[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ54978.1


[Show Plain Result]

## Summary of Sequence Search
   1::1077
 519::675  8.9e-18 19.9% 0038146 00381461 1/1   e domain of HSP90 chaperone/DNA topoiso 
 541::668  1.4e-17 24.2% 0035364 00353641 1/1   e domain of HSP90 chaperone/DNA topoiso 
 527::669  2.8e-16 21.1% 0035339 00353391 1/1   e domain of HSP90 chaperone/DNA topoiso 
 559::668  3.4e-16 33.0% 0038465 00384651 1/1   e domain of HSP90 chaperone/DNA topoiso 
 539::668    1e-15 21.1% 0040105 00401051 1/1   e domain of HSP90 chaperone/DNA topoiso 
 525::668  2.1e-15 18.1% 0038974 00389741 1/1   e domain of HSP90 chaperone/DNA topoiso 
 507::691  3.3e-15 22.3% 0042491 00424911 1/1   e domain of HSP90 chaperone/DNA topoiso 
 519::683  3.7e-15 19.6% 0046033 00460331 1/1   e domain of HSP90 chaperone/DNA topoiso 
 522::668  1.3e-14 17.8% 0052097 00520971 1/1   e domain of HSP90 chaperone/DNA topoiso 
 525::668  2.3e-14 18.7% 0043142 00431421 1/1   e domain of HSP90 chaperone/DNA topoiso 
 510::668  2.9e-14 22.8% 0039624 00396241 1/1   e domain of HSP90 chaperone/DNA topoiso 
 523::674  4.5e-14 20.0% 0051393 00513931 1/1   e domain of HSP90 chaperone/DNA topoiso 
 530::668  4.5e-14 22.8% 0037015 00370151 1/1   e domain of HSP90 chaperone/DNA topoiso 
 549::668    9e-13 26.7% 0048223 00482231 1/1   e domain of HSP90 chaperone/DNA topoiso 
 530::668  1.6e-11 18.8% 0040344 00403441 1/1   e domain of HSP90 chaperone/DNA topoiso 
 567::668  2.5e-11 26.0% 0043464 00434641 1/1   e domain of HSP90 chaperone/DNA topoiso 
 560::668  1.7e-10 24.5% 0043462 00434621 1/1   e domain of HSP90 chaperone/DNA topoiso 
 545::668  2.8e-10 20.3% 0043939 00439391 1/1   e domain of HSP90 chaperone/DNA topoiso 
 562::670  1.3e-09 22.2% 0035784 00357841 1/1   e domain of HSP90 chaperone/DNA topoiso 
 540::668  4.9e-09 21.9% 0044566 00445661 1/1   e domain of HSP90 chaperone/DNA topoiso 
 541::622    8e-08 19.8% 0043038 00430381 1/1   e domain of HSP90 chaperone/DNA topoiso 
 541::622  3.1e-06 21.0% 0053133 00531331 1/1   e domain of HSP90 chaperone/DNA topoiso 
   1::1077


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSTRATNNGADAKDDAPEQAEKTETTAKRPARRWDPRNWRVRSRLVALVVVPTAAALILGVVRFSESALN
00381461   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TFRNERTEAMVTLAEDIVQLGNELGKERMLVAAYIADNPNPTRRSNDRAVALQEQQKIVDQELNDVRAGA
00381461   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           NELGTPSDPLVKERLDIMLDSLEKLNGVREEVTSTRVTMLPAVTKYRQIISTLTDFVETLANATNTSSEL
00381461   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           RESVRALSALGRARDDQSYEAALMVHSLIRDSMSGGVQDSIESTQARYNNEIRNFRNSATPAQEALLDEN
00381461   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           YGGLDVSRLGTMRLRALLRADEGQPLTGITDGDDADSYQQTALSALDTLAKVESSLARMVRAEATAHKEQ
00381461   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           GRRLLLFDSITVLFVVVFVFLTTSWVARSMVIPLRVLRDGAMRIAAKDLPEAIVRMRETNVRPEEVKITP
00381461   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           LEVDSSDEFGEVARSFDEVHRSALRLAADEAALRANVNAMFVNLSRRSQSLVERQLRLIEHLEQSEQDEE
00381461   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           RLAELFQLDHLATRMRRNNENLLVLSGQDNTRKWAQPVPLVDVLRAAVSEVEQYARVNVRAPSHVSVLGR
00381461   1/1  ----------------------------gklelelepvdlaelleellellrllaeekglelielvldld
00353641   1/1  --------------------------------------------------fqaeikvlldleavllaage
00353391   1/1  ------------------------------------pvdlaelleellellrllaeekgieleleldgde
00384651   1/1  --------------------------------------------------------------------ge
00401051   1/1  ------------------------------------------------kievlgillavrlrpgliivsg
00389741   1/1  ----------------------------------lepvdlaelleevlellrllaeekgielvleldpdl
00424911   1/1  ----------------ylvedllvlsrlea......vrlrpdmyigllelaeekgivleleldellllvl
00460331   1/1  ----------------------------grlelelepvdlaelleevlellrll.ekgielvldld.lll
00520971   1/1  -------------------------------elelepvdlaelleevlellrllaeekgieleleldpdl
00431421   1/1  ----------------------------------aepvdlaelleevlellrllaekgielvldlapdlp
00396241   1/1  -------------------ndlldlsrleagllelelepvdlaelleevlellrllaekgielvldldpl
00513931   1/1  --------------------------------eelepvdlaelleevlellrllaeekgieleldldlpv
00370151   1/1  ---------------------------------------ldelledliavlkglelvlkr.pgmlilvtg
00482231   1/1  ----------------------------------------------------------lkilelvrkppl
00403441   1/1  ---------------------------------------laelleellelllllag..kgielvldlded
00434641   1/1  ----------------------------------------------------------------------
00434621   1/1  ---------------------------------------------------------------------e
00439391   1/1  ------------------------------------------------------lniqlevdglldilig
00357841   1/1  ----------------------------------------------------------------------
00445661   1/1  -------------------------------------------------eaeklefqleverlldilvgs
00430381   1/1  --------------------------------------------------laesiqfqveierlldilin
00531331   1/1  --------------------------------------------------lleklefqveverlldllik


                         -         -         -         *         -         -         -:630
query           PVNDVIHLIAELVENATVFSAHDTQVSVTAQAVDNGDIIIEITDSGIGMSAEELESANQKLAEPPVIDVA
00381461   1/1  llllvlgdplrlrqvllnLlsNAikatpegleegklelgtitvslrl.egdlvvisvsDnGiGippedle
00353641   1/1  dierlaqvlreLvdNAidag..agrievsle..dgglvlitVrDnGiGipeddlprlferfatskissfd
00353391   1/1  lllvlgdplllrqvllnllsNAikytielleerlalgkpeggtitvslrr.egdrvvievsDnGiGipee
00384651   1/1  dierlasvlkeLvdNAidag..atrievtle..dgglllieVsDnGiGipeedleklferfatskisgfd
00401051   1/1  dverlaqvlkeLldNAidaapaggavtirvtldddg..sltVeDnGrGippedlprlferfytskltvll
00389741   1/1  p.vlgdplllrqvllnllsNAikytpeg..itvslrllg.dllvlsveDnGpgipeellerifepfyrtd
00424911   1/1  gdvegllqillelldNAidhalagpgairikvtldgdg.vsieVeDnGrGIpveilekifepffeliltv
00460331   1/1  vlgdplllrqvllnLlsNAikyt..ggtitvslrlegd.lvvlsvsDnGiGipeellerifepffrtdss
00520971   1/1  lllvlgdplllrqvllnLlsNAikytpeggllltitvslrl.egdlvvisveDnGiGipeellerifepf
00431421   1/1  lvlgdplllrqvllnLlsNAikytepeggtitvslrlllllllllllegdlvvlsvsDnGpGipeeller
00396241   1/1  llvlgdplrlrqvllnLlsNAikatpeggleslllptitvslrl.dgdlvvisvsDnGiGipeellerif
00513931   1/1  lgdpll.lrqvllnLlsNAikytp.ggtitislrleg.dlvvlsveDnGpgipeellerifepffrtds.
00370151   1/1  datglyrvvqelldNAidhalaggavtisvtldgdg..sisVeDdGrGippeileriferfyelvltvlh
00482231   1/1  piivggdprrleqvlrnLvsNAidatakggvivivvilvivisedgglvritVsDnGiGIppeelpkife
00403441   1/1  lplvladallleqvllnllsNAikhalegpeggtitislrleg.glvvltvrDnGigipe..lerifepf
00434641   1/1  ------rylaesiqvlialeevlerpgmyigstgllrvvkelvdNAidaalaggavrievtldddg..si
00434621   1/1  vveglahvvkelvdNAidaalagkatrievtleadg..sieViDnGrGipvdilplykvsg.........
00439391   1/1  sdysrleqvlreLisNAiDAlaklvlllltdgkklaeggeitirikl.dkdnvlltvtDnGiGiteedlk
00357841   1/1  -lelkaiaeklgielevdrlldilagslysnleivlrELisNAiDAlaklrlilltdeklageggeitir
00445661   1/1  lysnleivlrELisNAiDAlaklvylsltdgkltleggeiriri.lldkdnltltvsDnGiGitkedlek
00430381   1/1  adysrleqvlrELiqNAiDAgatrveisledegklgengeitikiladken.vlitvtDnGi--------
00531331   1/1  slysnleivlrELisNAiDAlaklvylsltdekllgeggeilirilp.dkdavtltirDnGi--------


                         -         +         -         -         -         -         *:700
query           VSRRMGLFVVSRLANRHGIEVRLRPAHNGGITAAVRLPNDLLITPVEPTPPALTSGRGTTVPDTYAEATA
00381461   1/1  rifepffttkeaglsdlellnllllpglslaslvrdlgGtGlGLa-------------------------
00353641   1/1  dlsyivsiGgrGlGlasvralaelvivtrtadgkvatr--------------------------------
00353391   1/1  lllekalekgllseeellslselellerifepffrtkss-------------------------------
00384651   1/1  dlssrvtlGfrGlGlasvkalsellggtitrdgkvatr--------------------------------
00401051   1/1  aggkfddlsykvsggghGlGlsivnalsellggtitvd--------------------------------
00389741   1/1  ssr..ggtGlGLaivkeivelhggtitvesepgggttf--------------------------------
00424911   1/1  lhaggkfdddsykvsgggtGlGlsivnalsellggtvevks...ggttftitlplgmpvas---------
00460331   1/1  rdlggtGlGLaivkrivelhggtitvesepgggttftltlplal..eladdll-----------------
00520971   1/1  frtdssrsrelggtGlGLaivkeivelhggtitvesep--------------------------------
00431421   1/1  ifepffrtds....ggtGLGLaivkrivelhggtieve--------------------------------
00396241   1/1  epfyrtkssrsldsslrklgGtGLGLaivkrivelhgg--------------------------------
00513931   1/1  srsggtGlGLaivkrivelhggtisvesepgggttftltlpla.--------------------------
00370151   1/1  agskfdddsykvsggghGlGlsivnalsellggtitrd--------------------------------
00482231   1/1  rfatskiksfsrliggtGlGlsivkllselhggeitve--------------------------------
00403441   1/1  fttkesr..ggtGlGLaivke....hggeitvesepgg--------------------------------
00434641   1/1  sVeDdGrGipvdilpkifepfveliltvlhagskfddl--------------------------------
00434621   1/1  glhGvGlsvvnalsellggtvtrdgkvylqlfsrgvpv--------------------------------
00439391   1/1  kifepfatsktkgflealkaggkedlsdirliggfGlG--------------------------------
00357841   1/1  llp.dkeeltltvsDnGiGitkedlinifgtfatsgkkgf------------------------------
00445661   1/1  ifgtfatskkkgfleklsdladidliGgfGlGlysvfa--------------------------------
00430381   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           AFASSPAPADPADSVWEPRTSNDRPVWEPRTTPSGLPKRPDPATRAAQQGQQTPPEHPPSGEDLWDAGWK
00381461   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           RSVSRTTSPQPVADRPETPRTETPRPETPRPETPRTETPRTESPADTTSTSAIPTVSDSRPSAADTVGSS
00381461   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           RTGGQSVYGYSLDRPGQRSAHPLGDTRSSTSERQGWQQNPLSSSYSSGSGRTEQPEVREGYGSTAYLSKR
00381461   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           YGPGSGNQNTIIPPSPEHESNEPLPIFDSIESNWFRRRTVRPAVTTTETGPISAVSTPDGLGTEPAAPAQ
00381461   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1050
query           QQSQQPRPEDEWRSAADAGWKTAAERASAPIAGGITASGLPKRIPRANLVPGAAPAPENFKQITSRSAER
00381461   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:1120
query           VRSRFSSFQQGIRQGRDALNKRSSQEE-------------------------------------------
00381461   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------