[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ54630.1


[Show Plain Result]

## Summary of Sequence Search
   1::603
   6::309  5.4e-66 31.0% 0038659 00386591 1/1   in kinase-like (PK-like)                
   2::330  3.8e-64 28.2% 0040302 00403021 1/1   in kinase-like (PK-like)                
  10::310  3.7e-63 31.0% 0034801 00348011 1/1   in kinase-like (PK-like)                
  11::266  3.7e-63 34.0% 0044924 00449241 1/1   in kinase-like (PK-like)                
  15::332  3.4e-62 27.6% 0041927 00419271 1/1   in kinase-like (PK-like)                
  15::266  3.8e-61 32.7% 0037714 00377141 1/1   in kinase-like (PK-like)                
  14::343    7e-61 27.7% 0041710 00417101 1/1   in kinase-like (PK-like)                
   9::280  7.6e-61 32.7% 0038373 00383731 1/1   in kinase-like (PK-like)                
  13::279  1.6e-60 31.7% 0049348 00493481 1/1   in kinase-like (PK-like)                
   5::288    1e-59 31.2% 0039145 00391451 1/1   in kinase-like (PK-like)                
  12::275  1.7e-59 33.7% 0041719 00417191 1/1   in kinase-like (PK-like)                
  11::276  2.7e-59 32.2% 0035371 00353711 1/1   in kinase-like (PK-like)                
  12::264  8.1e-59 32.8% 0036031 00360311 1/1   in kinase-like (PK-like)                
  11::335  1.4e-58 28.4% 0040179 00401791 1/1   in kinase-like (PK-like)                
   6::272  1.6e-58 30.6% 0040670 00406701 1/1   in kinase-like (PK-like)                
  10::267  1.8e-58 32.4% 0047734 00477341 1/1   in kinase-like (PK-like)                
   3::283  1.9e-58 30.4% 0042707 00427071 1/1   in kinase-like (PK-like)                
  14::309  2.3e-58 31.7% 0044036 00440361 1/1   in kinase-like (PK-like)                
  12::284  2.9e-58 31.7% 0041048 00410481 1/1   in kinase-like (PK-like)                
   8::279  3.1e-58 32.2% 0049347 00493471 1/1   in kinase-like (PK-like)                
   9::289  3.5e-58 30.4% 0039603 00396031 1/1   in kinase-like (PK-like)                
   6::276  5.3e-58 32.3% 0042918 00429181 1/1   in kinase-like (PK-like)                
  11::335  5.8e-58 28.1% 0040180 00401801 1/1   in kinase-like (PK-like)                
   3::309  6.8e-58 29.9% 0044407 00444071 1/1   in kinase-like (PK-like)                
  11::279  7.4e-58 32.6% 0037369 00373691 1/1   in kinase-like (PK-like)                
  12::279  8.4e-58 33.0% 0048206 00482061 1/1   in kinase-like (PK-like)                
   9::296  8.8e-58 30.6% 0037803 00378031 1/1   in kinase-like (PK-like)                
  12::279  1.1e-57 33.3% 0035615 00356151 1/1   in kinase-like (PK-like)                
   6::276  1.5e-57 31.2% 0037572 00375721 1/1   in kinase-like (PK-like)                
   4::309  1.6e-57 28.2% 0049795 00497951 1/1   in kinase-like (PK-like)                
  11::291  1.6e-57 29.7% 0043074 00430741 1/1   in kinase-like (PK-like)                
  17::332  2.1e-57 27.9% 0050990 00509901 1/1   in kinase-like (PK-like)                
  11::266  2.9e-57 34.5% 0035157 00351571 1/1   in kinase-like (PK-like)                
   4::320  3.5e-57 28.0% 0040727 00407271 1/1   in kinase-like (PK-like)                
  17::282    7e-57 31.6% 0047088 00470881 1/1   in kinase-like (PK-like)                
   6::276  9.4e-57 32.3% 0044907 00449071 1/1   in kinase-like (PK-like)                
  11::266  9.8e-57 32.9% 0048785 00487851 1/1   in kinase-like (PK-like)                
  16::274    1e-56 32.3% 0042315 00423151 1/1   in kinase-like (PK-like)                
   2::266  1.5e-56 31.7% 0051877 00518771 1/1   in kinase-like (PK-like)                
   2::285  1.7e-56 30.1% 0037668 00376681 1/1   in kinase-like (PK-like)                
  13::281  2.5e-56 31.5% 0038940 00389401 1/1   in kinase-like (PK-like)                
  11::272  3.9e-56 32.2% 0044203 00442031 1/1   in kinase-like (PK-like)                
  11::266  6.2e-56 33.7% 0046180 00461801 1/1   in kinase-like (PK-like)                
   6::276  6.5e-56 31.7% 0046998 00469981 1/1   in kinase-like (PK-like)                
   1::266  7.6e-56 32.0% 0052889 00528891 1/1   in kinase-like (PK-like)                
  11::277  1.3e-55 32.7% 0044547 00445471 1/1   in kinase-like (PK-like)                
   3::274  3.9e-55 32.5% 0037731 00377311 1/1   in kinase-like (PK-like)                
   8::279  5.1e-55 31.1% 0049538 00495381 1/1   in kinase-like (PK-like)                
  15::275  5.3e-55 32.6% 0041095 00410951 1/1   in kinase-like (PK-like)                
  15::266  7.3e-55 30.4% 0053164 00531641 1/1   in kinase-like (PK-like)                
  15::285  8.3e-55 30.0% 0051133 00511331 1/1   in kinase-like (PK-like)                
  17::266  9.5e-55 31.6% 0041767 00417671 1/1   in kinase-like (PK-like)                
   1::314  1.1e-54 27.5% 0038477 00384771 1/1   in kinase-like (PK-like)                
  13::292  1.2e-54 31.1% 0050905 00509051 1/1   in kinase-like (PK-like)                
  11::296  2.7e-54 30.7% 0049786 00497861 1/1   in kinase-like (PK-like)                
  11::272  5.4e-54 30.4% 0043269 00432691 1/1   in kinase-like (PK-like)                
  18::284  6.8e-54 31.8% 0046210 00462101 1/1   in kinase-like (PK-like)                
  11::280  9.9e-54 32.1% 0039686 00396861 1/1   in kinase-like (PK-like)                
  21::286  1.4e-53 29.8% 0049834 00498341 1/1   in kinase-like (PK-like)                
  14::275  6.4e-53 31.8% 0043658 00436581 1/1   in kinase-like (PK-like)                
  12::266  7.8e-53 32.0% 0048011 00480111 1/1   in kinase-like (PK-like)                
  11::268  4.8e-52 30.5% 0042354 00423541 1/1   in kinase-like (PK-like)                
  13::276  4.8e-52 32.9% 0046042 00460421 1/1   in kinase-like (PK-like)                
  18::266  8.1e-52 31.7% 0038413 00384131 1/1   in kinase-like (PK-like)                
  15::268  2.1e-51 31.6% 0039870 00398701 1/1   in kinase-like (PK-like)                
  11::266  6.7e-51 32.7% 0039792 00397921 1/1   in kinase-like (PK-like)                
  19::204  7.6e-42 36.6% 0044090 00440901 1/1   in kinase-like (PK-like)                
   1::191  2.8e-28 33.3% 0039408 00394081 1/1   in kinase-like (PK-like)                
   8::167  5.1e-26 30.8% 0041315 00413151 1/1   in kinase-like (PK-like)                
  19::164  3.3e-14 25.5% 0041592 00415921 1/1   in kinase-like (PK-like)                
   1::603


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAMAAGFPDGEELPEYIGPYKIRRRIGQGGMGVVYQAVDPQDRLVAVKVLRAEVAGDDIARARLAREVMT
00386591   1/1  -----glfsllelelltdryellkklGeGgfGtVylardlltgrlvAvKvlkk....sekllerflrEie
00403021   1/1  -ddellllsllelellldryellkllGeGgfGvVylardlltgrlvAvKvlkke........erflrEie
00348011   1/1  ---------leelelllddyellkllGeGgfGvVylarlkltgrlvAvKvlkkss..degllerflrEie
00449241   1/1  ----------lelllllddyellkllGeGgfGvVylarlkllsstgrlvAvKvlkksllllseellerfl
00419271   1/1  --------------latddyellellGkGgfGvVylardkltgelvAvKvlkkelllseellerflrEie
00377141   1/1  --------------lalddyellkllGeGgfGvVylarlkltgrlvAvKvlkkslllsekllerflrEie
00417101   1/1  -------------elllddyellkllGeGgfGvVylarlkltgrlvAvKvlkkelllseellerflrEie
00383731   1/1  --------slselllllddyellkllGeGgfGvVylarlkltgrlvAvKvlkkelllsekllerflrEie
00493481   1/1  ------------lelllddyellellGeGgfGvVylardlktgrlvAvKvlkksl..degllerflrEie
00391451   1/1  ----lklfsleelelatddyellellGeGgfGvVylarlklllgsltgrlvAvKvlkksl..seelleef
00417191   1/1  -----------elelllddyellkllgeGgfgvVylarlkltgrlvAvKvlkkdllldeellerflrEve
00353711   1/1  ----------lelelatddfellellGeGgfGtVykarl.tgelvAvKvlkke......llkeflrEiei
00360311   1/1  -----------elellldryellkllGeGgfGtVylardlltgrlvAvKvlkkd.....kllerflrEie
00401791   1/1  ----------lelelllddyellkvlGeGgfGvVylardkltgrlvAvKvlkke...sekllerflrEie
00406701   1/1  -----klfsleelelatddyellellGeGgfGvVykarlklllgsstgrlvAvKvlkksl..seellkef
00477341   1/1  ---------ldseleialddyellkllGeGgfgtVylardkkllglltgrlvavKvlkks..lseeller
00427071   1/1  --ssllllsllelelatddyellellGeGgfGvVylarlktgrlvAvKvlkk....seelleeflrEiei
00440361   1/1  -------------ellldryellkllGeGgfGvVylardlltgrlvAvKvlkk....sekllerflrEie
00410481   1/1  -----------elelatddyellellGeGgfGvVykavlkdtggllgrlvAvKvlkksl..seellkefl
00493471   1/1  -------fsleelllalddyellellGeGgfGvVylardlktgrlvAvKvlkksl..degllerflrEie
00396031   1/1  --------slselelllddyellkllGeGgfGvVylarlkltgrlvAvKvlkkslldlllsekllerflr
00429181   1/1  -----klfslselllatddyellellGeGgfGvVylavlktgrlvAvKvlkk....seelleeflrEiei
00401801   1/1  ----------lelelltddyellkvLGeGgfGvVylardlltgrlvAvKvlkke...sekllerflrEie
00444071   1/1  --dslrlfsllelelltdryellkllGeGgfGvVylardkktgrlvAvKvlkkell.dekllerflrEie
00373691   1/1  ----------lelllllddyellellGeGgfGvVylarlkltgrlvAvKvlkke...seellerflrEie
00482061   1/1  -----------elelllddyellkllgeGgfgtvylardklldktgrlvavKvlkksll..eellerflr
00378031   1/1  --------sleelelatddyellellGeGgfGvVykarlkdtgssrlvAvKvlkksl..seelleeflrE
00356151   1/1  -----------elelltddyellellGeGgfGvVylarlkdtsgrlvAvKvlkkell.seellerflrEi
00375721   1/1  -----klfslselelatddyellellGeGgfGvVylarlkllsllllstgrlvAvKvlkksl..seellk
00497951   1/1  ---llllfsleelllalddyellkllGeGgfGvVylardlltgrlvAvKvlkkslllseellerflrEie
00430741   1/1  ----------lelelatddyellellGeGgfGtVykarlkdtgllgrlvAvKvlkksl..seelleeflr
00509901   1/1  ----------------lddyellkllGeGgfGvVylardkltgrlvAvKvlkksllldekllerflrEie
00351571   1/1  ----------lelelllddyellkllGeGgfGkVylardkstgrlvAvKvlkkellldekllerflrEie
00407271   1/1  ---glklfsleelelatddyellkllGeGgfGtVykarlkltgellellvAvKvlkkel..seelleefl
00470881   1/1  ----------------lddyellellGeGgfGvVylardlltgrlvAvKvlkksll.seellerflrEik
00449071   1/1  -----klfsleelelatddyellellGeGgfGvVykarllllldlltgrlvAvKvlkksl..seellkef
00487851   1/1  ----------selellldryellkklGeGgfgtVylardkktgrlvAvKvlkksl..seellerflrEie
00423151   1/1  ---------------llddyellkllgeGgfgvVylarlkltgrlvAvKvlkkslllslllllsekller
00518771   1/1  -ldllgllsllllellldryellkllGeGgfGvVylardlktgrlvAiKvlkksll.dekllerflrEik
00376681   1/1  -sssllllsllelelatddyellellGeGgfGvVylarlktgrlvAvKvlkk....seelleeflrEiei
00389401   1/1  ------------lelllddyellkllGeGgfGvVylavlkltgrlvAvKvlkksl..legllerflrEie
00442031   1/1  ----------eelllatddyellellGeGgfGvVylavlkllsltgrlvAvKvlkkelllseelleeflr
00461801   1/1  ----------esgllplsllselgeildryellkklGeGgfgtVylardkktgelvAvKvlkksl.lsee
00469981   1/1  -----elpllseleillddyellkllGeGgfgtVylardkglldllsktgelvavKvlkksl..seelle
00528891   1/1  lldllglllllllellldryellkllGeGgfGvVylardlktgrlvAvKvlkkell.seellerflrEik
00445471   1/1  ----------eelelatddyellellgeGgfgvVylavl..grlvAvKvlkksll.seelleeflrEvei
00377311   1/1  --ssllllsllelllatddyellellGeGgfGvVylavlkltgrlvAvKvlkk....seelleeflrEie
00495381   1/1  -------llslsegellgdyel..llgeGgfgtVylardlktgelvavKvlkksll.seellerflrEie
00410951   1/1  --------------lllddyellkllgeGgfgvVylavlkltgrlvAvKvlkkslllseellerflrEie
00531641   1/1  --------------lllddyellellGeGgfgvVylardlltgrlvAvKvlkksll.seellerflrEie
00511331   1/1  --------------lllddyellkllgeGgfgvVylardlltgrlvAiKvlkksllldlllekllerflr
00417671   1/1  ----------------lddyellellGeGgfGvVylarlktgrlvAvKvlkksll.seellerflrEiei
00384771   1/1  sslllelllfsllelelatdryellkvlGeGgfGtVylarlketgrlvAvKvlkkdk.......eeflrE
00509051   1/1  ------------leldlddyelelkllgeGgfgtVylardkktgelllvavKvlkksll.deellerflr
00497861   1/1  ----------selllalddyellklllGeGgfgtVylardkktgelllvavKvlkksll..eellerflr
00432691   1/1  ----------lelelatddyellkvlGeGgfGkVykarlklllgsstgrlvAvKvlkksl..seelleef
00462101   1/1  -----------------DllggrykllkklgeGgfgtvylardlktgelvavKvlkkdsl.....lerll
00396861   1/1  ----------lelelatddfellellGeGgfGtVylarlkllsstgrlvAvKvlkksl..seelleeflr
00498341   1/1  --------------------ellkllGeGgfGvVylarlkltgrlvAvKvlkkslllllseqllkrflrE
00436581   1/1  -------------elalddyellellGeGgfGvVylavlktgrlvavKvlkk....seellkeflrEiei
00480111   1/1  -----------ssssllldlellllldlllllsllelellldryellkklGeGgfgtVylardlktgrlv
00423541   1/1  ----------lelelatddyellellGeGgfGkVykarlkgllgsltgrlvAvKvlkksl..seellkef
00460421   1/1  ------------glelalddyellkllgeGgfgtVylard.tgelvavKvlk.....seellerflrEie
00384131   1/1  -----------------ddyellellGeGgfGvVylarlkltgrlvAvKvlkkdll.seellerflrEie
00398701   1/1  --------------lalddyellellgeGgfgvVylavlktgrlvAvKvlkk....seellkeflrEiei
00397921   1/1  ----------lelellldryellkklGeGgfGtVylardlltgelvAvKvlkk......kllerflrEie
00440901   1/1  ------------------ryellkllgsGsfgvvylardktgrlvavKvlrkgllsflllllyllrlkll
00394081   1/1  Msvlt....idelfellggyeivellgggsfnkvylvtl.dggkvvlKvlrpg...vseeaedlerEari
00413151   1/1  -------ellaellpllggllvlevlgggssnrvyrvttddggdyvlKvappg......aaedlerEarl
00415921   1/1  ------------------gvvllvsvklgldpvlpldvfpedalelilellvplwkvlnegdleikrigg


                         -         -         *         -         -         -         -:140
query           MRRVRSRNVAEVIDADTTAPLPWVVTEYIPGPTLDSTVTNHGPLRGRALTRVVTGLARALRDIHAAEIIH
00386591   1/1  ilkrlseldlslllllghpnivrllgvfeegdsnglhlylvmEyl.ggsLfdllkklkggplseeevlri
00403021   1/1  ilkrlsnhpnivrllgvfedlldgegelylvmEyveggsLfdllkkrgglplseeealrialqilsaLey
00348011   1/1  ilkrlnhpnivkllgvfeddgelylvmEyveggsLldllkkrgplseeealrialqilsaLaylhslgii
00449241   1/1  rEieilkrlrghpnivkllgvfededelylvmEyveggsLfdllkkrgplseeealrialqillaLeyLH
00419271   1/1  ilkrlsslnhpnivrllgvfededelylvmEyveggsLfdllkkrgplseeealrialqilsaLeyLHsl
00377141   1/1  ilkrlnhpnivkllgvfldedelylvmEyveggsLldllrkrgplseeealrialqillaLeyLHslgii
00417101   1/1  ilkrlrhpnivkllgvfedddelylvmEyveggsLfdllkkrgplseeealrialqilsaLeyLHskgii
00383731   1/1  ilkrlnhpnivkllgvfldddelylvmEyveggsLldllkkrgplseelalrialqilsaLeylhslgii
00493481   1/1  ilarlnhpnivkllgvfeddgelylvmEyleggsLldllkkrgplseeealkialqillaLaylhselgi
00391451   1/1  lrEveilkrlrhpnivrllgvcldgdelylvmEymeggsLldllrkrgllllllslglplseelllrial
00417191   1/1  ilkrlrhpnivrllgvfleedldllllylvmEyveggsLldllrkrgplseelalrialqilsaLeylhs
00353711   1/1  lelkrlrhpnivrllgvcldedggllelylvmEympggsLldllrk.gplseeerlkialqiargLayLH
00360311   1/1  ilkrlnhhpnivkllgvfleddylylvmeyl.ggsLldllkkrggplseetvlrialqilsaLeylHskg
00401791   1/1  ilkrlnhpnivrllgvfedddelylvmEympggsLfdllkkrggplseeealkialqilsgLayLHslgi
00406701   1/1  lrEieilsrlrhpnivrllgvcleggelylvmEympggsLldllrkrgllllllllllllllllllllll
00477341   1/1  flrEieilkklrhpnivkllgvfededelylvmeyleggsLldllkkrgrkglllllllllseeealria
00427071   1/1  lkrlrhpnivkllgvf.eedelylvmEymeggsLldllrkrkggplseelllrialqiargLayLhslgi
00440361   1/1  ilkrlnhpnivrllgvfedddelylvmEyveggsLldllkkrggplseeealrialqilsaLeyLHslgi
00410481   1/1  rEieilsrlrhpnivrllgvcldddelylvmEymeggsLldllrkrkgplseelllrialqiargLayLh
00493471   1/1  ilarlnhpnivklygvfedegelylvmEyleggsLldllkkrgplseeealkialqilrgLaylHsklgi
00396031   1/1  EieilkrlnhpnivkllgvfedddelylvmEyveggsLldllkkrgplseeeallialqilsaLaylhsl
00429181   1/1  lkrlrhpnivrllgvc.eddelylvmEymeggsLldllrkrgglplseelllrialqiargLayLhslgi
00401801   1/1  ilkrlnhpnivkllgvfedddelylvmEyveggsLldllkkrglplseeealrialqilsgLeyLHslgi
00444071   1/1  ilkrlnhpnivrllgvfededslglllelylvmEym.ggsLldll..kgplseeevlkialqilsgLayL
00373691   1/1  ilkrlnhpnivkllgvfldddelylvmEyveggsLldllkk.gplseelalkialqilsaLaylhslgii
00482061   1/1  Eieilkrlrhpnivkllgvfed.delylvmeyleggsLldllkkrgkklseeevlrialqilsaleyLHs
00378031   1/1  ieilsrlsrhpnivkllgvcldegelylvmEympggsLldllrkrgllllllllllllslglplseelrl
00356151   1/1  eilkrlselnhpnivrllgvflllllseggelylvmEym.ggsLldllkkrklgplseelvlkialqilr
00375721   1/1  eflrEieilsklsrhpnivrllgvcleddelylvmEymeggsLldllrkrgllllllllllllslglpls
00497951   1/1  ilsrlnhpnivkllgvfedegelylvmEyveggsLldllkkrgplseeealkialqillgLaylhslgii
00430741   1/1  EieilsrlrhpnivkllgvcldeedelylvmEympggsLldllrkrggplseelrlkialqiargLayLh
00509901   1/1  ilkrllnhpnivklygvfedegllylvmEyleggdLldllkkrgplseeeallialqillaLeylhslgi
00351571   1/1  ilkrlnhpnivkllgvfedegelylvmEyveggsLfdllrkrgplseeealrialqillaLeyLHskgii
00407271   1/1  rEieilkrlrhpnivrllgvfldgd.lylvmEympggsLldllrkrkgplseelalrialqiargLayLh
00470881   1/1  ilkklnhpnivklldvfedegllylvmEyl.ggdLldllkklkggplseelallialqillaLaylhslg
00449071   1/1  lrEieilsrlsrhpnivrllgvcleglgelylvmEymeggsLldllrkrgllllllllllllllllplse
00487851   1/1  ilkrlnhpnivkllgvfededlnglgelylvmEyl.ggsLldllkk.gklseeealrialqilsgLeyLH
00423151   1/1  flrEieilkrlsnhpnivkllgvfededelylvmEyveggsLldllkkrgplseeealkialqilsaLay
00518771   1/1  ilkklnhpnivklldvfededslgllghlylvmEyl.ggdLfdll.k.gplseeealkialqillgLayl
00376681   1/1  lkrlrhpnivrllgvc.eddelylvmEymeggsLldllrkrrggplseelllrialqiargLayLhslgi
00389401   1/1  ilkrlnhpnivkllgvfleedllylvmEyveggsLldllrkrgplseelalrialqilsaLaylhslgii
00442031   1/1  Eveilkklrhpnivrllgvfldgd.lylvmEymeggsLldllrkrggplseelllrialqiasgLayLhs
00461801   1/1  llerflrEieilkklnhpnivkllgvfedesllgllgylylvmEyc.ggsLldll.kkgplseeeilria
00469981   1/1  rflrEieilkrlsnhpnivkllgvfededelylvmeyleggsLldllkkrgklllllllllllllllvls
00528891   1/1  ilkklnhpnivklldvfededslgslgelylvmEyl.ggdLldllkk.gplseeealkialqillgLayl
00445471   1/1  lkrlrhpnivrllgvc.egdelylvmeymeggsLldllrkrggplseelllrialqiargLayLhslgii
00377311   1/1  ilkrlrhpnivkllgvcldedelylvmEympggsLldllrkrkggplseelllrialqiasglayLhslg
00495381   1/1  ilkklnhpnivkllgvflllledgdelylvmeyleggsLldllkkrgplseeeilkialqilsaleyLHs
00410951   1/1  ilsrlnhpnivrllgvfldedllylvmEyvpggsLldllkkrgplseelallialqillaLaylhslgii
00531641   1/1  ilaklnhpnivkllgvfldeddgllylvmEyleggsLldllkkllkskgllseeeallialqillaLayl
00511331   1/1  EieilkrlnlghpnivklldvfededllylvmEylesggdLldllkkrgrlseeeallialqillaleyl
00417671   1/1  lkrlnhpnivkllgvfleddllylvmEyl.ggsLldllkkrggplseelvllialqilrgLaylhslgii
00384771   1/1  ieilkrlnhpnivrllgvfldedelsgllllylvmEympggsLldllkglrkkgplseeealkialqilr
00509051   1/1  Eieilkklnhpnivkllgvfe.ddelylvmeyleggsLldllkkrgplseeealkialqilsaLeyLHsk
00497861   1/1  Eieilkklnhpnivkllgvf.dedelylvmeyleggsLldllkkrgkplseeevlrialqilsaLeyLHs
00432691   1/1  lrEieilsrlsrhpnivrllgvcldedelylvmEymeggsLldllrkrglllllllllllllllllllll
00462101   1/1  rEikilkklsdhpnivkllgyfededylylvmeyl.ggsLedllrkkggrlseeevlrialqllsaleyl
00396861   1/1  EveilsrlrhpnivrllgvcldedelylvmEymeggsLldllrkrkgplseelalkialqiargLayLhs
00498341   1/1  ikilkrlnhpnivkllgvfedegllylvmEyleggdLldllkkrgllseeeallialqillaLaylhslg
00436581   1/1  lsklrhpnivkllgvfleedelylvmEymeggsLldllrkrkgplseelllkialqiargLayLhslgii
00480111   1/1  AvKvlkksslse......flrEieilkrlsnhpnivkllgvfedenldelylvmEyl.ggsLldllkkr.
00423541   1/1  lrEieilsklsrhpnivrllgvcleegelylvmEymeggsLldllrkrgllllllllllllllllllpls
00460421   1/1  ilkrlnhpnivkllgvfededlelylvmeyleggsLldllkklkkgplseeeilrialqilsaleyLHsk
00384131   1/1  ilkrlnhpnivrllgvfleddllylvmEyle.gsLldllkkrggplseelvllialqilsgLaylhslgi
00398701   1/1  lsklrhpnivkllgvfldedelylvmEymeggsLldllrkrglplseelllkialqiargLayLhslgii
00397921   1/1  ilkrlnghpnivkllgvfedpnedelylvmEyleggsLldll...gklseeealkialqilsaLeyLHsl
00440901   1/1  llllllerllrEarilkrlshpnipklydvf...d.lylvmeyieggslldll.......eeealkilrq
00394081   1/1  lerlakgvpvPkvlgfgegdgypylvmeyleGgtladll.....lseellkellrqlaealaklHsidls
00413151   1/1  lraLaeagvpvPrvlavgedggrpwlvmeylpGetladlll..dp......aalaralaealarLHaldp
00415921   1/1  Gltnevykvelpdgllkqggeprkvllriygngte.....lidrerEleilklLshrglvPklygffed.


                         +         -         -         -         -         *         -:210
query           RDLKPGNVIICNGEPIIIDFGIAYAVDGSKLTQTGTFVGTPSYLSPEVIEGSDLSPATDIHAWGATVAFA
00386591   1/1  alqilraLeyLHsklgiiHrDlKPeNiLldlldslledgvvklaDFGlarllddt....lttvvgtpgYm
00403021   1/1  LHslgiiHRDlKpeNiLldsldsdgvvklaDFGlarllsdg..tllttvvgtpgYmAPEvllgkpytpks
00348011   1/1  HrDlKpeNiLllsldedgvvklaDFGlarlldsd..tllttvvgtpgYmAPEvllggpyspksDvwSlGv
00449241   1/1  slgiiHRDlKpeNiLldedgvvklaDFGlarllssdeltllttvvgtpgYmAPEvllggplyyspksDvw
00419271   1/1  giiHRDlKpeNiLldedgvvklaDFGlarllsdge...lttvvgTpgYmAPEvllggpyygpksDvWSlG
00377141   1/1  HrDlKpeNiLldedgvvklaDFGlarllddg....lttvvgtpgYmAPEvllggpyteksDvWSlGvvly
00417101   1/1  HRDlKpeNiLldedgvvklaDFGlarllssge.tllttvvgtpgYmAPEvllggpyspksDvWSlGvvly
00383731   1/1  HrDlKpeNiLldedgvvklaDFGlarllsdgelllllttvvgtpgYmAPEvllggkyspksDvwSlGvvl
00493481   1/1  iHrDlKPeNiLldsdgvvklaDFGlarllddd...llttvvgTpgYmAPEvllggpydtksDvwSlGvvl
00391451   1/1  qiargLayLhskgiiHrDLKpeNiLldedgvvklaDFGlarllssgeltlllttvvgtpgYmAPEvllgg
00417191   1/1  lgiiHrDlKpeNiLldedgvvklaDFGlarllldglltllllttvvgtpgYmaPEvllggpystksDvws
00353711   1/1  elllgllgskgiiHrDlKpeNiLldedgvvklaDFGlarllssdettlllllttvvgtpgYmAPEvllgg
00360311   1/1  iiHrDlKpeNilldlldedgvvklaDFGlarllldgettlllllrllttlvgtpgYmaPEvllggpysrk
00401791   1/1  iHRDlKpeNiLldedllgvvklaDFGlarllsdg..tllttvvgTpgYmAPEvllggpyspksDvWSlGv
00406701   1/1  llplseelrlkialqiargLayLhskgiiHrDlKpeNiLldedgvvklaDFGlarllssgesllllttvv
00477341   1/1  lqilsaLeyLHskgiiHrDlkpeNilldedgvvkliDFGlarllsdselllllttlvgtpgYmaPEvllg
00427071   1/1  iHrDlKpeNiLldedgvvklaDFGlarllssdellllttvvgtpgYmAPEvllggkyttksDvwSlGvvl
00440361   1/1  iHrDlKpeNiLldlledgvvklaDFGlarllssg..tllttvvgtpgYmAPEvllggpyspksDvWSlGv
00410481   1/1  slgiiHrDlKpsNiLldedgvvklaDFGlarllssdellllllttvvgtpgYmAPEvllggkyttksDvw
00493471   1/1  iHrDlKPeNiLldedgvvklaDFGlarllddd...llttvvgTpgYmAPEvllggpydtksDvwSlGvvl
00396031   1/1  giiHrDlKpeNiLldsdglsllvvklaDFGlarllssd..tllttvvgtpgYmAPEvllggpyspksDvw
00429181   1/1  iHrDlKpeNiLldedgvvklaDFGlarllsddellllttvvgtpgYmAPEvllggkyttksDvwSlGvvl
00401801   1/1  iHrDlKpeNiLldeddlgvvklaDFGlarllsdd..tllttvvgTpgYmAPEvllggpyspksDvWSlGv
00444071   1/1  HslgiiHRDlKpeNiLldsdgvvklaDFGlarllsdg..tllttvvgTpgYmAPEvllggpystksDvWS
00373691   1/1  HrDlKpeNiLldedgvvklaDFGlarllssdetl.lttvvgtpgYmAPEvllgggyspksDvwSlGvvly
00482061   1/1  kgiiHrDlkpeNilldedgvvkliDfGlarllsddeltllttlvgtpgYmaPEvllggpyspksDvwslG
00378031   1/1  kialqiargLayLhskgiiHrDlKpeNiLldedgvvklaDFGlarllssddll..ttvvgtpgYmAPEvl
00356151   1/1  gLayLhslgiiHrDlKpeNiLldedgvvklaDFGlarllssd..tllttvvgtpgYmAPEvllggkystk
00375721   1/1  eelllkialqiargLayLhskgiiHrDlKpeNiLldedgvvklaDFGlarllssgestlllttvvgtpgY
00497951   1/1  HRDlKpeNiLldedgvvklaDFGlarllssd.....ttvvgtpgYmAPEvllllgggkydeksDvwSlGv
00430741   1/1  skgiiHrDlKpeNiLldedgvvklaDFGlarllssgesllllllttvvgtpgYmAPEvllggkyttksDv
00509901   1/1  iHRDlKpeNiLldedgvvklaDFGlarllssge.tllttvvgTpgYmAPEvllgkpydakvDvWSlGvil
00351571   1/1  HRDlKpeNiLldedgvvklaDFGlarllgdg....lttvvgtpgYmAPEvllggpyspksDvWSlGvvly
00407271   1/1  skgiiHrDlKpeNiLldedgvvklaDFGlarllssgettlllttvvgtpgYmAPEvllggkyteksDvwS
00470881   1/1  iiHrDlKpeNiLldedgvvklaDFGlarllss.dltllttvvgTpgYmAPEvllglkyystkvDvWSlGv
00449071   1/1  elllkialqiargLayLhskgiiHrDlKpeNiLldedgvvklaDFGlarllssgeltlllttvvgtpgYm
00487851   1/1  skgiiHrDlKpeNilldsdgvvklaDFGlarllsddeltltllttlvgtpgYmAPEvllglgpyspksDv
00423151   1/1  lhslgiiHrDlKpeNiLldedgvvklaDFGlarlldsg..tllttvvgtpgYmAPEvllgllslllgkys
00518771   1/1  HslgiiHRDlKPeNiLldsdgvvklaDFGlArllsdd..tllttvvgTpgYmAPEvllgkpydtkvDiWS
00376681   1/1  iHrDlKpsNiLldedgvvklaDFGlarllsddellllttvvgtpgYmAPEvllggkyttksDvwSlGvvl
00389401   1/1  HrDlKpeNiLldedgvvklaDFGlarllsdgetllllttvvgtpgYmAPEvllggpyyslksDvwSlGvv
00442031   1/1  lgiiHrDlKpeNiLldedgvvklaDFGlarllsddlllllllttvvgtpgYmAPEvllggkystksDvwS
00461801   1/1  lqilsaLeyLHskgiiHrDlKpeNilldedgvvkliDFGlarllddd....lttlvgtpgYmAPEvllgl
00469981   1/1  eeevlkialqilsaLeyLHskgiiHrDlKpeNilldedgvvkliDFGlarllsddeltlllttlvgtpgY
00528891   1/1  HslgiiHRDlKpeNiLldedgvvklaDFGlArllddt....lttvvgTpgYmAPEvllglkgydtkvDiW
00445471   1/1  HrDlKpeNiLldedgvvklaDFGlarllssslsllllttvvgtpgYmAPEvllgllggkyttksDvwSlG
00377311   1/1  iiHrDlKpeNiLldedgvvklaDFGlarlllsgellllttvvgtpgYmAPEvllggkystksDvwSlGvv
00495381   1/1  lgppiiHrDlkpeNilldedlgvvkliDfGlarllsdd...llttlvgtpgYmaPEvllg.pyspksDvw
00410951   1/1  HrDlKpeNiLldedgvvklaDFGlarllsssl...lttvvgtpgYmaPEvllgglyslksDvwslGvvly
00531641   1/1  hsllslllgiiHrDlKpeNiLldedgvvklaDFGlarllssdl.tllttvvgtpgYmAPEvllgkpydlk
00511331   1/1  hslgiiHrDlKpeNiLldledgvvklaDFGlarlldde...llttlvgtpgYmAPEvllglpyyglkvDv
00417671   1/1  HrDlKpeNiLldedgvvklaDFGlarllssgltl.lttvvgtpgYmAPEvllgglkystksDvwSlGvvl
00384771   1/1  gLayLHslgiiHrDlKpeNiLldedlgvvklaDFGlarllsdg..tllttvvgTpgYmAPEvllgglkyt
00509051   1/1  giiHrDlkpeNilldedgvvkliDfGlarllsddeltllllttlvgtpgYmaPEvllggpyspksDvwsl
00497861   1/1  kgiiHrDlkpeNilldedgvvkliDFGlarllsdseltllllttlvgtpgYmaPEvllggpyspksDvws
00432691   1/1  llplseeealkialqiargLayLhskgiiHrDLKpeNiLldedgvvklaDFGlarllssgettlllttvv
00462101   1/1  HskgivHrDlkpsNillglgdsdedgrvkliDFGlarllldpksgklityrekkslvgtpgYmapevllg
00396861   1/1  lgiiHrDlKpeNiLldedgvvklaDFGlarllsssellllllllttvvgtpgYmAPEvllggkyttksDv
00498341   1/1  iiHrDlKpeNiLldedgvvklaDFGlArllssdgtl.lttvvgTpgYmAPEvllglkyystkvDvWSlGv
00436581   1/1  HrDlkpeNiLldedgvvklaDFGlarllssdlllllttvvgtpgYmAPEvllggkyttksDvwSlGvvly
00480111   1/1  .lseeevlrialqilsgLeyLHskgiiHrDlKpeNilldledgvvklaDFGlarllsddel..lttlvgt
00423541   1/1  eelllkialqiargLayLhskgiiHrDlKpeNiLldedgvvklaDFGlarllssgetllllttvvgtpgY
00460421   1/1  giiHrDlkpeNilldedgvvkliDfGl......lsltllttlvgtpgllYmaPEvllggpyspksDvwsl
00384131   1/1  iHrDlKpeNiLldedgvvklaDFGlarllsdgltl.lttvvgtpgYmAPEvllggkyystksDvwSlGvv
00398701   1/1  HrDlkpeNiLldedgvvklaDFGlarlllsdellllttvvgtpgYmaPEvllggkytlksDvwSlGvvly
00397921   1/1  giiHrDlKpeNiLldedlgvvklaDFGlarllsdd..tllttvvgtpgYmAPEvllglgkyspksDvWSl
00440901   1/1  llealaylhsagivHrDlkpeNilldedgvkliDFglarlldepedlalllrdlvgtpaymaPE------
00394081   1/1  dlpfagslelslaellalleellvdlalsdllklllldlleelldlleall-------------------
00413151   1/1  adcpflgrlvtylerllarleallaal-------------------------------------------
00415921   1/1  ...glvmeyiegrtltdedlldpe----------------------------------------------


                         -         -         -         +         -         -         -:280
query           ATGNPPYGAGAFEVIFFRILNGEINLDGVPEPLRPIVQDAVQRDPRKRPTAEELVARTEQLNLDLPWMED
00386591   1/1  APEvllggpyspksDvWSlGvilyelltgrppfdglsasdllleldqlalilellgtpplellllllllr
00403021   1/1  DvWSlGvvlyelltgrppfpglsplelllkilkglgtpdlllrlplppglspelkdlilkclakdpekRp
00348011   1/1  vlyelltgrppfdglsllellllilkglllpllelppllspelldlilkclqkdpekRptaeellehlff
00449241   1/1  SlGvvlyelltgrppfdglsplellllilkglltpplplppglspelldlilkclq--------------
00419271   1/1  vvlyelltgrppfdgesplelllkilkllglplplppglspelkdlilkclqkdpekRptmaevvaeell
00377141   1/1  elltgrppfdglsplellllilkgllplpeelspelkdlilkclqkdpekRptmae--------------
00417101   1/1  elltgrppfdglsplelllkilkgllplpellspelkdlilkclqkdpekRpgsleetaeellehpfllg
00383731   1/1  yelltgrppfdglsllellllilkgllplpeelspelldlilkclakdpekRptaeellkhlfflllllp
00493481   1/1  yelltgrppfpgesllellllilkgklslllgtpslellllllsllllllllllllleglllelldpll-
00391451   1/1  kyttksDvwSlGvvlyelltlgrppfdglsplellelilkglrlplpellspelldlilkclqkdpekRp
00417191   1/1  lGvvlyelltgrppfdglsllellllilkglllpllelppglspelldlilkclakdpekRpsaa-----
00353711   1/1  lgllllkyttksDvwSlGvvlyelltgrppfdglsplelllkilkgllllpeevlplllslrllel----
00360311   1/1  sDvwSlGvvlyelltgrlpfpglselelllkilkglglllllllpllppglspe----------------
00401791   1/1  vlyelltgrppfdgesplelllkilkglglpplelppglspelldlilkclqkdpekRptaeellehpfl
00406701   1/1  gtpgYmAPEvllggkyttksDvwSlGvvlyelltlgrppfpglsplellllilkglrlplpe--------
00477341   1/1  gpyspksDvwslGvvlyelltlgklpfdglsplellekilegllpplpedlspelkd-------------
00427071   1/1  yelltlgrppfdglsllellllilkglrlplpellspelldlilkclakdpekRptasevlehlflllll
00440361   1/1  vlyelltgrppfpglsllelllkilkglllpllelppglspelldlilkclqkdpekRptaeellehpfl
00410481   1/1  SlGvvlyelltlgrppfdglsllellllilkglrlplpellspelldlilrclakdpekRptasevlehl
00493471   1/1  yelltgrppfpgesllelllkilkglgtpseellplllsllllllllllllllllvllllleglllell-
00396031   1/1  SlGvvlyelltgrppfpglsllellllilkglllpllelppllspelldlilkclakdpekRpsaeelle
00429181   1/1  yelltlgrppfdglsllellllilkglrlplpellspelldlilkclaldpekRptasevlehlfl----
00401801   1/1  vlyelltgrppfdgesplelllkilkglglppeelppglspelkdlilkclqkdpekRptaeellehpfl
00444071   1/1  lGvvlyelltgrppfpgeselelllkilkglgtpplellllllllllllllllllllllllglllllldl
00373691   1/1  elltgrppfdglsllellllilkglglllplppllspelldlilkclqkdpekRptasellehlfflll-
00482061   1/1  vilyelltlgklpfpglsllellekileglllplpedlspelldlilkclqldpekRpsaeellehlff-
00378031   1/1  lggkyteksDvwSlGvvlyelltlgrppfdglsplellelilkglrlplpedlspelldlilkclqkdpe
00356151   1/1  sDvWSlGvvlyelltgrppfdglselellllilkglgtpslelllllllllllllllldlllllplppl-
00375721   1/1  mAPEvllggkyttksDvwSlGvvlyelltlgrppfdglsplellllilkglrlplpellspelldl----
00497951   1/1  vlyelltgrppfdglsllellllilkgllrpllppllspelkdlilkclqkdpekRpsaeellehlffll
00430741   1/1  wSfGvvlyelltlgrppfdglsplellelilkglrlplpeelspelldlilkclqkdpekRptasevleh
00509901   1/1  yelltgrppfpgesllelllkilkgllplpedlspelkdlilkllqkdpekRptaaeellehpfflglll
00351571   1/1  elltgrppfpglsplelllkilkgllplpeglspelkdlilkclqkdpekRptsae--------------
00407271   1/1  lGvvlyelltlgrppfdglsplellekilkglrlplpedlspelldlilkclqkdpekRptasellehlf
00470881   1/1  ilyelltgrppfpglsllellllilkllgtpslelllllllllllllllllldpllllllppllspelld
00449071   1/1  APEvllggkyttksDvwSlGvvlyelltlgrppfpglsllellllilkgllrpplppllspelldl----
00487851   1/1  wslGvilyelltgkppfpglsplellekilkllgtpslellllllslllldllkll--------------
00423151   1/1  lksDvwSlGvvlyelltgrppfdglsllellllilrglllpllelppllspelldlilkclqkd------
00518771   1/1  lGvilyelltgrppfpgeselelllkilkglgtppeelllslllllllllllllll--------------
00376681   1/1  yelltlgrppfdglsllellllilkglrlplpellspelldlilkclakdpekRptasevlehlffllll
00389401   1/1  lyelltgrppfdglsllellllilkglllllllppllspelldlilkclaldpekRptasevlehlffls
00442031   1/1  lGvvlyelltlgrppfdglsllellllilkgllrlplppelspelldlilkclakdpekRps--------
00461801   1/1  gpyspksDvwslGvilyelltgkppfdgesplellekilkllgtpplelllkllll--------------
00469981   1/1  maPEvllggpyspksDvwslGvilyelltlgklpfdglsplellekilkglrlplpedlspelkdl----
00528891   1/1  SlGvilyelltgrppfpgeselelllkilkglgtppeellllllllllllllllll--------------
00445471   1/1  vvlyelltgrlpfdglsllellllilkglllpllllllppllspelldlilkclakdpekRpsasev---
00377311   1/1  lyelltlgrppfdglsllellllilkglrlplpellspelldlilkclqldpekRptasevleh------
00495381   1/1  slGvilyelltgklpfdglldldellekilelglplplpellspelkdlilkclqldpekRpsaeel..-
00410951   1/1  elltgrppfdglsllellllilkgllplpeelspelldlilkclaldpekRpsasellehlflkg-----
00531641   1/1  sDvwslGvvlyelltgrppfpglsllellllilkglllplpellspelldlilkcl--------------
00511331   1/1  wslGvilyelltgrlpfpglsllelllli.....lppllspelldlilkllqkdpekRptaeellehpff
00417671   1/1  yelltgrppfpglsllellllilkllgtpslelllllllllllllllllldlllll--------------
00384771   1/1  tksDvWSlGvvlyelltgrppfdgeselelllkilkglgtpslellllvlsllllglllelldprlllpl
00509051   1/1  GvilyelltlgklpfdglsplellekilkglrpplppglspelldlilkclqldpekRpsaeel......
00497861   1/1  lGvvlyelltlgklpfdglsllellekilkgllpplpedlspelkdlilkclqldpekRpsaeelle...
00432691   1/1  gtpgYmAPEvllggkyttksDvWSlGvvlyelltlgrppfpglsplellekildgllrpplp--------
00462101   1/1  keysrksDiwslGvilyelltgklpfqglsdlellekikkilelklptppeellkglpeelkdlikklls
00396861   1/1  wSlGvvlyelltlgrppfdglsllellllilkglrlplpeelspelldlilkclqkdpekRptasevleh
00498341   1/1  ilyelltgrppfpglsllellllilkllgtpslelllsllllllllllllldlllllelppllspelldl
00436581   1/1  elltlgrppfdglsllellllilkglrlplpellspelldlilkclakdpekRptasevlehlfl-----
00480111   1/1  pgYmAPEvllggpyyspksDvwslGvilyelltgklPlfdglsplellelilkglg--------------
00423541   1/1  mAPEvllggkyttksDvwSlGvvlyelltlgrppfpglsllelllkildgllrpplpp------------
00460421   1/1  GvilyelltlgklpfdglsllellelilkglllplppelspelldlilkclqldpekRpsaeellk----
00384131   1/1  lyelltgrppflpglsllellllilkglgtpslelllllllllllllllllldlll--------------
00398701   1/1  elltlgkppfpglsllellllilkglrlplpellseelldlilkclaldpekRptase------------
00397921   1/1  Gvvlyelltgrppfdpgeselelllkilkglgtpslelllklllllllllllllll--------------
00440901   1/1  ----------------------------------------------------------------------
00394081   1/1  ----------------------------------------------------------------------
00413151   1/1  ----------------------------------------------------------------------
00415921   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           EYRSSGMTGLHTVSADLPTSTPQPAPPEPEENQATAVAEAAAPDRTMVAPEGFGDDEEEQDSGRRYDHYY
00386591   1/1  lllllllllllllglllelldkilngrlp-----------------------------------------
00403021   1/1  taeellehpflkgllllllllllllppllplllsllllslllllllssll--------------------
00348011   1/1  llllllllllllllllllllllllsllssl----------------------------------------
00449241   1/1  ----------------------------------------------------------------------
00419271   1/1  ehpffrglllllllllllppplvpllsslldlssldllllslllllllllll------------------
00377141   1/1  ----------------------------------------------------------------------
00417101   1/1  llllllllllllppllplllslldlslldllllslllllslssssllsllllslllllsllsl-------
00383731   1/1  ----------------------------------------------------------------------
00493481   1/1  ----------------------------------------------------------------------
00391451   1/1  tasevleh--------------------------------------------------------------
00417191   1/1  ----------------------------------------------------------------------
00353711   1/1  ----------------------------------------------------------------------
00360311   1/1  ----------------------------------------------------------------------
00401791   1/1  kgllllllllllllppllpllssllslslllllllssslslslsssslsssslls---------------
00406701   1/1  ----------------------------------------------------------------------
00477341   1/1  ----------------------------------------------------------------------
00427071   1/1  lel-------------------------------------------------------------------
00440361   1/1  kglllllllllllllllllllllllllsl-----------------------------------------
00410481   1/1  ffll------------------------------------------------------------------
00493471   1/1  ----------------------------------------------------------------------
00396031   1/1  hlfflllll-------------------------------------------------------------
00429181   1/1  ----------------------------------------------------------------------
00401801   1/1  kgllllllllllppllplllslldtslfdllllslllslslslsslllssslsls---------------
00444071   1/1  llllplppelspelldlllkclqkdpekR-----------------------------------------
00373691   1/1  ----------------------------------------------------------------------
00482061   1/1  ----------------------------------------------------------------------
00378031   1/1  kRptasevlehlffll------------------------------------------------------
00356151   1/1  ----------------------------------------------------------------------
00375721   1/1  ----------------------------------------------------------------------
00497951   1/1  llllllllllllllllllllllllllsll-----------------------------------------
00430741   1/1  lfflllllell-----------------------------------------------------------
00509901   1/1  lllllllllllllpllllllllslllllllllllllllllslllllllllll------------------
00351571   1/1  ----------------------------------------------------------------------
00407271   1/1  fllllllllllllllllllllllllllllsllllllllll------------------------------
00470881   1/1  ll--------------------------------------------------------------------
00449071   1/1  ----------------------------------------------------------------------
00487851   1/1  ----------------------------------------------------------------------
00423151   1/1  ----------------------------------------------------------------------
00518771   1/1  ----------------------------------------------------------------------
00376681   1/1  lelll-----------------------------------------------------------------
00389401   1/1  l---------------------------------------------------------------------
00442031   1/1  ----------------------------------------------------------------------
00461801   1/1  ----------------------------------------------------------------------
00469981   1/1  ----------------------------------------------------------------------
00528891   1/1  ----------------------------------------------------------------------
00445471   1/1  ----------------------------------------------------------------------
00377311   1/1  ----------------------------------------------------------------------
00495381   1/1  ----------------------------------------------------------------------
00410951   1/1  ----------------------------------------------------------------------
00531641   1/1  ----------------------------------------------------------------------
00511331   1/1  kglll-----------------------------------------------------------------
00417671   1/1  ----------------------------------------------------------------------
00384771   1/1  ppelspelldlllkclqkdpekRptaeevlehpf------------------------------------
00509051   1/1  .....ellllnl----------------------------------------------------------
00497861   1/1  ......pllalllsll------------------------------------------------------
00432691   1/1  ----------------------------------------------------------------------
00462101   1/1  ldpe------------------------------------------------------------------
00396861   1/1  ----------------------------------------------------------------------
00498341   1/1  llkllq----------------------------------------------------------------
00436581   1/1  ----------------------------------------------------------------------
00480111   1/1  ----------------------------------------------------------------------
00423541   1/1  ----------------------------------------------------------------------
00460421   1/1  ----------------------------------------------------------------------
00384131   1/1  ----------------------------------------------------------------------
00398701   1/1  ----------------------------------------------------------------------
00397921   1/1  ----------------------------------------------------------------------
00440901   1/1  ----------------------------------------------------------------------
00394081   1/1  ----------------------------------------------------------------------
00413151   1/1  ----------------------------------------------------------------------
00415921   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           DATLRPEEFRDILTPVDYEGRNRDSADYDDEPPSLLERFRAYRRGEDRLSDYFSDDEDDYYDEYEAKRLP
00386591   1/1  ----------------------------------------------------------------------
00403021   1/1  ----------------------------------------------------------------------
00348011   1/1  ----------------------------------------------------------------------
00449241   1/1  ----------------------------------------------------------------------
00419271   1/1  ----------------------------------------------------------------------
00377141   1/1  ----------------------------------------------------------------------
00417101   1/1  ----------------------------------------------------------------------
00383731   1/1  ----------------------------------------------------------------------
00493481   1/1  ----------------------------------------------------------------------
00391451   1/1  ----------------------------------------------------------------------
00417191   1/1  ----------------------------------------------------------------------
00353711   1/1  ----------------------------------------------------------------------
00360311   1/1  ----------------------------------------------------------------------
00401791   1/1  ----------------------------------------------------------------------
00406701   1/1  ----------------------------------------------------------------------
00477341   1/1  ----------------------------------------------------------------------
00427071   1/1  ----------------------------------------------------------------------
00440361   1/1  ----------------------------------------------------------------------
00410481   1/1  ----------------------------------------------------------------------
00493471   1/1  ----------------------------------------------------------------------
00396031   1/1  ----------------------------------------------------------------------
00429181   1/1  ----------------------------------------------------------------------
00401801   1/1  ----------------------------------------------------------------------
00444071   1/1  ----------------------------------------------------------------------
00373691   1/1  ----------------------------------------------------------------------
00482061   1/1  ----------------------------------------------------------------------
00378031   1/1  ----------------------------------------------------------------------
00356151   1/1  ----------------------------------------------------------------------
00375721   1/1  ----------------------------------------------------------------------
00497951   1/1  ----------------------------------------------------------------------
00430741   1/1  ----------------------------------------------------------------------
00509901   1/1  ----------------------------------------------------------------------
00351571   1/1  ----------------------------------------------------------------------
00407271   1/1  ----------------------------------------------------------------------
00470881   1/1  ----------------------------------------------------------------------
00449071   1/1  ----------------------------------------------------------------------
00487851   1/1  ----------------------------------------------------------------------
00423151   1/1  ----------------------------------------------------------------------
00518771   1/1  ----------------------------------------------------------------------
00376681   1/1  ----------------------------------------------------------------------
00389401   1/1  ----------------------------------------------------------------------
00442031   1/1  ----------------------------------------------------------------------
00461801   1/1  ----------------------------------------------------------------------
00469981   1/1  ----------------------------------------------------------------------
00528891   1/1  ----------------------------------------------------------------------
00445471   1/1  ----------------------------------------------------------------------
00377311   1/1  ----------------------------------------------------------------------
00495381   1/1  ----------------------------------------------------------------------
00410951   1/1  ----------------------------------------------------------------------
00531641   1/1  ----------------------------------------------------------------------
00511331   1/1  ----------------------------------------------------------------------
00417671   1/1  ----------------------------------------------------------------------
00384771   1/1  ----------------------------------------------------------------------
00509051   1/1  ----------------------------------------------------------------------
00497861   1/1  ----------------------------------------------------------------------
00432691   1/1  ----------------------------------------------------------------------
00462101   1/1  ----------------------------------------------------------------------
00396861   1/1  ----------------------------------------------------------------------
00498341   1/1  ----------------------------------------------------------------------
00436581   1/1  ----------------------------------------------------------------------
00480111   1/1  ----------------------------------------------------------------------
00423541   1/1  ----------------------------------------------------------------------
00460421   1/1  ----------------------------------------------------------------------
00384131   1/1  ----------------------------------------------------------------------
00398701   1/1  ----------------------------------------------------------------------
00397921   1/1  ----------------------------------------------------------------------
00440901   1/1  ----------------------------------------------------------------------
00394081   1/1  ----------------------------------------------------------------------
00413151   1/1  ----------------------------------------------------------------------
00415921   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           WVMVVPVALGIVGLTLMMPTIGLILGTLAVTVLGGLDLARREHARRLHERGPRSSDNVVIALSMPWALLR
00386591   1/1  ----------------------------------------------------------------------
00403021   1/1  ----------------------------------------------------------------------
00348011   1/1  ----------------------------------------------------------------------
00449241   1/1  ----------------------------------------------------------------------
00419271   1/1  ----------------------------------------------------------------------
00377141   1/1  ----------------------------------------------------------------------
00417101   1/1  ----------------------------------------------------------------------
00383731   1/1  ----------------------------------------------------------------------
00493481   1/1  ----------------------------------------------------------------------
00391451   1/1  ----------------------------------------------------------------------
00417191   1/1  ----------------------------------------------------------------------
00353711   1/1  ----------------------------------------------------------------------
00360311   1/1  ----------------------------------------------------------------------
00401791   1/1  ----------------------------------------------------------------------
00406701   1/1  ----------------------------------------------------------------------
00477341   1/1  ----------------------------------------------------------------------
00427071   1/1  ----------------------------------------------------------------------
00440361   1/1  ----------------------------------------------------------------------
00410481   1/1  ----------------------------------------------------------------------
00493471   1/1  ----------------------------------------------------------------------
00396031   1/1  ----------------------------------------------------------------------
00429181   1/1  ----------------------------------------------------------------------
00401801   1/1  ----------------------------------------------------------------------
00444071   1/1  ----------------------------------------------------------------------
00373691   1/1  ----------------------------------------------------------------------
00482061   1/1  ----------------------------------------------------------------------
00378031   1/1  ----------------------------------------------------------------------
00356151   1/1  ----------------------------------------------------------------------
00375721   1/1  ----------------------------------------------------------------------
00497951   1/1  ----------------------------------------------------------------------
00430741   1/1  ----------------------------------------------------------------------
00509901   1/1  ----------------------------------------------------------------------
00351571   1/1  ----------------------------------------------------------------------
00407271   1/1  ----------------------------------------------------------------------
00470881   1/1  ----------------------------------------------------------------------
00449071   1/1  ----------------------------------------------------------------------
00487851   1/1  ----------------------------------------------------------------------
00423151   1/1  ----------------------------------------------------------------------
00518771   1/1  ----------------------------------------------------------------------
00376681   1/1  ----------------------------------------------------------------------
00389401   1/1  ----------------------------------------------------------------------
00442031   1/1  ----------------------------------------------------------------------
00461801   1/1  ----------------------------------------------------------------------
00469981   1/1  ----------------------------------------------------------------------
00528891   1/1  ----------------------------------------------------------------------
00445471   1/1  ----------------------------------------------------------------------
00377311   1/1  ----------------------------------------------------------------------
00495381   1/1  ----------------------------------------------------------------------
00410951   1/1  ----------------------------------------------------------------------
00531641   1/1  ----------------------------------------------------------------------
00511331   1/1  ----------------------------------------------------------------------
00417671   1/1  ----------------------------------------------------------------------
00384771   1/1  ----------------------------------------------------------------------
00509051   1/1  ----------------------------------------------------------------------
00497861   1/1  ----------------------------------------------------------------------
00432691   1/1  ----------------------------------------------------------------------
00462101   1/1  ----------------------------------------------------------------------
00396861   1/1  ----------------------------------------------------------------------
00498341   1/1  ----------------------------------------------------------------------
00436581   1/1  ----------------------------------------------------------------------
00480111   1/1  ----------------------------------------------------------------------
00423541   1/1  ----------------------------------------------------------------------
00460421   1/1  ----------------------------------------------------------------------
00384131   1/1  ----------------------------------------------------------------------
00398701   1/1  ----------------------------------------------------------------------
00397921   1/1  ----------------------------------------------------------------------
00440901   1/1  ----------------------------------------------------------------------
00394081   1/1  ----------------------------------------------------------------------
00413151   1/1  ----------------------------------------------------------------------
00415921   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           TLGHAALYGLGYLLAGIVVGIAIGMVSGNSSANVVGSWALGVVVLMNFLFGPHARGAQRQSRWLVSKITI
00386591   1/1  ----------------------------------------------------------------------
00403021   1/1  ----------------------------------------------------------------------
00348011   1/1  ----------------------------------------------------------------------
00449241   1/1  ----------------------------------------------------------------------
00419271   1/1  ----------------------------------------------------------------------
00377141   1/1  ----------------------------------------------------------------------
00417101   1/1  ----------------------------------------------------------------------
00383731   1/1  ----------------------------------------------------------------------
00493481   1/1  ----------------------------------------------------------------------
00391451   1/1  ----------------------------------------------------------------------
00417191   1/1  ----------------------------------------------------------------------
00353711   1/1  ----------------------------------------------------------------------
00360311   1/1  ----------------------------------------------------------------------
00401791   1/1  ----------------------------------------------------------------------
00406701   1/1  ----------------------------------------------------------------------
00477341   1/1  ----------------------------------------------------------------------
00427071   1/1  ----------------------------------------------------------------------
00440361   1/1  ----------------------------------------------------------------------
00410481   1/1  ----------------------------------------------------------------------
00493471   1/1  ----------------------------------------------------------------------
00396031   1/1  ----------------------------------------------------------------------
00429181   1/1  ----------------------------------------------------------------------
00401801   1/1  ----------------------------------------------------------------------
00444071   1/1  ----------------------------------------------------------------------
00373691   1/1  ----------------------------------------------------------------------
00482061   1/1  ----------------------------------------------------------------------
00378031   1/1  ----------------------------------------------------------------------
00356151   1/1  ----------------------------------------------------------------------
00375721   1/1  ----------------------------------------------------------------------
00497951   1/1  ----------------------------------------------------------------------
00430741   1/1  ----------------------------------------------------------------------
00509901   1/1  ----------------------------------------------------------------------
00351571   1/1  ----------------------------------------------------------------------
00407271   1/1  ----------------------------------------------------------------------
00470881   1/1  ----------------------------------------------------------------------
00449071   1/1  ----------------------------------------------------------------------
00487851   1/1  ----------------------------------------------------------------------
00423151   1/1  ----------------------------------------------------------------------
00518771   1/1  ----------------------------------------------------------------------
00376681   1/1  ----------------------------------------------------------------------
00389401   1/1  ----------------------------------------------------------------------
00442031   1/1  ----------------------------------------------------------------------
00461801   1/1  ----------------------------------------------------------------------
00469981   1/1  ----------------------------------------------------------------------
00528891   1/1  ----------------------------------------------------------------------
00445471   1/1  ----------------------------------------------------------------------
00377311   1/1  ----------------------------------------------------------------------
00495381   1/1  ----------------------------------------------------------------------
00410951   1/1  ----------------------------------------------------------------------
00531641   1/1  ----------------------------------------------------------------------
00511331   1/1  ----------------------------------------------------------------------
00417671   1/1  ----------------------------------------------------------------------
00384771   1/1  ----------------------------------------------------------------------
00509051   1/1  ----------------------------------------------------------------------
00497861   1/1  ----------------------------------------------------------------------
00432691   1/1  ----------------------------------------------------------------------
00462101   1/1  ----------------------------------------------------------------------
00396861   1/1  ----------------------------------------------------------------------
00498341   1/1  ----------------------------------------------------------------------
00436581   1/1  ----------------------------------------------------------------------
00480111   1/1  ----------------------------------------------------------------------
00423541   1/1  ----------------------------------------------------------------------
00460421   1/1  ----------------------------------------------------------------------
00384131   1/1  ----------------------------------------------------------------------
00398701   1/1  ----------------------------------------------------------------------
00397921   1/1  ----------------------------------------------------------------------
00440901   1/1  ----------------------------------------------------------------------
00394081   1/1  ----------------------------------------------------------------------
00413151   1/1  ----------------------------------------------------------------------
00415921   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           RNPYVYWGTIIAISLLALFLVVFGVQLVPAWDPIPGPSEWFGS---------------------------
00386591   1/1  ----------------------------------------------------------------------
00403021   1/1  ----------------------------------------------------------------------
00348011   1/1  ----------------------------------------------------------------------
00449241   1/1  ----------------------------------------------------------------------
00419271   1/1  ----------------------------------------------------------------------
00377141   1/1  ----------------------------------------------------------------------
00417101   1/1  ----------------------------------------------------------------------
00383731   1/1  ----------------------------------------------------------------------
00493481   1/1  ----------------------------------------------------------------------
00391451   1/1  ----------------------------------------------------------------------
00417191   1/1  ----------------------------------------------------------------------
00353711   1/1  ----------------------------------------------------------------------
00360311   1/1  ----------------------------------------------------------------------
00401791   1/1  ----------------------------------------------------------------------
00406701   1/1  ----------------------------------------------------------------------
00477341   1/1  ----------------------------------------------------------------------
00427071   1/1  ----------------------------------------------------------------------
00440361   1/1  ----------------------------------------------------------------------
00410481   1/1  ----------------------------------------------------------------------
00493471   1/1  ----------------------------------------------------------------------
00396031   1/1  ----------------------------------------------------------------------
00429181   1/1  ----------------------------------------------------------------------
00401801   1/1  ----------------------------------------------------------------------
00444071   1/1  ----------------------------------------------------------------------
00373691   1/1  ----------------------------------------------------------------------
00482061   1/1  ----------------------------------------------------------------------
00378031   1/1  ----------------------------------------------------------------------
00356151   1/1  ----------------------------------------------------------------------
00375721   1/1  ----------------------------------------------------------------------
00497951   1/1  ----------------------------------------------------------------------
00430741   1/1  ----------------------------------------------------------------------
00509901   1/1  ----------------------------------------------------------------------
00351571   1/1  ----------------------------------------------------------------------
00407271   1/1  ----------------------------------------------------------------------
00470881   1/1  ----------------------------------------------------------------------
00449071   1/1  ----------------------------------------------------------------------
00487851   1/1  ----------------------------------------------------------------------
00423151   1/1  ----------------------------------------------------------------------
00518771   1/1  ----------------------------------------------------------------------
00376681   1/1  ----------------------------------------------------------------------
00389401   1/1  ----------------------------------------------------------------------
00442031   1/1  ----------------------------------------------------------------------
00461801   1/1  ----------------------------------------------------------------------
00469981   1/1  ----------------------------------------------------------------------
00528891   1/1  ----------------------------------------------------------------------
00445471   1/1  ----------------------------------------------------------------------
00377311   1/1  ----------------------------------------------------------------------
00495381   1/1  ----------------------------------------------------------------------
00410951   1/1  ----------------------------------------------------------------------
00531641   1/1  ----------------------------------------------------------------------
00511331   1/1  ----------------------------------------------------------------------
00417671   1/1  ----------------------------------------------------------------------
00384771   1/1  ----------------------------------------------------------------------
00509051   1/1  ----------------------------------------------------------------------
00497861   1/1  ----------------------------------------------------------------------
00432691   1/1  ----------------------------------------------------------------------
00462101   1/1  ----------------------------------------------------------------------
00396861   1/1  ----------------------------------------------------------------------
00498341   1/1  ----------------------------------------------------------------------
00436581   1/1  ----------------------------------------------------------------------
00480111   1/1  ----------------------------------------------------------------------
00423541   1/1  ----------------------------------------------------------------------
00460421   1/1  ----------------------------------------------------------------------
00384131   1/1  ----------------------------------------------------------------------
00398701   1/1  ----------------------------------------------------------------------
00397921   1/1  ----------------------------------------------------------------------
00440901   1/1  ----------------------------------------------------------------------
00394081   1/1  ----------------------------------------------------------------------
00413151   1/1  ----------------------------------------------------------------------
00415921   1/1  ----------------------------------------------------------------------