[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ55004.1


[Show Plain Result]

## Summary of Sequence Search
   1::219
   6::219  5.7e-47 36.9% 0052182 00521821 1/1   nosyl-L-methionine-dependent methyltran 
   8::217  2.8e-44 34.2% 0052001 00520011 1/1   nosyl-L-methionine-dependent methyltran 
  19::220  1.2e-33 26.6% 0049474 00494741 1/1   nosyl-L-methionine-dependent methyltran 
   9::214  1.8e-30 28.1% 0046354 00463541 1/1   nosyl-L-methionine-dependent methyltran 
  21::174  1.2e-22 27.0% 0048490 00484901 1/1   nosyl-L-methionine-dependent methyltran 
  19::219  5.8e-22 22.1% 0050919 00509191 1/1   nosyl-L-methionine-dependent methyltran 
  17::216  8.7e-22 25.7% 0047580 00475801 1/1   nosyl-L-methionine-dependent methyltran 
  15::218  4.8e-21 22.7% 0051657 00516571 1/1   nosyl-L-methionine-dependent methyltran 
  25::166  3.8e-20 26.1% 0041580 00415801 1/1   nosyl-L-methionine-dependent methyltran 
  57::211  8.9e-20 23.6% 0047676 00476761 1/1   nosyl-L-methionine-dependent methyltran 
  53::219  1.5e-19 24.7% 0047329 00473291 1/1   nosyl-L-methionine-dependent methyltran 
  41::212    2e-19 20.2% 0049915 00499151 1/1   nosyl-L-methionine-dependent methyltran 
  48::204  3.3e-19 25.5% 0051823 00518231 1/1   nosyl-L-methionine-dependent methyltran 
  51::204  5.1e-19 23.3% 0050745 00507451 1/1   nosyl-L-methionine-dependent methyltran 
  49::171    6e-19 26.4% 0050988 00509881 1/1   nosyl-L-methionine-dependent methyltran 
  48::173  1.4e-18 30.0% 0049532 00495321 1/1   nosyl-L-methionine-dependent methyltran 
  39::174  1.9e-18 23.8% 0047923 00479231 1/1   nosyl-L-methionine-dependent methyltran 
   1::168  2.7e-18 28.3% 0045060 00450601 1/1   nosyl-L-methionine-dependent methyltran 
  52::171    3e-18 26.5% 0047471 00474711 1/1   nosyl-L-methionine-dependent methyltran 
  29::189  3.4e-18 29.6% 0049122 00491221 1/1   nosyl-L-methionine-dependent methyltran 
  36::188  9.9e-18 26.9% 0047919 00479191 1/1   nosyl-L-methionine-dependent methyltran 
  25::196    1e-17 20.1% 0053107 00531071 1/1   nosyl-L-methionine-dependent methyltran 
  62::173  1.3e-17 24.8% 0051885 00518851 1/1   nosyl-L-methionine-dependent methyltran 
  35::167  1.8e-17 25.4% 0052649 00526491 1/1   nosyl-L-methionine-dependent methyltran 
  23::219  3.6e-17 22.2% 0050762 00507621 1/1   nosyl-L-methionine-dependent methyltran 
   1::207    4e-17 24.0% 0043085 00430851 1/1   nosyl-L-methionine-dependent methyltran 
  17::193  5.7e-17 25.7% 0051884 00518841 1/1   nosyl-L-methionine-dependent methyltran 
  35::172  7.2e-17 24.4% 0051449 00514491 1/1   nosyl-L-methionine-dependent methyltran 
   3::219  9.3e-17 22.3% 0051840 00518401 1/1   nosyl-L-methionine-dependent methyltran 
  53::167  1.1e-16 29.4% 0051261 00512611 1/1   nosyl-L-methionine-dependent methyltran 
  25::216  2.5e-16 23.1% 0047386 00473861 1/1   nosyl-L-methionine-dependent methyltran 
  32::221  2.9e-16 20.8% 0049074 00490741 1/1   nosyl-L-methionine-dependent methyltran 
  40::188  4.6e-16 26.2% 0049671 00496711 1/1   nosyl-L-methionine-dependent methyltran 
   1::182  6.6e-16 20.1% 0053110 00531101 1/1   nosyl-L-methionine-dependent methyltran 
  44::214    8e-16 22.7% 0044689 00446891 1/1   nosyl-L-methionine-dependent methyltran 
  25::189    1e-15 23.9% 0046931 00469311 1/1   nosyl-L-methionine-dependent methyltran 
  61::167  1.2e-15 29.1% 0046744 00467441 1/1   nosyl-L-methionine-dependent methyltran 
  48::170  1.3e-15 27.3% 0051930 00519301 1/1   nosyl-L-methionine-dependent methyltran 
  60::173  1.3e-15 27.5% 0048438 00484381 1/1   nosyl-L-methionine-dependent methyltran 
  19::189  1.5e-15 22.8% 0049719 00497191 1/1   nosyl-L-methionine-dependent methyltran 
  19::169  1.7e-15 22.4% 0046696 00466961 1/1   nosyl-L-methionine-dependent methyltran 
  62::169  3.2e-15 23.5% 0052807 00528071 1/1   nosyl-L-methionine-dependent methyltran 
  52::189  4.5e-15 26.0% 0050234 00502341 1/1   nosyl-L-methionine-dependent methyltran 
  53::168  6.5e-15 24.8% 0050935 00509351 1/1   nosyl-L-methionine-dependent methyltran 
  33::174  6.8e-15 23.5% 0041444 00414441 1/1   nosyl-L-methionine-dependent methyltran 
  60::188  2.9e-14 29.5% 0047211 00472111 1/1   nosyl-L-methionine-dependent methyltran 
  62::166    3e-14 23.7% 0047851 00478511 1/1   nosyl-L-methionine-dependent methyltran 
  23::213  6.2e-14 23.2% 0050154 00501541 1/1   nosyl-L-methionine-dependent methyltran 
  62::220  7.3e-14 24.8% 0053229 00532291 1/1   nosyl-L-methionine-dependent methyltran 
   6::173  7.5e-14 23.4% 0051103 00511031 1/1   nosyl-L-methionine-dependent methyltran 
  48::202  1.5e-13 22.7% 0051143 00511431 1/1   nosyl-L-methionine-dependent methyltran 
  50::171  2.3e-13 23.5% 0039093 00390931 1/1   nosyl-L-methionine-dependent methyltran 
  44::173  2.6e-13 31.2% 0042197 00421971 1/1   nosyl-L-methionine-dependent methyltran 
  17::219  3.1e-13 22.7% 0046838 00468381 1/1   nosyl-L-methionine-dependent methyltran 
  51::167  3.4e-13 29.6% 0049885 00498851 1/1   nosyl-L-methionine-dependent methyltran 
  16::174    4e-13 24.5% 0048805 00488051 1/1   nosyl-L-methionine-dependent methyltran 
  22::167  1.1e-12 19.9% 0052739 00527391 1/1   nosyl-L-methionine-dependent methyltran 
  17::220  1.2e-12 25.4% 0052536 00525361 1/1   nosyl-L-methionine-dependent methyltran 
  66::166  1.4e-12 30.1% 0040196 00401961 1/1   nosyl-L-methionine-dependent methyltran 
  52::179  2.9e-12 25.4% 0035026 00350261 1/1   nosyl-L-methionine-dependent methyltran 
  53::167  3.8e-12 29.4% 0051944 00519441 1/1   nosyl-L-methionine-dependent methyltran 
  60::218  3.8e-12 25.2% 0046840 00468401 1/1   nosyl-L-methionine-dependent methyltran 
  29::219  1.1e-11 22.1% 0051239 00512391 1/1   nosyl-L-methionine-dependent methyltran 
  35::188  1.7e-11 26.4% 0049171 00491711 1/1   nosyl-L-methionine-dependent methyltran 
  66::172    2e-11 24.5% 0037982 00379821 1/1   nosyl-L-methionine-dependent methyltran 
  53::166  2.7e-11 27.3% 0047465 00474651 1/1   nosyl-L-methionine-dependent methyltran 
  66::166  6.2e-11 23.7% 0044550 00445501 1/1   nosyl-L-methionine-dependent methyltran 
  60::167  8.8e-11 24.0% 0047945 00479451 1/1   nosyl-L-methionine-dependent methyltran 
  60::166  9.6e-11 30.3% 0052709 00527091 1/1   nosyl-L-methionine-dependent methyltran 
  43::167    1e-10 27.4% 0040829 00408291 1/1   nosyl-L-methionine-dependent methyltran 
  48::167  1.4e-10 25.9% 0049442 00494421 1/1   nosyl-L-methionine-dependent methyltran 
  64::166  1.8e-10 31.9% 0052894 00528941 1/1   nosyl-L-methionine-dependent methyltran 
  23::166  3.3e-10 23.0% 0050693 00506931 1/1   nosyl-L-methionine-dependent methyltran 
  50::166  4.3e-10 31.4% 0051617 00516171 1/1   nosyl-L-methionine-dependent methyltran 
  62::168  5.1e-10 27.7% 0048629 00486291 1/1   nosyl-L-methionine-dependent methyltran 
  18::166  6.3e-10 20.7% 0041326 00413261 1/1   nosyl-L-methionine-dependent methyltran 
   8::188  7.2e-10 21.2% 0040964 00409641 1/1   nosyl-L-methionine-dependent methyltran 
  18::197  8.1e-10 23.3% 0040327 00403271 1/1   nosyl-L-methionine-dependent methyltran 
  23::220  8.8e-10 24.3% 0050242 00502421 1/1   nosyl-L-methionine-dependent methyltran 
  35::174  1.2e-09 28.2% 0053077 00530771 1/1   nosyl-L-methionine-dependent methyltran 
  20::209  1.3e-09 18.5% 0050749 00507491 1/1   nosyl-L-methionine-dependent methyltran 
  19::166  4.2e-09 24.3% 0036610 00366101 1/1   nosyl-L-methionine-dependent methyltran 
  66::166  5.3e-09 20.6% 0041593 00415931 1/1   nosyl-L-methionine-dependent methyltran 
  42::167    6e-09 23.4% 0052693 00526931 1/1   nosyl-L-methionine-dependent methyltran 
  19::219  1.1e-08 26.0% 0051842 00518421 1/1   nosyl-L-methionine-dependent methyltran 
  66::167  1.2e-08 17.9% 0052749 00527491 1/1   nosyl-L-methionine-dependent methyltran 
  45::207  1.3e-08 26.1% 0052618 00526181 1/1   nosyl-L-methionine-dependent methyltran 
  33::174  3.6e-08 22.7% 0045109 00451091 1/1   nosyl-L-methionine-dependent methyltran 
  59::166  5.4e-08 30.3% 0051679 00516791 1/1   nosyl-L-methionine-dependent methyltran 
  66::167  8.4e-08 25.0% 0047862 00478621 1/1   nosyl-L-methionine-dependent methyltran 
  66::167  9.6e-08 27.1% 0050519 00505191 1/1   nosyl-L-methionine-dependent methyltran 
  29::166  3.6e-07 28.5% 0047656 00476561 1/1   nosyl-L-methionine-dependent methyltran 
  40::166  4.5e-07 28.6% 0046568 00465681 1/1   nosyl-L-methionine-dependent methyltran 
  60::167  2.7e-06 28.2% 0048774 00487741 1/1   nosyl-L-methionine-dependent methyltran 
  45::167  5.2e-06 22.5% 0042682 00426821 1/1   nosyl-L-methionine-dependent methyltran 
  17::166  7.2e-06 23.5% 0048524 00485241 1/1   nosyl-L-methionine-dependent methyltran 
  19::205  8.3e-06 26.6% 0052982 00529821 1/1   nosyl-L-methionine-dependent methyltran 
  66::173  1.6e-05 21.7% 0049778 00497781 1/1   nosyl-L-methionine-dependent methyltran 
  44::207  3.7e-05 23.4% 0053087 00530871 1/1   nosyl-L-methionine-dependent methyltran 
  47::166  0.00015 26.5% 0052084 00520841 1/1   nosyl-L-methionine-dependent methyltran 
   1::219


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTRTSENLSPELHAYLVAHSTPVDEVLTDLAAETERLFPDHVGMQIAPEQGLFLTLLTQLIGARNIVEVG
00521821   1/1  -----diteeelleyvlrhsfvpdpllllalrdealdvg.gglpilspekgalllellrllpgkrvLdiG
00520011   1/1  -------llletliellldlgrdllldervddylrdlikglpeallaledfadllykyaylfswrgrlii
00494741   1/1  ------------------kngikdeilldyilsrprge.pldelldeyedyalkfgl..glliiqpella
00463541   1/1  --------renlvdnlaehydllnevleallkvprelflpevplrelayedeflpitlevgegllisqpe
00484901   1/1  --------------------lllldkllkllkpgdlvllllannlllpltlrvnklkltrfgllnvlels
00509191   1/1  ------------------klleleedvrslfldyaelydgdnllleelgdgvmraqeralmallall.gl
00475801   1/1  ----------------vprehfvpsllgylafldlplafgegvlisqpellalllelldlkpgdrvLDiG
00516571   1/1  --------------pedevkelirsfydraadrydgqnrlleelgdgvmlaqerallrllall.glrpgg
00415801   1/1  ------------------------ellldevlgldraglllgdrgltleelakflelierrlegepleyl
00476761   1/1  --------------------------------------------------------lldllsllllelgl
00473291   1/1  ----------------------------------------------------vkllkegdrvllelgrpl
00499151   1/1  ----------------------------------------Llvlgllielltpglrlllkvdelllsers
00518231   1/1  -----------------------------------------------idcallaerlnkalellkdllkk
00507451   1/1  --------------------------------------------------llvlllllllalnkalkllr
00509881   1/1  ------------------------------------------------kalldillwliellslglalsl
00495321   1/1  -----------------------------------------------tigellrealalleeagldllda
00479231   1/1  --------------------------------------efyddyalsfdeglrptqeellelllellglk
00450601   1/1  Msstek.....lsplliehkelveefydslaerydelrgvllrpaqrallelllellg.llpgkrvLDvG
00474711   1/1  ---------------------------------------------------ldgwfteilwpglrlllkl
00491221   1/1  ----------------------------mstvplselskklaeeffydlaadfydllldglfpsqrelld
00479191   1/1  -----------------------------------Ydlgndlyellldedyfysdayyddpgdllrpaqe
00531071   1/1  ------------------------Gplriilgefrglklkvdpgvlirpttdrlrelllelladllkgkr
00518851   1/1  -------------------------------------------------------------eldgqlldl
00526491   1/1  ----------------------------------ddlyddglsliqrellelllelldlllkpgkrvLDi
00507621   1/1  ----------------------veehydelaefydkllgellip..rpateellelllellglkpgkrvL
00430851   1/1  msetetdfglarlklieeliashydlsvdvlealldvpreyfvlepayedlalafgtgvhilrpellall
00518841   1/1  ----------------dlikegdlvllllsrgnlllvllkllneggvlntrygvlkhddligklygsfld
00514491   1/1  ----------------------------------GadeyfefgpryiqepllelllelldlllkpgkrvL
00518401   1/1  --qvmlklikkqikeypqdklvripekaslyllvlealltg.lnllqrllaafllell.dlfkgkrvLdi
00512611   1/1  ----------------------------------------------------ellealnrklpltlrvnt
00473861   1/1  ------------------------melfdevaery.ddfadglspgqdrllelllellaellkpgkrvLD
00490741   1/1  -------------------------------ledllrayllllpellllleslenladhldlgnppfell
00496711   1/1  ---------------------------------------nsvsglfdsiashydllndlyellldedyfy
00531101   1/1  fanrlnkalklrkkllkklgldayrlfdglpglvvdrygdvlviqvtsagalklkdalvdalevkgiylk
00446891   1/1  -------------------------------------------flsapellalllelldlkpgkrVLDiG
00469311   1/1  ------------------------erlfdeyaefydlanglglrprqeallelllellplkpgkrvLDlG
00467441   1/1  ------------------------------------------------------------ikrlvvllvl
00519301   1/1  -----------------------------------------------vllslfaerlvealkllkklllk
00484381   1/1  -----------------------------------------------------------seildglvivg
00497191   1/1  ------------------llllralllllelvelllelleklldsllkgeipfeyllgedffeyfdddae
00466961   1/1  ------------------dlsndlyelyldlydlyssaydllgdrpltdalleallellglkpgkrvLDl
00528071   1/1  -------------------------------------------------------------fdsyayfyd
00502341   1/1  ---------------------------------------------------alklelllellg.lkpgkr
00509351   1/1  ----------------------------------------------------nmllelllklllllglnl
00414441   1/1  --------------------------------tysagyydlpadilrpateelldlllellglkpgdrvL
00472111   1/1  -----------------------------------------------------------nsdmsddefdp
00478511   1/1  -------------------------------------------------------------klkksfdnv
00501541   1/1  ----------------------dvaeyfddiaavydgfaeglreaaea.llelllellp...pgkrvLDi
00532291   1/1  -------------------------------------------------------------lllgllwlt
00511031   1/1  -----kllelldldidllklsllklkkinklyknlknlilkntsnvskeeiakfydlvadffdevaayyd
00511431   1/1  -----------------------------------------------qrellelllellg.lkpgkrvLD
00390931   1/1  -------------------------------------------------eeffelfrdigkkydgwyfee
00421971   1/1  -------------------------------------------Msdcplcpesltpsellykeevarvfd
00468381   1/1  ----------------edsllplllllldpllleallslleallegkydllellfgkelfeylagdaely
00498851   1/1  --------------------------------------------------darlllglllglslllleay
00488051   1/1  ---------------vnvlkidseevleallkegrellltpglvpgksvygedygdplgeearlwdprrs
00527391   1/1  ---------------------ypmriiagkfrgrkllvppglftrpttdrvreallnilapllpgarvLD
00525361   1/1  ----------------lkvdkeeiakfydlaaeyydlvyatedgylgglflfngadleesaefladllle
00401961   1/1  -----------------------------------------------------------------vLDvG
00350261   1/1  ---------------------------------------------------alaelllpllpglrvLdlG
00519441   1/1  ----------------------------------------------------slprwlvinllkllgeel
00468401   1/1  -----------------------------------------------------------lslapllllll
00512391   1/1  ----------------------------elydklaefYdkllg.srllyeelldlllellpelllkgkrv
00491711   1/1  ----------------------------------skyywdefyrpllda...llell.glkpgkrvLDlG
00379821   1/1  -----------------------------------------------------------------VLDlG
00474651   1/1  ----------------------------------------------------leddllplliryslpdwl
00445501   1/1  -----------------------------------------------------------------vLDlG
00479451   1/1  -----------------------------------------------------------etlgellklrl
00527091   1/1  -----------------------------------------------------------lkpgkrvLDiG
00408291   1/1  ------------------------------------------vlipfehqevlleellellklkpgkrvL
00494421   1/1  -----------------------------------------------lpgllidrliqllgeeleallea
00528941   1/1  ---------------------------------------------------------------ylgdydk
00506931   1/1  ----------------------llriiggkfrgrkllvppgprptterlrealfnllllllleggrvLDl
00516171   1/1  -------------------------------------------------Qnfltdpalldailell.glk
00486291   1/1  -------------------------------------------------------------sydniaihy
00413261   1/1  -----------------rskrvpleyilgeadfyglpldvggafltprpitellleallelgllkgkrvL
00409641   1/1  -------wfterltpekafslkveevlyeakseyqqi......flvdsevfgkllfldgvlqsterlefp
00403271   1/1  -----------------dgdsllplvllelsdellrafldllealregepafelafgkdffeylakdpdl
00502421   1/1  ----------------------dvkdfydelaelyddlldelsd....alldlllell.glkpgkrvLDi
00530771   1/1  ----------------------------------keyydeiaery.dpaqrallelllellgllpggrvL
00507491   1/1  -------------------egeplriilgkleglklkldpgqafltprpvtellvdallelgllkgkrvl
00366101   1/1  ------------------mserliklepekyillelkflglrfkvdpgvffptgldldtelllell.dlk
00415931   1/1  -----------------------------------------------------------------vlDiG
00526931   1/1  -----------------------------------------lriiaGqfrgrkldvpdglitrpttdrvr
00518421   1/1  ------------------Mkekvkeyydelaerydllrgslplrpaaealldlllellp...pggrvLDl
00527491   1/1  -----------------------------------------------------------------VlDlg
00526181   1/1  --------------------------------------------lqeitedllellfnallllienlldg
00451091   1/1  --------------------------------ddlakflgqn.fltdpellelilellnlkpgdtvLDiG
00516791   1/1  ----------------------------------------------------------vlgnddyqeefd
00478621   1/1  -----------------------------------------------------------------vLdvG
00505191   1/1  -----------------------------------------------------------------vlDlg
00476561   1/1  ----------------------------dlyndlfelfldh.sseyalinqllleelvellldlldlkpg
00465681   1/1  ---------------------------------------gyvsrgalklqe.lleklgllkpgervLDlG
00487741   1/1  -----------------------------------------------------------hqnfvnpllak
00426821   1/1  --------------------------------------------qnfltdpeilekilelldlkegdrvL
00485241   1/1  ----------------rayelplqyitgeldfsglelhvrgyvpaliprpltellaaallrllgldpgtv
00529821   1/1  ------------------vsidfvrrflvkliekiilrswrgldiilsagylipgilgregteqlldsal
00497781   1/1  -----------------------------------------------------------------vlDlG
00530871   1/1  -------------------------------------------fyTPreivellvelldpkpggrvlDpg
00520841   1/1  ----------------------------------------------elvlsslmdaefWderydegetgf


                         -         -         *         -         -         -         -:140
query           TFTGYSSICLARGLPNDGTLLACDVSEEWTAVARRYWQRAGVADRIDLRLAPALDTLRALPEEPQFDLAF
00521821   1/1  tGtGysalalaralppgarvvavdispealalarenleaaGledrvtvilgdaedllpqllaplpdgkfD
00520011   1/1  klpedgallrlllaelkpkriLElGcgtGgsllllaealkllgpdgkvvgiDispemlevar......gl
00494741   1/1  lllelldlkpgkrvLDiGcGtGglalalakllppgakvtgvDispealelarenakenglpnrvefivgd
00463541   1/1  tlalllellglkpgkrvLDiGcGtGylalalarlggpdgrvvavDispealelarenaerlgl.dnvefi
00484901   1/1  gknavahydlsndvyellldpaysdslarfgegntllqpelaelllelldlkpgkrvLDiGcGtGglala
00509191   1/1  rpggrVLDvGcGtGglalalaeagpe..evtgvDispemlerareraaelg..pnvrvlvgdaeellppl
00475801   1/1  cGtGylalalaklvg..grvtavdispealelarenaerlgl.dnvevilgdaeell...fedgsfDlvv
00516571   1/1  rvLdvGcGtGllalalaeagp..aevtgvDispemlerareraaeag..pnvrvlvgdaedllpplpdg.
00415801   1/1  lglyeflglefgtgpgvfiprpttelllelllellglkpgkrvLDlGcGsGllaialak.lga.akvtgv
00476761   1/1  vlsdeqleklealldllldwnpvinltgsrefdelwlrvlldllallplkpgkrvLDlGcGtGllalala
00473291   1/1  mllellregglldtrlgiepledllgvprglfldlavgylvlilrpltedlveafgrgtqitqpavaall
00499151   1/1  kyqeirvyelgddgrvllldgllqgsslderqrallllllallglkpgkrvLDiGcGtGglalalakr.p
00518231   1/1  levlrlilregdglpglavdrygdwlvvlllealgeeeleelleallellpelrvnllkisredlleell
00507451   1/1  dllrklglpayrlvlgegdllrglavdrygdwlvvlllselgleelealleallellppidlrvnklkis
00509881   1/1  kidklleeekskyqiiriydlgnfgyelfldgrllysrldeaqytelllllllldlkpgkrvLDiGcGtG
00495321   1/1  elllllllgldrlrlllllllplsvlelllllellerrllgepveyllgerefyglafkvgggvftprpt
00479231   1/1  pgkrvLDlGcGtGglalalaklgp...kvtgvDispealelarenakelglddnvefivgDaedlp...l
00450601   1/1  CGtGllslalaer.ga..eVtgvDiseemlelAreraaengldpgadnvefvvgdaedlpellfpdgsfD
00474711   1/1  dellheekskyqiiriydlgndgrvllldglvlgsrpdeaqerllllllallplkpgkrvLDiGcGtGgl
00491221   1/1  lllell.glkpgkrvLDlGcGtGglalalakr.ga..rvtgvDispemlelarenaaelglsdaddnvef
00479191   1/1  rllelllellglkpgkrvLDiGcGtGglalalakalg..arvtgvDispemlelareraaelglpnrvef
00531071   1/1  vLDlgcGtGglalalak.rgak.kvtgvDispealelarenaklngldednvefiqgdaldflpllllde
00518851   1/1  llklikeklkknlglnldllplgegqyieelwpglalslkvdevlhekkskyqiiriydlgndgrrlfld
00526491   1/1  GcGtGglalalakllpg.akvtgvDispemlelarenakelglpn.vefivgDaedlpellpd.gsfDli
00507621   1/1  DlGCGtGrlalalakrgp...evtgvDispemlelArerakengl..nvefiqgDaed.lp..f.dgsfD
00430851   1/1  lellledlkpgarVLDiGcGsGyltlalarlvpelgkdpggrvvgvDispealelarenlerlgldlllp
00518841   1/1  sskgysvallrpapedltlllkrgtqivqpkdialilelldlkpGdrVLDiGtGsGgltlllarlvgpkG
00514491   1/1  DiGcGtGglalalakllpg.akvtgvDispemlelarenakelgl.pnvefivgdaedlpellpdg.sfD
00518401   1/1  GaGtGllllalaellppgaevtgiDidpdalevarknlkrlglpkrvrlvvgdaldalpalaegvedgkf
00512611   1/1  lkisreeilkhydlagkvydlfyivprgefllldptledsvlifkrgteilqpadlalilellglkpgdr
00473861   1/1  iGcGtGglalalakllgepgarvtgvDispemlelareraaelglsdnvefvvgDaed.lp.lpd...fD
00490741   1/1  lgeeffeyfakvyelydafndglrpatrlllelllellglkpgkrvLDiGcGtGglalalakalP.garv
00496711   1/1  sygyfddyglglrpaqeallelllellglkpgkrvLDiGcGtGglalalakalg.a.rvtgvDispemle
00531101   1/1  vnrrllglplrvllgelpetitveenglkflvdpgsffqtglrpdtrllrealaaalaglakgkrvLDlg
00446891   1/1  cGtGyltlllaklgg...kvtgvDiseemlelarenlkeng...nvefivgDaeel...pfpdesfDliv
00469311   1/1  cGtGglalalaklgpk..rvtgvDisp.mlelarenaaenglpnrvefivgDaedlleplpd...fDlvv
00467441   1/1  kglllsrlladalilvprhydlgedlygeelakvyddlaafldglrsrqeallelllellglkpgkrvLD
00519301   1/1  glvnayrlvlgegdllrglavdrypdwlvvlllsalgeeelealleallellpdlrvnllkisreeklll
00484381   1/1  kydlskdlfeeflgdydlvlafldglrsraerllelllellglkpgkrvLDlGcGtGglalalakllga.
00497191   1/1  ly.dgfndglsgaqelllelllellp.lkpgkrvLDiGcGtGglalalakalp.gakvtgvDi.pemlel
00466961   1/1  GcGtGglalalakrgak..rvtgvDisp.mlelarenaaenglpnrvefivgDaedl....plpdgsfDl
00528071   1/1  alnllqlrprtealleallellglkpgkrvLDlGcGtGglalalakrgak..rvtgvDisp.mlelaren
00502341   1/1  vLDiGcGtGglalalakrg...arvtgvDispemlelareraaelgl.pnvefvvgDaed.lp..fpdgs
00509351   1/1  seeqyekledyfdllldwnkkynllsskdpdrlwerhildsllllelldlkpgkrvLDlGcGtGllaial
00414441   1/1  DlGcGtGglalalaravg..arvtgvDispemlelareraeelglpdnvefvvgDaedl....fpdgsfD
00472111   1/1  kkyldefyddyagrffrlreilrllldellallgllpggrvLDvGcGtGllalalaralppgarvtgvDl
00478511   1/1  akhYdlgndlyslildpdmfysygyyddpdetlrpaqelllelllellglkpgkrvLDiGCGtGllalal
00501541   1/1  GcGtGglalalakr...garvtgvDispemlelareraaelgl..nvefvvgDaed.lp..fpdgsfDlv
00532291   1/1  etltpglalslkvdevlyeekspyqeivvvesgdfgrllfldgvvqsterdefiyhemlahlllllhpnp
00511031   1/1  glfg..dllslrpaqeellelllellplkpgkrvLDiGcGtGglalalakrlga..rvtgvDispemlel
00511431   1/1  iGcGtGglalalakrgp...rvtgvDispemlelareraaelglpn.vefvvgDaed.lp..fpdgsfDl
00390931   1/1  pllpglalsykvdrvlhegkspyqeililespdfgrllvldgvvqlserleliyhealahllllllkppk
00421971   1/1  riaerydrlrpvpsplyyllgddeeayldlllfpgagiprplaelllelldelllkpgkrvLDiGCGtGy
00468381   1/1  dlfndglrpgserlldll.lellpllkpgkrvLDiGcGtGglalalakalPga.rvtgvDi.pemlelar
00498851   1/1  ldlvldeeelerllellerlaerypllksllselndrdweeaylkglrpfrgldflvipavldprpdger
00488051   1/1  rlaaklalilellg.lkpGdrVLDlGcGsGgltlhlaelvgpeGkVygvDispemlelarenleelg...
00527391   1/1  lgaGsGalgleaasr..gaarvtaveispealelarenaallgl.dnveviqgdaleflpel..gekfdl
00525361   1/1  llg.llpgkrvLDvGcGtGrltlallarlga..evtgvDlseemlevarerlaeagl.prvefvvgdaed
00401961   1/1  CGtGglllalakryg..arvtGiDispemlelareraaelglpnrvefvqgdaed....lp.d.sfDlvv
00350261   1/1  cGtGeepyslamlllealalagpgarvtatDispealekareglyplgllrglplellkryflkllgadg
00519441   1/1  lealleallellplvlrvnellaelgielerdelgppllyllggvefadlplyktgvfitqdeasallae
00468401   1/1  ddvlleawlslldallegrldllellyglglfeylaldaevydafldglrpatellldlllellglkpgk
00512391   1/1  LDlGCGtGrltlalakrga...kvtgvDiseemlevArerakeagl..nvefivgdaed.lp..f.dgsf
00491711   1/1  CGtGglllalarl.ga.gevtGvDiseemlelArerakeaglsdnvefivgdaed....lpefpdgsfDl
00379821   1/1  cGtGgltlhlaklvgpeGkvvgvDispemlelarenleklg...nvefilgDaeelpkyllpdgsfDvil
00474651   1/1  vellldllgeeleallealllplpldlrvntlkisleellelleklgvvleaydllgdpleyllglrefy
00445501   1/1  CGtGgltlalAklga...rVvgvDispealelarenaklngl.dnvefivgDaeellkelpfpdgsfDvv
00479451   1/1  nklikeefdlgnkfsklwldrsvydsyyfeakllglyrsraalkleelleklglkpgkrvLDlGCGtGgl
00527091   1/1  CGtGglarylaeryg..arvtGiDlseemlerareraaeaglsnrvefivgdaed....lp..gsfDlvv
00408291   1/1  DlGcGtGglalalakllpg.arvigvDispealelarenlkelg..dnvefiqgdaldlpellllfpdgs
00494421   1/1  llealplllrvntlkisldellelleglgielrllpllplayilgerlefallpgfktglfltqrevsel
00528941   1/1  lrllrsnlaeqllsllalrrglrilDlGcGtGalllalaevlppdvrvvgvDiseealekarqrlganpl
00506931   1/1  gaGsGalaleaasrga...evvavDidpeavalarenaerlglenrveviqgdafellaalpge.sfDlv
00516171   1/1  pgdrVLDiGcGtGaltlalakrga...rvtgvDispemlelareraaengladnvefiqgDaedl..plp
00486291   1/1  dmlndrprtealleallellgllkgkrVLDvGcGtGilslalakaGak..kVtgvDisp.mlelarenak
00413261   1/1  DlGcGtGilaialakl.Ga.akvtavDispealelarena......gnvefivgdaee....lp..gkfD
00409641   1/1  yhealahllllnlkkgkrVLdiGcGtGglarellkh..gaaevtgvdidpevielakenlklnglsvlna
00403271   1/1  alrflggmralsellldellealpdlsggkrvLDvGcGtGalllalakkyPga.kvtgvDlsp.mlelar
00502421   1/1  GcGtGglalal.......grvtgvDispemlelarer........nvefvvgdaedl..pfpdg.sfDlv
00530771   1/1  DlGCGtGrlalalarrga...rvtgvDlspemlelareraaaagl.dnvefvvgdaed....lpfdgsfD
00507491   1/1  DlGaGtGalslalakr..gakkvvavDidpealelarenaelngl..nveviqgdale.lp.....gkfD
00366101   1/1  kgkrvLDlGcGtGilaialakrga...kvtgvDispealelakenaklngldnrkvefiqgdaedplp..
00415931   1/1  cGtGglalalAkltg.akhvyGieiseealelakenakenkkrlklfglgidnvefiqgdaeel..plpd
00526931   1/1  ealfnilapllegkrvLDlfaGsGalgleaas..rgaakvvavdispealelakenaalnglenrvevir
00518421   1/1  GcGtGrlalalaerga...evtgvDispemlevarer....g...nvefvvgdaed....lpfpdgsfDl
00527491   1/1  aGiGilalpaakl..gakkVvaveidpeavellreNaklnglenrvevingdardllpe....ekfDvvv
00526181   1/1  aldalleilpellgllflldlllddellrelldllseidlseidydilgelyeyllgefaglrfklgefy
00451091   1/1  cGtGaltlalaklgp...kvtgvdiseemlelakenlkeng...nvtfihgDalel...pfpdgkfDliv
00516791   1/1  pealadefyalaseydpldrllllllerllellslglkpggrvLDvGcGtGllalllaarlga..rvtgl
00478621   1/1  cGsGlllallaeaigvagkvlgvDidaevldlaednlkknglsllssgnvelvvgdllkli...ledgkf
00505191   1/1  cGtGghslalaerg...grvigvDidpealalarerlaglgllnrvefvqgdalalplp...dgsfDgvl
00476561   1/1  lkvLDiGcGtGelalalakklpalfpsigakvtgvDiseemielakerakelglsdnvnvefivgdaeel
00465681   1/1  cGpGgltlvlaervgpggrvvavDlsp.mlelar......vefiqgdardlplldlllellpdgsfDlvl
00487741   1/1  llealdlrpgdrVLdlgcGtGrlalaLakr...garvigvDispealeqarenaelnglvsevgdllvys
00426821   1/1  diGcGtGaltlelakrgg...kvtaieideemlelakenlkelg...nvefiqgDalkl...pfpdgkfD
00485241   1/1  lDpgCGsGtllieaalaarrpaar.viGvDidpaalelArrnlallgladllllesasellsslleklsl
00529821   1/1  ..........................ilemlqelkglsvldiGcGtGtlailllrlgpa.rrvvavDisp
00497781   1/1  cGtGnlaiqaAleyGak.kvvGidispeaielakenlkelgkllelfgkklenrvefilgDfldlpfedl
00530871   1/1  cGsGgfllalaerllpgarvvgvDidpealelaren..........eivvgDalell...p.desfDlii
00520841   1/1  dlgepnpllvefleallglpkggrvLdlGCGtGrdalwLaer...GfdVtGvDisetalelareraklag


                         +         -         -         -         -         *         -:210
query           IDADKESYIAYWEELVPRVRPGGVLLADNVFSHSRVLDPAQTAARVQAIRDFNVHARDDTRVDLVILPIG
00521821   1/1  lifldaplehlpdllellealrlLkpGGvlvldnvllpgavddp.......ealrellellredpgletv
00520011   1/1  ldnvtliqgdaldlpflekllelgsfDlvfidashshypvlldlllrlLkpGGvlvvddvlppglvlrpg
00494741   1/1  aedflpfllaeglldgsfDlivsdalhpdlpklleelarlLkpGGrlvlsdplrpgeevllelldalfil
00463541   1/1  lgdaedllfe...dgsfDlvvsdapleh...lleellrlLkpGGrlvlstilleg.......leellell
00484901   1/1  lakllgpdarvtgvDispealelArenakrlgld------------------------------------
00509191   1/1  pdg.sfDavlsDppgssevlhhvpdleaflaeaarlLkPGGvlvistllgwdeeledllevvrlvseeel
00475801   1/1  sdaplph...lleellrlLkpGGrlvlvvgtleg.......leellellkeagf.evvevidpvgfvplt
00516571   1/1  sfDavlsDppsevlhhvrrpdpeaflreaarvLkPGGvlvlstlllaglelerdaehvrfvtpeeleall
00415801   1/1  DispealelArenaelnglsnrvefi--------------------------------------------
00476761   1/1  kllp.garvtgvDispealelarenaaelgl.dnvefvvgdaedlp.p...dgsfDlvvsnppy.dleal
00473291   1/1  lellglkpGarVLDlGcGtGaltlalaravgpggrvvavDispealelarenlaraglalpdnvevvvgD
00499151   1/1  egarvtgvDispealelarenlaelglgllddpnvefivgDaedflpfl..dgsfDlivsdpplhhlpdp
00518231   1/1  delielllgerdllgelyenglrflvdpdgfgtglfptqellaelllelldpgkrvLDlGcGtG------
00507451   1/1  reelgepvelllgelpeelyvqflglkfkvdpgvffrpgtellvelllelldlk.pgkrvLDlG------
00509881   1/1  glalalakrgp.aakvtgvDispealelare---------------------------------------
00495321   1/1  telllelllellpkpgkrvLDlGcGtGglalal-------------------------------------
00479231   1/1  pdgsfDlivsdpplhhlpdllkellrlLkpGGrl------------------------------------
00450601   1/1  lvvsnfgvlhhlPpyfldpedleaalre------------------------------------------
00474711   1/1  alalakrgp.darvtgvDispealelarenl---------------------------------------
00491221   1/1  ivgDaed.l.plpellledgsfDlvvsnfavlhhlptgrrdpedleall---------------------
00479191   1/1  vvgDaedl......dgsfDlvvsnavlhhlpledleallrelarvLkP----------------------
00531071   1/1  kfDlivsnppyglegledlekllkea.rlLkpgGilvleinpetleellellkelg--------------
00518851   1/1  ggvqysrlderqleelllllalldlkpgkrvLD-------------------------------------
00526491   1/1  vsnpPypwpgvlhhlpdellekllkel-------------------------------------------
00507621   1/1  lvvsnpnvlhhlppedlekllrelarvLkPGGrlvlstpnpegleellalllallllelvllvdllpetd
00430851   1/1  dnvefivgdaedlp...fpdgsfDlvvsnavlhhl...leellrlLkpGGrlvlsvpnregl.....---
00518841   1/1  rVigvdiseemlelarenlkrlgldlhleklgyaldnvefilgdaeellkllp-----------------
00514491   1/1  livsnpPypsgvlhhlpdpllqeellkelarv--------------------------------------
00518401   1/1  DliildfvlehladllkqvlrlLkpgGvlviadylrpgllkllallesyllelksfgerlvalgrvtvvk
00512611   1/1  vLDiGcGsGgltlalarlvgpegrvta-------------------------------------------
00473861   1/1  lvvsnavlhhlpdpdleallrelarvLkpGGrlvlsepnlpdleellelllelllellpllglllleier
00490741   1/1  tgvDi.pemlelarenaaelglspnvefvvgDaed...plpd..sfDlvvsngvlhhlpdpdleallrel
00496711   1/1  larenaaelglpnrvefvvgDaedl......dgsfDlvvsnavlhhlp----------------------
00531101   1/1  cGtGglslaaakaga...eVtgvDispealelareNaalngl----------------------------
00446891   1/1  snaplhhl...leellrlLkpgGrlvlvdgnpeg.........elldkllkllllllkeelfevdfvplt
00469311   1/1  snPpggvlhhlpdleallrelarvLkPGGrlvlstpnrpglpellelll---------------------
00467441   1/1  lGcGtGglalalakllga.grvtgvDi-------------------------------------------
00519301   1/1  rreeilpllpetlleeflglrfkvdpgvff----------------------------------------
00484381   1/1  grvtgvDispealelarenakrlg...nvefiv-------------------------------------
00497191   1/1  arenakelglpnrvefivgDaed...plpd.g.fDlivssgvlhhlpdp---------------------
00466961   1/1  vvsnpsgvlhhlpde.leallrelarvLk-----------------------------------------
00528071   1/1  aaenglpnrvefivgDaedl..plpd.gs-----------------------------------------
00502341   1/1  fDlvvsnavlhhlpd...peallrelarvLkPGGrlvlstpnlpdlell---------------------
00509351   1/1  aklfp.gakvtgvDispemlefarenak------------------------------------------
00414441   1/1  lvvsngvlhhlpdpeallrelarvLkpGGrlvls------------------------------------
00472111   1/1  spealelarerlaeaglafdwspllkvvlelegnlelleeleellrad----------------------
00478511   1/1  akrvga..rvtgvDispemlelaren--------------------------------------------
00501541   1/1  vsnavlhhlpdedleallrelarvLkPGGrlvlstpnrp...........dllsleeleelleragftgv
00532291   1/1  krvLdiGgGtGglarellkhlp.vekvtavEidpevielarkyfpllglalddprvevvvgDaleflkel
00511031   1/1  arenaaelgl...vefivgDaed.lp..fpdgs-------------------------------------
00511431   1/1  vvsnavlhhlpdp...eallrelarvLkPGGrlvlstpnrpdleelrelldllerlllpghg--------
00390931   1/1  rvLdiGgGtGglarellkh.gpvakvtgvdi---------------------------------------
00421971   1/1  lalalakllP.garvtgvDispemlelArera.-------------------------------------
00468381   1/1  er.......pnvefvvgDaed...plp...sfDlvvsngvlhhlpdpeleallrelarvLkPGGrlvlse
00498851   1/1  lvldpglffgtglhpttelllellakl-------------------------------------------
00488051   1/1  nvefilgDaeellklpfpdgsfDvvlsdavlhpd------------------------------------
00527391   1/1  iflDPPyagglldlllllllalrllkp-------------------------------------------
00525361   1/1  l...pfpdgsfDlivssevlhhlsdedlaaflrelrrvLkPgGllvisdpvlpd............dlrl
00401961   1/1  snevlhhlgpedleaalkelarvLkp--------------------------------------------
00350261   1/1  glyrvkpelrdrveflqgdlldlppp..ldgsfDlifcr-------------------------------
00519441   1/1  lldlkpgdrVLDlgaGsGgltlalael-------------------------------------------
00468401   1/1  prvLDiGcGtGglalalakrlPga.rvtgvDi.pemlelarer.......pnvefvvgDaed...plp..
00512391   1/1  DlvvsnfnvlhhllseedlekalkeiarvLkpgGvlvistlnpedlpellaileleellglvprilkyif
00491711   1/1  vvsnfvlhhlflspedleaalreiarvLkPGGrlvlstpnpddllell----------------------
00379821   1/1  sdaplshlpde..aleealrvLkpGGrlvisd--------------------------------------
00474651   1/1  slplfkdglvltqdavsellvelldp--------------------------------------------
00445501   1/1  vsDPPysglsgvlhhlpdpelkrivy--------------------------------------------
00479451   1/1  alylakryp.gakvtgvDispemlela-------------------------------------------
00527091   1/1  sievlehvgpedleaflkelarvLkp--------------------------------------------
00408291   1/1  fDlilsDpPysslgllifvlhhled..-------------------------------------------
00494421   1/1  laelldlkpgerVLDlgcGtGgltlal-------------------------------------------
00528941   1/1  ..niefivgdalq....lplpggfDl--------------------------------------------
00506931   1/1  vldPPygldglellllllaa.rllkp--------------------------------------------
00516171   1/1  d...fDlvvsnlplhhlpd...leav--------------------------------------------
00486291   1/1  lngldnrvefiqgdaedl..plpde.kf------------------------------------------
00413261   1/1  livsNPPyvplsdilllevldlepls--------------------------------------------
00409641   1/1  galddprvevivgDalellfe...dekfDviiaDlpdsiglphlldle----------------------
00403271   1/1  en.......prvefvvgDafd...plp...sfDlivsswvlhhlpdeelvkllkeay-------------
00502421   1/1  vssavlhhlpd...peallrelarvLkPGGrlvlsepnrpsleelllllllllllllp...hgrflslee
00530771   1/1  lvvsngvlhhlppedleallaelarvLkpGGrll------------------------------------
00507491   1/1  lvvsNPPyiitskillklllklepelaldvledlldleelleaaarlLkpgGrlvl....vipsrflp.-
00366101   1/1  ..dgkfDlivsnppyllgledlekll--------------------------------------------
00415931   1/1  lgekfDvivsnpplhipd.leevlke--------------------------------------------
00526931   1/1  gdalellkallkegekfDlvvlDPPyf-------------------------------------------
00518421   1/1  vvssfgvlhhlpd...peaalrelarvLkPGGrlvlstpnreslpelrelllaylllkllfpelgyrlld
00527491   1/1  ldppasgl.ellkaalkllkpggivyv-------------------------------------------
00526181   1/1  tprpvtellvelllpklgdlkglrvLDpgCGsGgllialakrlpnaggaevtllGvDispealelAr---
00451091   1/1  sNpPynistavlehlpdleelrrlvlmlqleeal------------------------------------
00516791   1/1  Dlspamleearkrlaelgladdwspl--------------------------------------------
00478621   1/1  Dvvlsdpplehi...leeiarlLkPGG-------------------------------------------
00505191   1/1  ldlglsslgldradndeledlaealee-------------------------------------------
00476561   1/1  lleqlepfedekfDliisnnvlhhvp--------------------------------------------
00465681   1/1  sdaplshlgdlrrdlarlaalqlall--------------------------------------------
00487741   1/1  adnvefivgDafdlppadl..gsvdlv-------------------------------------------
00426821   1/1  livsNp...Pynissavlhhledleka-------------------------------------------
00485241   1/1  ldlllaldlleelllgelktlrvevv--------------------------------------------
00529821   1/1  evvelakkrlqalglenrvtfilgdaldilrdllellsdgsfDvvvldPPfisslpllalgvleh-----
00497781   1/1  ligsfDvvfs.nnllfdpdllkalkellrvLkp-------------------------------------
00530871   1/1  aNPPyggsgdldrlldellkrlydelalalsgvlglldlyrafleealrlLkpgGrlvfvtpnsflf---
00520841   1/1  lvtrlgeleggklflysgpnitfvqg--------------------------------------------


                         -         -         -         +         -         -         -:280
query           DGFTLARRR-------------------------------------------------------------
00521821   1/1  ilplgdglt-------------------------------------------------------------
00520011   1/1  gvregvk---------------------------------------------------------------
00494741   1/1  kllfkglrel------------------------------------------------------------
00463541   1/1  eeag------------------------------------------------------------------
00484901   1/1  ----------------------------------------------------------------------
00509191   1/1  ealleeaGf-------------------------------------------------------------
00475801   1/1  dglelv----------------------------------------------------------------
00516571   1/1  eeaGfevv--------------------------------------------------------------
00415801   1/1  ----------------------------------------------------------------------
00476761   1/1  l---------------------------------------------------------------------
00473291   1/1  aedlp...l-------------------------------------------------------------
00499151   1/1  el--------------------------------------------------------------------
00518231   1/1  ----------------------------------------------------------------------
00507451   1/1  ----------------------------------------------------------------------
00509881   1/1  ----------------------------------------------------------------------
00495321   1/1  ----------------------------------------------------------------------
00479231   1/1  ----------------------------------------------------------------------
00450601   1/1  ----------------------------------------------------------------------
00474711   1/1  ----------------------------------------------------------------------
00491221   1/1  ----------------------------------------------------------------------
00479191   1/1  ----------------------------------------------------------------------
00531071   1/1  ----------------------------------------------------------------------
00518851   1/1  ----------------------------------------------------------------------
00526491   1/1  ----------------------------------------------------------------------
00507621   1/1  rlekvvlle-------------------------------------------------------------
00430851   1/1  ----------------------------------------------------------------------
00518841   1/1  ----------------------------------------------------------------------
00514491   1/1  ----------------------------------------------------------------------
00518401   1/1  vfledGvei-------------------------------------------------------------
00512611   1/1  ----------------------------------------------------------------------
00473861   1/1  llelle----------------------------------------------------------------
00490741   1/1  arvLkpGGrlv-----------------------------------------------------------
00496711   1/1  ----------------------------------------------------------------------
00531101   1/1  ----------------------------------------------------------------------
00446891   1/1  drfy------------------------------------------------------------------
00469311   1/1  ----------------------------------------------------------------------
00467441   1/1  ----------------------------------------------------------------------
00519301   1/1  ----------------------------------------------------------------------
00484381   1/1  ----------------------------------------------------------------------
00497191   1/1  ----------------------------------------------------------------------
00466961   1/1  ----------------------------------------------------------------------
00528071   1/1  ----------------------------------------------------------------------
00502341   1/1  ----------------------------------------------------------------------
00509351   1/1  ----------------------------------------------------------------------
00414441   1/1  ----------------------------------------------------------------------
00472111   1/1  ----------------------------------------------------------------------
00478511   1/1  ----------------------------------------------------------------------
00501541   1/1  rll-------------------------------------------------------------------
00532291   1/1  ..dekfDvIi------------------------------------------------------------
00511031   1/1  ----------------------------------------------------------------------
00511431   1/1  ----------------------------------------------------------------------
00390931   1/1  ----------------------------------------------------------------------
00421971   1/1  ----------------------------------------------------------------------
00468381   1/1  pvrpdleel-------------------------------------------------------------
00498851   1/1  ----------------------------------------------------------------------
00488051   1/1  ----------------------------------------------------------------------
00527391   1/1  ----------------------------------------------------------------------
00525361   1/1  ddlpggrfrt------------------------------------------------------------
00401961   1/1  ----------------------------------------------------------------------
00350261   1/1  ----------------------------------------------------------------------
00519441   1/1  ----------------------------------------------------------------------
00468401   1/1  .sfDlvvs--------------------------------------------------------------
00512391   1/1  eggllpsll-------------------------------------------------------------
00491711   1/1  ----------------------------------------------------------------------
00379821   1/1  ----------------------------------------------------------------------
00474651   1/1  ----------------------------------------------------------------------
00445501   1/1  ----------------------------------------------------------------------
00479451   1/1  ----------------------------------------------------------------------
00527091   1/1  ----------------------------------------------------------------------
00408291   1/1  ----------------------------------------------------------------------
00494421   1/1  ----------------------------------------------------------------------
00528941   1/1  ----------------------------------------------------------------------
00506931   1/1  ----------------------------------------------------------------------
00516171   1/1  ----------------------------------------------------------------------
00486291   1/1  ----------------------------------------------------------------------
00413261   1/1  ----------------------------------------------------------------------
00409641   1/1  ----------------------------------------------------------------------
00403271   1/1  ----------------------------------------------------------------------
00502421   1/1  leelleeaGf------------------------------------------------------------
00530771   1/1  ----------------------------------------------------------------------
00507491   1/1  ----------------------------------------------------------------------
00366101   1/1  ----------------------------------------------------------------------
00415931   1/1  ----------------------------------------------------------------------
00526931   1/1  ----------------------------------------------------------------------
00518421   1/1  pshlrflsp-------------------------------------------------------------
00527491   1/1  ----------------------------------------------------------------------
00526181   1/1  ----------------------------------------------------------------------
00451091   1/1  ----------------------------------------------------------------------
00516791   1/1  ----------------------------------------------------------------------
00478621   1/1  ----------------------------------------------------------------------
00505191   1/1  ----------------------------------------------------------------------
00476561   1/1  ----------------------------------------------------------------------
00465681   1/1  ----------------------------------------------------------------------
00487741   1/1  ----------------------------------------------------------------------
00426821   1/1  ----------------------------------------------------------------------
00485241   1/1  ----------------------------------------------------------------------
00529821   1/1  ----------------------------------------------------------------------
00497781   1/1  ----------------------------------------------------------------------
00530871   1/1  ----------------------------------------------------------------------
00520841   1/1  ----------------------------------------------------------------------