  ---------------------------------------------------------------------l
00512702   2/2  ----------------------------------------------------------------------
00521032   2/2  ----------------------------------------------------------------------
00488951   1/1  ----------------------------------------------------------------------
00458571   1/1  ----------------------------------------------------------------------
00514051   1/1  ----------------------------------------------------------------------
00367541   1/1  ----------------------------------------------------------------------
00441011   1/1  -------------------------------------------tfrqlgsglpghpepetpgvefttGpl
00391971   1/1  ------------------------------------------------------pergetpgvefttGpl
00427621   1/1  --------------------------------------------------------------vefttgpl
00458581   1/1  -------------------------------------------------------------------tlh
00503941   1/1  ---------------------------------------------------------------------l
00490281   1/1  ---------------------------------------------------------------------l
00491361   1/1  ---------------------------------------------------------------------l
00362701   1/1  ----------------------------------------------------------------------
00404121   1/1  ---------------------------------------------------------------------l
00424111   1/2  ----------------------------------------------------------------------
00524501   1/2  ----------------------------------------------------------------------
00424881   1/2  ----------------------------------------------------------------------
00499681   1/2  ----------------------------------------------------------------------
00451301   1/2  ----------------------------------------------------------------------
00488971   1/2  ----------------------------------------------------------------------
00421021   1/2  ----------------------------------------------------------------------
00411671   1/2  ----------------------------------------------------------------------
00420451   1/2  ----------------------------------------------------------------------
00521041   1/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           GTGMGYAIAARLVRPSSQVVALFGDGALGFSLADVDTLVRHNLPVVMVCGNNGIWGLEKAPMQLVYGYDV
00524502   2/2  GyglpaAlGaklanpdrrvvaivGDGsfqmglqelatavrynlpviivvlnNggygmirqqqeltggdry
00451302   2/2  GyglpaAlGaalaapdrrvvaivGDGsfqmglqelataaryklpviivvlnNngygiirglqelfyndl.
00512711   1/1  mGyglpaAlGaalalpdrrvvaviGDGsflmgleelntaarynlpvlivvlnNggygitgglqslttgyg
00421022   2/2  GyglpaAlGaalanpdrrvvaiiGDGsflmglqelatavrynlpviivvlnNggygmtrgqqeltgggry
00424882   2/2  GyglpaAlGaalalkllgpdrrvvalvGDGsfgmtlqelataaryglpviivvlnNggygiirqlqelty
00424112   2/2  GyglpaAlGaalanpdrrVvaivGDGsfqmglqelatavrynlpviivvlnNngygivrgqqeltygerl
00420452   2/2  GyglpaAlGaalanpdrrvvaivGDGsfgmtlqelataaryglpviivvlnNggygitrqqqsltypgnd
00411672   2/2  gtmGyglpaAlGaalarpdrrvvaiiGDGsflmglqelatavrynlpviivvlnNggygmtrgqqsltyg
00512701   1/2  ----------------------------------------------------------------------
00499682   2/2  gglgsmGyglpaAlGaalanpdrrvvaiiGDGsflmglqelataaryklpvlivvlnNggygitgqlqet
00488972   2/2  GyglpaAlGaalaapdrrvvaviGDGsflmgleelntaarynlpvvivvlnNggygitrglqeltggegl
00521031   1/2  ----------------------------------------------------------------------
00451291   1/2  ----------------------------------------------------------------------
00488961   1/2  ----------------------------------------------------------------------
00444781   1/2  ----------------------------------------------------------------------
00524491   1/2  ----------------------------------------------------------------------
00421001   1/1  ----------------------------------------------------------------------
00421011   1/2  ----------------------------------------------------------------------
00521042   2/2  imGyglpaAlGaala.pdrrvvaiiGDGsfqmglqelstaarlklpvlivvlnNggygit..ggqeragg
00397381   1/2  ----------------------------------------------------------------------
00424871   1/2  ----------------------------------------------------------------------
00420442   2/2  hegyalpaAiGaalatg.rgvvlvtgdggflnllqelatavryglpvlvivgnnggygigrgaqqelygg
00487961   1/1  ----------------------------------------------------------------------
00424101   1/2  ----------------------------------------------------------------------
00444771   1/1  ----------------------------------------------------------------------
00420441   1/2  ----------------------------------------------------------------------
00524481   1/1  ----------------------------------------------------------------------
00424102   2/2  gyalpaAiGaalatgdrgvvlltgdggflnllqelatavryglpvvvivgnnggygigrgaqq.......
00512691   1/1  ----------------------------------------------------------------------
00521021   1/1  ----------------------------------------------------------------------
00429171   1/1  ----------------------------------------------------------------------
00424872   2/2  arkgirfilsgh...egyalpaAiGaaratg.rgvvlvtgdggflnllqelatavreglpvvvivgnngg
00516051   1/1  ----------------------------------------------------------------------
00397382   2/2  hegaalpaAlGaalatgkpgvvlvtgdggflnllqelatavryglPvvvivgnnggygigrgaqqel...
00486501   1/1  ----------------------------------------------------------------------
00444782   2/2  ..gyalpaAlGaaratgkrgvvlvtgdggflnllqelatavreglPvlvivgnnpgygivgrgaqqe...
00476721   1/1  ----------------------------------------------------------------------
00365961   1/1  lpaAvGaAlAaklagpdrvvvaliGDGalseGmvhEalnlagllklpvlfvvenNg............ya
00421012   2/2  etllltgaealveaLkalgvdtvfgvpGssnlplldaladsgirvilvrhEgaaapaAiGaaratgkpgv
00451292   2/2  --kltgaealverLvelgvdtvfgvpGdsilplldalarsggirlilvrhElgAapaAiGaaratg.pgv
00524492   2/2  mmlltgaealveaLlaagvdtvfgvpgtpnlplldalaellpgirfilvrhEgaAlpaAiGaaratgkpg
00444391   1/1  lpvAvGaAlAakllgkdrvvvaliGDGalseGvvhealnlaallglpvlfvvvNNqigistpvgrqrs..
00488962   2/2  ggAapaAdGyaratgkpgvvlvtggpGflnlltelatavrdglPvlvivgnngtlglgrgaqqel.....
00414021   1/1  pvAvGaalAakllgkdrvvvaliGDGalseGvvhEalnlaalyklpvlfvvvnNqigistpverssay..
00512702   2/2  --llllelmlkllltgaealveaLlaagvdhvfgvpGtpnlplldalakspgirfilvrhEqaAafaAiG
00521032   2/2  lmkltgadalveaLkalgvdtvfgvpGgsilplldalldsgirlilvrhEgaAlpaAiGyaratgkpgVv
00488951   1/1  ----------------------------------------------------------------------
00458571   1/1  ----------------------------------------------------------------------
00514051   1/1  ----------------------------------------------------------------------
00367541   1/1  ----------------------------------------------------------------------
00441011   1/1  GqglsaAvGaAlalkllgalfnrglldlpdrvvvafiGDGalseGvshealnlaghlklgnlifildnNg
00391971   1/1  GqglpaAvGaAlaakllgalfnrplldlpdrvvvaliGDGalneGvslealnlAghlkldnlivivdnNg
00427621   1/1  GqglslAvGmAlaakllgalfnrplldlvdrvvvafiGDGalseGvfhEalnlAgvlkldnlifvvdnNg
00458581   1/1  gralgvalglklagpdlvvvvigGDGdaydiG..fealnhaarrnlnvvvlvlDNev-------------
00503941   1/1  pvAvGmAlAlkllgkdvvvvaliGDGalseGvvhEAlnlAgllklpvlfvvedNg............igi
00490281   1/1  pvAvGmalalkllgpdrvvvaviGDGalseGvvhEAlnlagllklpvlivvvdNg.igistpvdlrssay
00491361   1/1  pvAvGaAlalkllgelfnrglldlvdrvvvaliGDGalseGvvweAlnlagl.....lklpnlifivdnN
00362701   1/1  ----------------------------------------------------------------------
00404121   1/1  saAvGmAlalkylgarfnkdivdrrvyaliGDGeldeGvswealslaghlkldnlivilddNgi......
00424111   1/2  ----------------------------------------------------------------------
00524501   1/2  ----------------------------------------------------------------------
00424881   1/2  ----------------------------------------------------------------------
00499681   1/2  ----------------------------------------------------------------------
00451301   1/2  ----------------------------------------------------------------------
00488971   1/2  ----------------------------------------------------------------------
00421021   1/2  ----------------------------------------------------------------------
00411671   1/2  ----------------------------------------------------------------------
00420451   1/2  ----------------------------------------------------------------------
00521041   1/2  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           LADLAPQTRYDQVVTALGGGGELVTDPAEIGPALRRAFDSGVPYLVNIVTDPENVYPRKTMGV-------
00524502   2/2  .gtdlpnpdfaklaeafGakgvrvedpeeleaalkealaaakgdgpvlievlvdpee-------------
00451302   2/2  .....pnpdfaklaeafGanyvaridghkgvrvdtpdeleealkealaksdgpvlie-------------
00512711   1/1  ysgttlptgllllgllpdfaklaeafGapgvrvdgpdeleealeealaadgpvlievl------------
00421022   2/2  gtdl.pnpdfaalaeafGakgvrvddpeeleealkealaadgpvlievlvdpgtgvl-------------
00424882   2/2  ggrdlpn....pdfaklaeafGakgvltvrvedveeleaalkealeragdgpvliev-------------
00424112   2/2  sgtdlpnpdfaklaeafGakgvrvddpeeleealkealaigrdgpvlievlvdpgeg-------------
00420452   2/2  ....lpnpdfaklaeafGakyvalgirvetpdeleealkealaadgpvlievltdkgd------------
00411672   2/2  ggasgtdlpnpdfaklaeafGakgvrvedpeeleealkealaadgpvlievltdpgeg------------
00512701   1/2  ----------------------------------------------------------------------
00499682   2/2  taggrysttdllgnpdfaklaeafGakgvrvddpeeleealkealasdgpvlievltdrg.ldp------
00488972   2/2  sgtdlpnpdfaklaeafGakgvrvdgpdeleealeealagdgpvlievltd-------------------
00521031   1/2  ----------------------------------------------------------------------
00451291   1/2  ----------------------------------------------------------------------
00488961   1/2  ----------------------------------------------------------------------
00444781   1/2  ----------------------------------------------------------------------
00524491   1/2  ----------------------------------------------------------------------
00421001   1/1  ----------------------------------------------------------------------
00421011   1/2  ----------------------------------------------------------------------
00521042   2/2  rpsgtdlpppdfaalaeafGapgvrvdgpdeleealeealagdgpvlievltdrgtg-------------
00397381   1/2  ----------------------------------------------------------------------
00424871   1/2  ----------------------------------------------------------------------
00420442   2/2  dl.....pnpdfvklaeafgkkgvrvttpeelpealdealaaalrpgpvlievpvdv-------------
00487961   1/1  ----------------------------------------------------------------------
00424101   1/2  ----------------------------------------------------------------------
00444771   1/1  ----------------------------------------------------------------------
00420441   1/2  ----------------------------------------------------------------------
00524481   1/1  ----------------------------------------------------------------------
00424102   2/2  ......evdfaklaeafgkkgvrvtdpeelpealkealalalgrpgpvlievp-----------------
00512691   1/1  ----------------------------------------------------------------------
00521021   1/1  ----------------------------------------------------------------------
00429171   1/1  ----------------------------------------------------------------------
00424872   2/2  ygigrgaqqe.............pdfvklaeafgkkgarvtdpeelpealdralaa--------------
00516051   1/1  ----------------------------------------------------------------------
00397382   2/2  ..........dfvklaeafgkkgvrvtspeelpealdeAlalalsgrpgpvlievp--------------
00486501   1/1  ----------------------------------------------------------------------
00444782   2/2  ..........pdfvklaeaygkygvrvtdpeelpealaralaaalsgrpgpvliev--------------
00476721   1/1  ----------------------------------------------------------------------
00365961   1/1  istptglatasedlaaraeayGipgirVdGndvealyaalkealerarsgggPvlIev------------
00421012   2/2  vlvtggpgflnllqelatavreglPvvvivgnngglglgrgaqqel.....-------------------
00451292   2/2  vlvtgdggflnlltelatavreglPvlvivgqvnngllgmvallqellyg.-------------------
00524492   2/2  vvlvtggpGflnlltelatavrdglPvvvivgnnggygigrgaqqev.........--------------
00444391   1/1  .........tpdladraeafgipgirVdGnDveavyaalkeaveraragg--------------------
00488962   2/2  .......pdfvklaeaygkygarvtdpeelpealdrAlaialsgrpGPvll-------------------
00414021   1/1  ..........ptl.laeafgipgirVdGndveavyaalkealeyarkgggPvlievvty-----------
00512702   2/2  aaratgkpgvvlvtsgpGalnlltglatavrdglPvvvivgqrptlglgrg-------------------
00521032   2/2  lvtggpGalnlltelatavrdslPvvvivgnvprvllglgrgafqel....-------------------
00488951   1/1  ----------------------------------------------------------------------
00458571   1/1  ----------------------------------------------------------------------
00514051   1/1  ----------------------------------------------------------------------
00367541   1/1  ----------------------------------------------------------------------
00441011   1/1  y............sisgpvglasledlakrfeayGwnvirviwdGhdvea--------------------
00391971   1/1  y............sidgpvglqlledlakrfeayGwnvirvdGhsldvea--------------------
00427621   1/1  ............ysisgpvggqtledlaarfeayGwnvirvvdGhDvlav--------------------
00458581   1/1  ----------------------------------------------------------------------
00503941   1/1  stpvgrsrssedladraeafgipvirVdGhdveavyaalkeakeyaregg--------------------
00490281   1/1  e...........dlaarfeayGipvirvdGhDpeavyaalkeAleyarkg--------------------
00491361   1/1  gy............sisgpvsralsedladrfeayGwpvirvidGnlDve--------------------
00362701   1/1  ----------------------------------------------------------------------
00404121   1/1  ......sidgpvglalklledlekrfeaygwnvirviwgslwdallagdd--------------------
00424111   1/2  ----------------------------------------------------------------------
00524501   1/2  ----------------------------------------------------------------------
00424881   1/2  ----------------------------------------------------------------------
00499681   1/2  ----------------------------------------------------------------------
00451301   1/2  ----------------------------------------------------------------------
00488971   1/2  ----------------------------------------------------------------------
00421021   1/2  ----------------------------------------------------------------------
00411671   1/2  ----------------------------------------------------------------------
00420451   1/2  ----------------------------------------------------------------------
00521041   1/2  ----------------------------------------------------------------------