[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ55030.1


[Show Plain Result]

## Summary of Sequence Search
   1::236
   9::228    6e-65 47.3% 0050375 00503751 1/1    II aaRS and biotin synthetases         
   9::218  2.7e-35 27.4% 0050295 00502951 1/1    II aaRS and biotin synthetases         
   1::236


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKSVSELLYHWLGESPVPYMEGWELQRQLHKRRVADQVPDTVLLLEHEPVYTAGKRTGPWDRPLTDPGAP
00503751   1/1  --------lllsldllllellvidlglvdyeealaleeallearldgt.pdtllllehppvytlGrnqna
00502951   1/1  --------lrlidlgsldpaenlaleeallrlvaag..ptllflwwnpptvvlGrnqnplpevnlellke


                         -         -         *         -         -         -         -:140
query           VIDIDRGGKITWHGPGQLTAYPIVKLPAPLDVVAYVRMLEEAIIRVIGDFGLSGMRVEGRTGVWLAAAPD
00503751   1/1  edllnl..gipvvrrdrGGgatyhgpGqlvaYslldlkrgldvreyvrlleeavidaLaelgikaervsg
00502951   1/1  ngipvvrRpsGGgavyhdpgnlnyslilp..lpldirelyrlleelvidalkelgie.aeisgrnDlvvd


                         +         -         -         -         -         *         -:210
query           RGLPERKIAAIGCRIAKGVTMHGFALNCNNDLSWFDRIVPCGIRDAGVTSLTAELDRTVGVGDILEATEH
00503751   1/1  rtgvwv.....dgglerKiaaiglrvrrgvtlHGlaLnvdtdlspfsrilpcgieglrvtslsellgldv
00502951   1/1  g........kKisGiAqrrsrgvvlhhgtllvdtdlellakilpvpyekleskgvksvrsrvtsLkellg


                         -         -         -         +         -         -         -:280
query           HLAAVLGASSYRRIAGWPVLPEFVDA--------------------------------------------
00503751   1/1  tveevaellleafaellg----------------------------------------------------
00502951   1/1  rdlsveel--------------------------------------------------------------