[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ55194.1


[Show Plain Result]

## Summary of Sequence Search
   1::256
   2::256  2.2e-84 48.2% 0049629 00496291 1/1   ose-phoshate binding barrel             
   2::256  1.2e-74 44.3% 0039781 00397811 1/1   ose-phoshate binding barrel             
   1::257  1.2e-73 44.2% 0047125 00471251 1/1   ose-phoshate binding barrel             
   5::249  1.9e-73 46.6% 0048998 00489981 1/1   ose-phoshate binding barrel             
   3::249  8.6e-73 46.6% 0050322 00503221 1/1   ose-phoshate binding barrel             
   2::258    7e-68 39.0% 0039992 00399921 1/1   ose-phoshate binding barrel             
   6::248  4.9e-54 32.6% 0046599 00465991 1/1   inked oxidoreductases                   
   5::246  7.5e-53 37.2% 0045712 00457121 1/1   ose-phoshate binding barrel             
  10::251  4.6e-50 36.5% 0050201 00502011 1/1   inked oxidoreductases                   
   5::238  5.5e-46 39.7% 0049739 00497391 1/1   like                                    
   1::250  1.3e-42 37.8% 0045046 00450461 1/1   in phosphate synthase                   
   1::250  5.1e-42 32.8% 0036258 00362581 1/1   inked oxidoreductases                   
  24::250  2.5e-41 34.4% 0051598 00515981 1/1   ose-phoshate binding barrel             
   3::251  6.3e-37 31.5% 0042445 00424451 1/1   inked oxidoreductases                   
  15::251  6.6e-33 30.8% 0038429 00384291 1/1   inked oxidoreductases                   
  12::249  3.5e-32 33.0% 0051164 00511641 1/1   ose-phoshate binding barrel             
   4::250  6.6e-32 31.0% 0047140 00471401 1/1   inked oxidoreductases                   
   4::249  7.4e-31 32.5% 0051442 00514421 1/1   ose-phoshate binding barrel             
   4::191  1.4e-30 30.9% 0044760 00447601 1/2   inked oxidoreductases                   
  19::254  4.2e-29 33.1% 0042110 00421101 1/1   inked oxidoreductases                   
  29::246  1.5e-27 31.7% 0052610 00526101 1/1   inked oxidoreductases                   
   5::249  1.8e-26 31.1% 0048768 00487681 1/1   ose-phoshate binding barrel             
  34::250  2.3e-25 29.4% 0036457 00364571 1/1   inked oxidoreductases                   
  32::238  3.1e-25 29.0% 0049721 00497211 1/1   like                                    
  30::246  2.5e-22 29.3% 0038583 00385831 1/1   ephosphate isomerase (TIM)              
   7::121  1.9e-20 33.9% 0038072 00380721 1/2   ose-phoshate binding barrel             
   7::125  2.7e-20 31.6% 0041152 00411521 1/2   ase                                     
  16::254  9.1e-20 28.8% 0050135 00501351 1/1   inked oxidoreductases                   
  27::255    4e-19 32.2% 0049661 00496611 1/1   ase                                     
  16::119  5.9e-18 31.7% 0039482 00394821 1/2   ase                                     
  34::256  8.7e-18 26.8% 0047889 00478891 1/1   ose-phoshate binding barrel             
  21::254  1.3e-17 30.8% 0047242 00472421 1/1   inked oxidoreductases                   
  21::254  1.5e-17 30.6% 0047026 00470261 1/1   inked oxidoreductases                   
   7::120  3.2e-16 28.0% 0041658 00416581 1/2   ase                                     
 116::251  3.6e-14 28.7% 0044928 00449282 2/2   ephosphate isomerase (TIM)              
  29::150  1.1e-13 29.2% 0049708 00497081 1/2   inked oxidoreductases                   
 140::256  1.4e-13 28.4% 0041693 00416932 2/2   ase                                     
 155::250  3.2e-13 37.5% 0051899 00518992 2/2   inked oxidoreductases                   
 159::252    5e-13 34.0% 0049708 00497082 2/2   inked oxidoreductases                   
 159::248  8.1e-13 31.1% 0046721 00467212 2/2   inked oxidoreductases                   
  17::109  8.8e-13 30.1% 0050717 00507171 1/2   like                                    
 147::236  9.9e-13 34.4% 0038072 00380722 2/2   ose-phoshate binding barrel             
  21::254  1.1e-12 27.4% 0049587 00495871 1/1   inked oxidoreductases                   
 159::250  5.9e-12 33.7% 0052481 00524812 2/2   inked oxidoreductases                   
  29::121  9.5e-12 32.3% 0046721 00467211 1/2   inked oxidoreductases                   
 110::236  3.2e-11 27.6% 0050717 00507172 2/2   like                                    
  33::112  7.6e-11 28.8% 0044928 00449281 1/2   ephosphate isomerase (TIM)              
  29::123  2.1e-10 29.5% 0052481 00524811 1/2   inked oxidoreductases                   
  29::121  2.7e-10 32.3% 0050003 00500031 1/2   inked oxidoreductases                   
  32::146  1.1e-09 28.3% 0051899 00518991 1/2   inked oxidoreductases                   
  15::111  1.5e-09 33.0% 0049848 00498481 1/2   ase                                     
  29::135  2.4e-09 20.8% 0042611 00426111 1/2   inked oxidoreductases                   
 147::235  6.2e-09 29.2% 0049146 00491462 2/2   ose-phoshate binding barrel             
  68::240    1e-08 24.3% 0047651 00476511 1/1   se C-terminal domain-like               
  29::256  1.5e-08 26.4% 0049228 00492281 1/1   ose-phoshate binding barrel             
 192::255  2.7e-08 30.6% 0044760 00447602 2/2   inked oxidoreductases                   
 159::250  5.9e-08 33.3% 0050003 00500032 2/2   inked oxidoreductases                   
 159::238  1.4e-07 35.1% 0049848 00498482 2/2   ase                                     
  20::133  2.6e-07 23.7% 0049146 00491461 1/2   ose-phoshate binding barrel             
  71::238  2.7e-07 26.4% 0051569 00515691 1/1   ne monophosphate dehydrogenase (IMPDH)  
 161::236  3.4e-07 34.2% 0048029 00480292 2/2   inked oxidoreductases                   
  29::257  9.8e-07 23.0% 0049674 00496741 1/1   ose-phoshate binding barrel             
  24::127  1.2e-06 23.3% 0038308 00383081 1/2   inked oxidoreductases                   
  29::234  1.4e-06 24.4% 0047101 00471011 1/1   ose-phoshate binding barrel             
 159::248  1.4e-06 29.2% 0042611 00426112 2/2   inked oxidoreductases                   
 161::238  1.6e-06 29.7% 0048832 00488322 2/2   ne monophosphate dehydrogenase (IMPDH)  
  63::116  1.9e-06 33.3% 0048029 00480291 1/2   inked oxidoreductases                   
  24::135    2e-06 18.9% 0038972 00389721 1/2   inked oxidoreductases                   
 157::237  2.9e-06 29.6% 0047561 00475612 2/2   ne monophosphate dehydrogenase (IMPDH)  
  21::109    3e-06 24.7% 0049004 00490041 1/2   ose-phoshate binding barrel             
  11::251  4.6e-06 20.7% 0050181 00501811 1/1   ase                                     
 159::234  5.6e-06 30.7% 0041152 00411522 2/2   ase                                     
  32::112  5.7e-06 23.5% 0050916 00509161 1/2   ose-phoshate binding barrel             
 144::238  2.1e-05 31.9% 0036628 00366282 2/2   ose-phoshate binding barrel             
 143::234  2.2e-05 31.9% 0038308 00383082 2/2   inked oxidoreductases                   
  15::122  2.6e-05 24.0% 0052356 00523561 1/2   ose-phoshate binding barrel             
 160::234    4e-05 30.1% 0049922 00499222 2/2   ose-phoshate binding barrel             
  29::135  4.1e-05 25.2% 0051489 00514891 1/2   inked oxidoreductases                   
 161::234  5.8e-05 29.7% 0049004 00490042 2/2   ose-phoshate binding barrel             
 187::232  6.6e-05 39.1% 0052356 00523562 2/2   ose-phoshate binding barrel             
  18::253  7.5e-05 23.9% 0052714 00527141 1/1   ose-phoshate binding barrel             
 157::238  0.00013 29.3% 0046530 00465302 2/2   ne monophosphate dehydrogenase (IMPDH)  
  24::122  0.00016 26.3% 0048661 00486611 1/2   inked oxidoreductases                   
 146::235   0.0002 34.1% 0045471 00454712 2/2   in phosphate synthase                   
  21::121  0.00057 22.2% 0049922 00499221 1/2   ose-phoshate binding barrel             
  33::118   0.0006 24.4% 0036628 00366281 1/2   ose-phoshate binding barrel             
 143::234  0.00079 30.8% 0038972 00389722 2/2   inked oxidoreductases                   
 156::255   0.0011 23.5% 0049675 00496752 2/2   ose-phoshate binding barrel             
 164::235   0.0025 30.8% 0050246 00502462 2/2   ase                                     
  64::121   0.0041 27.8% 0048294 00482941 1/2   ase                                     
 159::254   0.0059 27.1% 0051489 00514892 2/2   inked oxidoreductases                   
  63::117   0.0093 36.4% 0046530 00465301 1/2   ne monophosphate dehydrogenase (IMPDH)  
 159::228   0.0097 33.3% 0041658 00416582 2/2   ase                                     
  67::113     0.01 38.3% 0047561 00475611 1/2   ne monophosphate dehydrogenase (IMPDH)  
  61::124    0.012 20.6% 0049675 00496751 1/2   ose-phoshate binding barrel             
  62::117     0.02 28.6% 0048832 00488321 1/2   ne monophosphate dehydrogenase (IMPDH)  
 161::234    0.031 27.0% 0050916 00509162 2/2   ose-phoshate binding barrel             
  32::132    0.032 22.0% 0044803 00448031 1/2   inked oxidoreductases                   
  64::125    0.038 25.4% 0036340 00363401 1/2   ose-phoshate binding barrel             
 187::232    0.046 38.6% 0036340 00363402 2/2   ose-phoshate binding barrel             
  34::119    0.049 23.5% 0045471 00454711 1/2   in phosphate synthase                   
 159::252     0.08 28.0% 0048294 00482942 2/2   ase                                     
 159::234    0.089 31.6% 0048661 00486612 2/2   inked oxidoreductases                   
   7::122     0.12 23.1% 0050246 00502461 1/2   ase                                     
  17::121     0.38 30.7% 0041693 00416931 1/2   ase                                     
 159::234      0.4 32.0% 0044803 00448032 2/2   inked oxidoreductases                   
 156::228     0.43 34.2% 0039482 00394822 2/2   ase                                     
   1::256


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSLAVRVIPCLDVDGGRVVKGVNFQNLRDAGDPVELARRYDAEGADELTFLDVTASSSNRETTYDVVRRT
00496291   1/1  -mlamriiPaldlkdgrvvklvqgkllryagdpvelaklyleagadelhlvdldgallgrpvnlelikei
00397811   1/1  -gllglelpiriaPmldvtdglvvrllqgkygaalvykemvfsdllllgdpvelakayeeaGadalhvld
00471251   1/1  lml..kriiPaldlkdgkvvlvkgvllvplvtagdpleiaklleeagadalhvvdldaplaggptileai
00489981   1/1  ----mriiPaidlkdgkvvrlvqgdldenlvylgdpvelakayleagadelhvvdldgafegrgvnlevi
00503221   1/1  --lamriiPalDlkdgrvvrlvqgdldnlrvvgdpvelaavyleggadelhvvdldgal.gpevlaeaie
00399921   1/1  -mlakriipaldlkdgrvvrlivglnggdpedpveaakaaeeaGadaielndldpallgpeallevirai
00465991   1/1  -----pkdvpllstlilglklknPiilApmadvtdaelaaalalaggggvlgktmtpepqagnpvprarr
00457121   1/1  ----llllstiLdkIvadkleevaalkkriipaidlkdglvvrlvqgdlaliaevkkaspskgvidfdpv
00502011   1/1  ---------alldlkdgalvsll....dpdfgdpvelakaleeaGadalhlgdsdgaadgnliqgaevvl
00497391   1/1  ----mliipgldlks.rlvlgtg.....dygdpvelakaikesgadivvvalrripavirnrdllldlir
00450461   1/1  iimllkriylildv...............diedllelaeaaleaGadaiqlrvkdpspegllelaeaike
00362581   1/1  merlaelmlpkrlipyllvgldrevthrlnlkaldrvalipevtagdpdlsttilglelknPlvlapmag
00515981   1/1  -----------------------qgggidpedpaelaraaeeaGadaielndgcpfdsrlldgs..gllp
00424451   1/1  --kmsrLfeplklggltlknRivmaPmtryladdgvptdlllayyaqrakggagliiteatavspegrgy
00384291   1/1  --------------kmskLfePlklggltLknRvvmaPmtrylatlddgvptdlalryyaqragagliit
00511641   1/1  -----------dllkgklivsvqlaldsplrdtvdlaeaAkaaaeaGadgiri...........nggepi
00471401   1/1  ---lleeiralkdaagdlpvivqlgvgsdpedlaeaarraeeaGadaielnlgcPntkvlrgggaallqd
00514421   1/1  ---lmeiipaidlldgklvaevkgplpvllvgpdpedlaelaeaaeeaGadaievndldp..........
00447601   1/2  ---aklaeegadgidlnfgcpvskvrrdgyGaallkdpelvleivkavreavpipvtvkirlgw...dle
00421101   1/1  ------------------pdlpvfanlgvpgdteelleaaeaagadal.vldvdapqegvrleglrdpsl
00526101   1/1  ----------------------------lkkglivaltlgdpdkedlvelakaleeaGadaie.ldgsf.
00487681   1/1  ----mmtildkiladkreevenrkaliplltlgdpllpktrdflkalkeggadlIaeikkaSPskgdirv
00364571   1/1  ---------------------------------letlslskLfePlklggltLknRivmaPmtryrdgvp
00497211   1/1  -------------------------------lllEvcvdslesalaaeeaGadrleLvd.nlavggltps
00385831   1/1  -----------------------------eikrsslilgnwkmygdpaeiaklieaagaealsvltdldv
00380721   1/2  ------iipdlpleelelvlelakelglklivlvapttpverlkevaelgagfiylvsltgvtggrkalp
00411521   1/2  ------ikaikeavggvvvkvilgtvlldeeeivelaealieaGaDgikvsgGfggigatlealrliaev
00501351   1/1  ---------------pggplgvnlggaqdaepgveeaaraaeeagadalelnvdlpqlgsreldrprlll
00496611   1/1  --------------------------lldpglalaaaldfvalgadvgllvdldgafvlaptngd.....
00394821   1/2  ---------------gvpvkviletglltdveflveaaraaaeaGAdfikvsdGgtvggatpeavallve
00478891   1/1  ---------------------------------lsplilaldfpdleealellealadgvdvvelgfpl.
00472421   1/1  --------------------ivqlyvl.dretteellkraeaagadalvltvdapllgirerdlrlgfgl
00470261   1/1  --------------------gvnlyglkdpellaellrraeaagadaivltvglpvlgvrerdlrlgfll
00416581   1/2  ------ikavreacgpvvvKviletgdldleeiveaakaaaeaGadfiktstGfggggatlealrlilev
00449282   2/2  ----------------------------------------------------------------------
00497081   1/2  ----------------------------svedieeiakaleeaGadgiivsnttagghgrtslegvtggl
00416932   2/2  ----------------------------------------------------------------------
00518992   2/2  ----------------------------------------------------------------------
00497082   2/2  ----------------------------------------------------------------------
00467212   2/2  ----------------------------------------------------------------------
00507171   1/2  ----------------ealvkagfkvlvytgddlelakrleeagadavmplgeligsgiglanpellrai
00380722   2/2  ----------------------------------------------------------------------
00495871   1/1  --------------------ivnlyaskdrgvlaelleraeeagadai...vltvdspllgqrardlrgg
00524812   2/2  ----------------------------------------------------------------------
00467211   1/2  ----------------------------dvediedlakaleeaGadaiivsngigggtgltplelagvhg
00507172   2/2  ----------------------------------------------------------------------
00449281   1/2  --------------------------------evlearralalgadaiayepveaigtgkganpellpev
00524811   1/2  ----------------------------giediediakalveaGadaivvsntthggrqldiegvdliva
00500031   1/2  ----------------------------teediaeiaraaeeagadgiivtNttggrlldlepllgveag
00518991   1/2  -------------------------------edveiakaleeaGladaiivsnrtggtlaadigpgsllt
00498481   1/2  --------------ggvpvkviletglltveeiveaaraaveaGadfiktstgggsg...gatlevlali
00426111   1/2  ----------------------------tleealelakaleeagldylhvsegrveglvlliasilvgeg
00491462   2/2  ----------------------------------------------------------------------
00476511   1/1  -------------------------------------------------------------------vrd
00492281   1/1  ----------------------------lpllslkmkklliapsilaldfadlaealkllleagadlihl
00447602   2/2  ----------------------------------------------------------------------
00500032   2/2  ----------------------------------------------------------------------
00498482   2/2  ----------------------------------------------------------------------
00491461   1/2  -------------------lglkaivlinpttslerlkaiaklgdgflymvvipGvtGqktgfipevlel
00515691   1/1  ----------------------------------------------------------------------
00480292   2/2  ----------------------------------------------------------------------
00496741   1/1  ----------------------------klyliaPsilaldfadllealkllleagadlihldvmdggfv
00383081   1/2  -----------------------veggldsltleealelakaleeagvdylhvsggtvegvpegafldla
00471011   1/1  ----------------------------lalisplilalDfadllealklleelgadlihldvmdggfvl
00426112   2/2  ----------------------------------------------------------------------
00488322   2/2  ----------------------------------------------------------------------
00480291   1/2  --------------------------------------------------------------tlealaev
00389721   1/2  -----------------------veggldsltleealelakaleelgldylhvsegrveipvgegyflel
00475612   2/2  ----------------------------------------------------------------------
00490041   1/2  --------------------gldliflvapttplerlkliaelgsgfiylvslaGvTGarsevlppllel
00501811   1/1  ----------sdlslkllelltklplvpvlrgldledalelaeallegglralelrlktpkaleliealk
00411522   2/2  ----------------------------------------------------------------------
00509161   1/2  -------------------------------tsderlkaiaelssgfvylvsllGvTgarlelsadllel
00366282   2/2  ----------------------------------------------------------------------
00383082   2/2  ----------------------------------------------------------------------
00523561   1/2  --------------glkllilvtvltseealealllgadyvavlavepgldgvvvgat....elellkel
00499222   2/2  ----------------------------------------------------------------------
00514891   1/2  ----------------------------nleeavelakaleeagvdllhvshgrtsglstpaipgafldl
00490042   2/2  ----------------------------------------------------------------------
00523562   2/2  ----------------------------------------------------------------------
00527141   1/1  -----------------lmkispsilalDfadlaealklleelgadll.hldvmdggfvlnltigpeivk
00465302   2/2  ----------------------------------------------------------------------
00486611   1/2  -----------------------veggltledsnplellvelakaleeagadgkgvdylhvsegtyedlv
00454712   2/2  ----------------------------------------------------------------------
00499221   1/2  --------------------glklilliapttslerlkaiaelgsgfiylvsllgvTGaktgvspdllel
00366281   1/2  --------------------------------veaaaeaaaeaGadaitvhgyagsdtlkelleaakelg
00389722   2/2  ----------------------------------------------------------------------
00496752   2/2  ----------------------------------------------------------------------
00502462   2/2  ----------------------------------------------------------------------
00482941   1/2  ---------------------------------------------------------------vllmlea
00514892   2/2  ----------------------------------------------------------------------
00465301   1/2  --------------------------------------------------------------tltalpev
00416582   2/2  ----------------------------------------------------------------------
00475611   1/2  ------------------------------------------------------------------vaea
00496751   1/2  ------------------------------------------------------------psvlekikel
00488321   1/2  -------------------------------------------------------------pqltalpev
00509162   2/2  ----------------------------------------------------------------------
00448031   1/2  -------------------------------ealelaklleeagldylhvsegrvegpvgegyflelael
00363401   1/2  ---------------------------------------------------------------lellrkv
00363402   2/2  ----------------------------------------------------------------------
00454711   1/2  ---------------------------------leealeaeelgadyvglGpvfpTptkpgaspplglel
00482942   2/2  ----------------------------------------------------------------------
00486612   2/2  ----------------------------------------------------------------------
00502461   1/2  ------vsPgldlellaaavhlglpllpgvatptea.laalelgadyvklfpaep......ggpeylkal
00416931   1/2  ----------------pviagvganstr...eaielaklaeelGadailvlppyydkpsqegllahfkav
00448032   2/2  ----------------------------------------------------------------------
00394822   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           AEQVFIPLTVGGGVRSTEDVDRLLRAGADKVSINTAAVRRPELIREIAQEFGSQVLVLSADVRRTVNGTA
00496291   1/1  aeavpiplqvgggirslediellleagadkviigsaaledpelvaelakafgkqaivvsvdvkr......
00397811   1/1  ldaafaggvtrgvllelikeiaeavpipvqvgggirsledlaaaiivfleaaiillnaGadaviigsaal
00471251   1/1  kralkavdipvlvgggirdledaeillnaGadvviigsalltdpeliaelakavgagvivvdldvrlg..
00489981   1/1  ekiae.vdiplqvgggirdledvellleagadkviigsaalkdpellkelakafg..kivvsldak....
00503221   1/1  aiaeltdlpidvnggirsledaealleagadkviigtaalknpelvaellkafgsq.vvvsvdvki....
00399921   1/1  reavgipvivgggirspedaralleaGadavivgsalledpellaellealgpevivvaidvkav.....
00465991   1/1  ldeaginrlgfndlgaaaelrrllkllvksiaevpiivnlvgggireldaedarllleagadavelnigc
00457121   1/1  eiak.yeeaGadalsvltddgafgg...slellkaireavslpvlvkggirdpyqveealaaGadavllg
00502011   1/1  aigktvdlplqvgggirslpdlliipilllag.dpiviig....edpflvdelakaigvdgvvv.gdl..
00497391   1/1  ik.divlipl..gggirsaeeaklllgagveaiilntv...dpevideaavllpdvievldaakklvklg
00450461   1/1  lakkvdvplivndg......velaleagadgvhlgg.....pdllleaarelglgvivgv..........
00362581   1/1  gnaelaaalaagGagaievgtvtpdpqagnpvprlarlralagginrmglnnlgldalleelravrlavv
00515981   1/1  dpeiikavrkavsvpvivkgrigsdedvelalaagadgvtvgtlagedpeelleaakelglpvivgarda
00424451   1/1  pgtlglwsdeqieglkkltdavhaeggkifiqLahagrvasgllpvapsaipaplglvvpraltleeiee
00384291   1/1  eatavspegrgypgtlgiwsdeqveglkkvtdavhaaggkialQLwhagrvaspsllpggllpvaPSaip
00511641   1/1  kkvkkavdlpv.vgiilrdlpdspviidptleevdalleagadvvaldatalprpelveelvelvk....
00471401   1/1  pellleivkavreavgipvivKlrpggddtvelaraaeeaGadgiiv.......................
00514421   1/1  .ikairkavdvpvivkdfiglplavggglrdpeeaeaaleaGadgvvlgaaagyllglellaelvkaake
00447601   1/2  dtvelakaleeaGadaltvhgrtrsqrytgpadleaikevke..sipvianGgirtpedaakaleatGad
00421101   1/1  vlddikelkelvpvpvivKgvgnvltvedalllaeaGadaivv...........................
00526101   1/1  gvtvenvlelvkavke.vdvpvvlkgginp......ilrigvdgvlipdlpveepeefaeaaaeagadii
00487681   1/1  ifdpveialaye.agadalsvltdekffqg...slddlkavreavdlPvlvkdfiidpyqigearaagAd
00364571   1/1  tdllleyyalralggagliiteatavspegrgttpgtpglwsdeqieglkklvdavhaagalifiqLwha
00497211   1/1  lgllkavleavdipvhvmirprggdfvysdleliimlddidlalelgadgvvlGaldldgpldvelleel
00385831   1/1  afapsftdlaevrkavk...ipvlaqdvlivggGirtgedavemlkdaGvdgvilghserrlllgeldel
00380721   1/2  etllelirrireavdvpvivggGistpedvaelleaGAdgvvvGsaivkll-------------------
00411521   1/2  vke.....kipiiadGGIrsgedalkalaaGAdlvgvgsalaileellglleelg---------------
00501351   1/1  ellealreavgvpvivKlvggvltvedaralleaGadaivv.............................
00496611   1/1  ..........lggllslesveaaveaGadavklglyygsdkeaeqaledlervrelcralg.lplvvelv
00394821   1/2  alrevavgvkipvhasGGirtdedaakalalaaveaGadqvgadavgiG---------------------
00478891   1/1  pladgpeliealrklvpglpvfldvklgdnpetvvelaaeaGadgvtvhala..gpdlleelleaikkag
00472421   1/1  ppglgglntldlvvipegrllgadvilldaahgdplllleliealrealgvpvivkgva.tvedarrale
00470261   1/1  ppaaggalladlaralalvlagadelvlvvsdgdpeglleliealreatgvpvivkgva.tvedaraaae
00416581   1/2  vkd.....kipviaaGGIrtgeDalkalaaGad..riGtssllallagle--------------------
00449282   2/2  ---------------------------------------------ellleaGadgvilghserrlalgep
00497081   1/2  sglpllpasleliaalrealggripviavGGIrtgedaakalaaGAdgVmvgrallyagpelvleileel
00416932   2/2  ---------------------------------------------------------------------a
00518992   2/2  ----------------------------------------------------------------------
00497082   2/2  ----------------------------------------------------------------------
00467212   2/2  ----------------------------------------------------------------------
00507171   1/2  aeavkvPVivdGGIgtpsdaaaamelGadgVlvgtaiak-------------------------------
00380722   2/2  ----------------------------------------------------------------------
00495871   1/1  fllglkvtaeilalrlvppgealispahgdpilsledlkalrealgvpvivkgvl.tvedallaaeaGad
00524812   2/2  ----------------------------------------------------------------------
00467211   1/2  glsglplapaslevlaelreavggripviadGGirsgedaakalalGAdaV-------------------
00507172   2/2  ---------------------------------------dllviggktflsrlllGtgkydspellqeai
00449281   1/2  veavrallelapdvpviagGGigtgndaaaalalGadgVlvG----------------------------
00524811   1/2  qgpeagglsGnalapaaleliaeiadavkgdipviadGGIrsgedaakalalG-----------------
00500031   1/2  glsgaalkplalrlvaevreavggdipiigvGGIrtgedalealaaGAsaV-------------------
00518991   1/2  trlvehgglsgdalpplalellaevaeavgdipviadGGIrsgedaakalalGAdaVmiGraflyggpal
00498481   1/2  veavggkipviaaGGirtaedalkalaaGAdavgvgsalai-----------------------------
00426111   1/2  yflelaeaireavkipviavggi.tpelaeealeegladlvalgRaflanPdlvlklaeglplnp-----
00491462   2/2  ----------------------------------------------------------------------
00476511   1/1  gvpvyatlgggdpeelaeaaeelldeGftavkikvgapdleldlelveavreavgpd.iplrvDangg..
00492281   1/1  .dvmdggfvpnltfgpeiikalrkltdlpidvhlmindienyvelaaeagadgitvhqealpledleeli
00447602   2/2  ----------------------------------------------------------------------
00500032   2/2  ----------------------------------------------------------------------
00498482   2/2  ----------------------------------------------------------------------
00491461   1/2  vkevkkatdipvivggGIstpedakealeaGAdgvvvGsaivkaidgalaieelleavkelve-------
00515691   1/1  addeltlrrnrlaFddvllvprvltvldvsevdlstlllglglkiPiiiapMggvgeaalaaaaakaGgl
00480292   2/2  ----------------------------------------------------------------------
00496741   1/1  .pnltigpeivkalrkltdlpldvhlmindvekyielaaeagadgitvhqedlaledlkrllklikklgl
00383081   1/2  aavrkavkipviavggi.dpelaeealeeggaDlvaigRaflanPdlvlklaeglpl-------------
00471011   1/1  nltfgpeivkalrkltdlpldlhliindvekfielaaeagadgitvhaeagletleaaikaikklg....
00426112   2/2  ----------------------------------------------------------------------
00488322   2/2  ----------------------------------------------------------------------
00480291   1/2  aealgelglrgripviadGGirtgedaakalalGAdaVmvGraflg------------------------
00389721   1/2  aelirkavkipviavggi.tpelaeealaegladlvalgrafladPdlvlklaeglplnpcirct-----
00475612   2/2  ----------------------------------------------------------------------
00490041   1/2  lerireltdlpvlvgfGistpeqvkaaleaGAdgvvvGS-------------------------------
00501811   1/1  ellpdll....vgagtvlnldrvdlaleagadfvvlptad....................levikaakll
00411522   2/2  ----------------------------------------------------------------------
00509161   1/2  verirkltdlpvlvGfGIstpeqvkealeaGadgvvvGSaiv----------------------------
00366282   2/2  ----------------------------------------------------------------------
00383082   2/2  ----------------------------------------------------------------------
00523561   1/2  realpdipvivdgGigtpgedaaealeaGadgvvvGsaifkaedpaeaakal------------------
00499222   2/2  ----------------------------------------------------------------------
00514891   1/2  aaavkkavsipviavggitspedaeealeeggadlvalgRallanPdlvlkiaegleleildcit-----
00490042   2/2  ----------------------------------------------------------------------
00523562   2/2  ----------------------------------------------------------------------
00527141   1/1  alrkltdlpldvhlmindteklielaaeagadgitvhaeageellealkaikklgkkigvaln.......
00465302   2/2  ----------------------------------------------------------------------
00486611   1/2  stpvpegyfldlaaairkavgipviavggitltpedaeealeegadlvalgR------------------
00454712   2/2  ----------------------------------------------------------------------
00499221   1/2  lkrvkkatdlpvivGfGIstpenakell..gAdgvvVGsaivkliennldl-------------------
00366281   1/2  lgvlvllspstegllelllelvllvaylavelgvdgvvvgatnlellk----------------------
00389722   2/2  ----------------------------------------------------------------------
00496752   2/2  ----------------------------------------------------------------------
00502462   2/2  ----------------------------------------------------------------------
00482941   1/2  vggldvgvkaaGGirtledalkllaaGad..riGtssll..eilaelekgv-------------------
00514892   2/2  ----------------------------------------------------------------------
00465301   1/2  adavkgrdipviadGGIrtggdvakalalGAdaVmiGtaflgtleap-----------------------
00416582   2/2  ----------------------------------------------------------------------
00475611   1/2  avgvdipviadGGIrtggdvakAlalGAdaVmvGtaflatlea---------------------------
00496751   1/2  rkligdipiivdGGin.petikkaieaGadivvvGsaifkaedpeeaikalrka----------------
00488321   1/2  adavreyleegglgipviadGGirdggdiakalalGAdaVmlGtrfa-----------------------
00509162   2/2  ----------------------------------------------------------------------
00448031   1/2  ireavkipviavggi.tpelaeealeegladlvalgRaflanPdlvlklaeglplnpcirct--------
00363401   1/2  vg..pvpvivtgGirtpsggdgdqkrvltaaealeaGadgvvvGraItkaed.Pv---------------
00363402   2/2  ----------------------------------------------------------------------
00454711   1/2  lrelaelalslPvvAiGGi.tlenaaevleaGadgvavisaifaaedpa---------------------
00482942   2/2  ----------------------------------------------------------------------
00486612   2/2  ----------------------------------------------------------------------
00502461   1/2  rgplpdipivatGGisl.dnaaeylaaGavavavgsalfkkdliaagdweai------------------
00416931   1/2  aeavdlPvilYniPgrtgvdlspetlarlaeeipnivgiKdasgdlgrler-------------------
00448032   2/2  ----------------------------------------------------------------------
00394822   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           TPSGFEITTHGGRQGTGIDAVEWVQQAEELGAGEILLNSMDADGTKSGFDLELIRAVRKAVNVPLIASGG
00496291   1/1  vdgdglvatrggleltgvdlvelakaaeeaGadailvtsidrdgtlsgpdlellkevaeavsipviasGG
00397811   1/1  tnpdeahgyllsqfllpllaelakeygaqaivvgidakrgkggaallddpelveaiveavkeavpvpvtv
00471251   1/1  ....eglaevatkgglevtpidavelakraeelgadailltsrtvtgtlsgpdlellkevaeavsipvia
00489981   1/1  ......ggkvatrgwleltgvdavelakrleelgadeilvtsidrdgtlsgpdlellkklaeavsipvia
00503221   1/1  ......glvatdgwle.sgldavelakkaeeaGadaiiltgidrdgtlggpdlellrevaeavdipvias
00399921   1/1  .gvpvtvkirggldltdvdavelakaleeagadailvtgglgggtlggadlelvaeiaeavgiPviasGG
00465991   1/1  pntpvlgallakdpelvaivvaavkkav..........kvpvvvkivpgvddlveiakaleeaGadaiiv
00457121   1/1  aaalsdpelvellelakelglevlv.............................evhtleeakralelga
00502011   1/1  ...valnpgtglvaikgvapttdidalelamtvepggagqvlltgv..tGtls..diellkalreavgip
00497391   1/1  lkvl............vtgvdtlelakrledaGadailvtg.gpggtglgvadlellrevaeavdiPvia
00450461   1/1  .................svhtleealeaeelgadyillgpvfptgtkpgfgplglellrelveavkipvi
00362581   1/1  kraapdvpvgvnlggnkpaefgvddyelarraleaGadaivlnvsapnlpglrkdqgggallpdpelvle
00515981   1/1  k..........ealraarlgrealrtkgikllpdvvttveaaraaeeaGadvigvtggdltgtkrlagag
00424451   1/1  iiedfaeaarraleaGfdgveihgahgyLldqFlsplsnvrtdeyGgslenrprlllevveavreavgad
00384291   1/1  apggvfllllllelalvafvvpraltveeikriiedfaeAArraieaGfdgveihgAhgyLldqFlsplt
00511641   1/1  ...................kaltlgllvladvatveeAkraeeaGadaigvgvhggtdvtkdgglggpdl
00471401   1/1  ........................hnrtgtqlidvearkallglglgsinetgglsgpaippaaleliae
00514421   1/1  lgpglivlv............................gvltleeakaaeeaGadaigvsnigltgtvagv
00447601   1/2  gVmigraalgnpelfgeikeglggegivv.igakevl.ellleylellley-------------------
00421101   1/1  ....................sghgGrqldavevar.............sicttrlvagvglptltallev
00526101   1/1  vlhapttgdlrlikeaggfayvvlnpg...tsvagvtgarpvlglvdlvlaaavae.glsglliiylead
00487681   1/1  avlLivadlpdeeleelleaarelgldvlvevhd.............................leelera
00364571   1/1  GrvaspsllgllpvapsaiplplllllvpraltveeiaeiiedfaeaArraieaGfdgveihgahgYLld
00497211   1/1  lgaagglgvtfhraldaal........................daeealedlielGvvrilt.....sGg
00385831   1/1  vkaalklglevivcvget..........................leleealrleevgiayepvwaigtgg
00380721   1/2  ----------------------------------------------------------------------
00411521   1/2  ----------------------------------------------------------------------
00501351   1/1  ...............sgggggghidvetlrav........gaattggllgvgvpt...lallaevrealg
00496611   1/1  arggrlgwakvdpeli.............adaareaaelGa.dilkvevptdagtlegpnlealrevvea
00394821   1/2  ----------------------------------------------------------------------
00478891   1/1  lllgvlvlpv.......................tsleeakaalelgadyvlvglvvgtggdgvvfgpagl
00472421   1/1  aGadaivvs............................................ghggggl..........
00470261   1/1  aGadaivvsg............................................gggggl..........
00416581   1/2  ----------------------------------------------------------------------
00449282   2/2  delieaakklglkvivcvgevlearralalgadaiayepveaigtgkganpellpevveavrallelapd
00497081   1/2  kallallgvs------------------------------------------------------------
00416932   2/2  vggrvpviagvganstr.eaielaklaeelGadailvlppyydkpsqegllahfkavaeavdlPvilYni
00518992   2/2  --------------rpgidtaedveiakaleeaGladaiivsnrtggtlaadigpgsllttrlvehggls
00497082   2/2  ------------------dieeiakaleeaGadgiivsnttagghgrtslegvtgglsglpllpasleli
00467212   2/2  ------------------diedlakaleeaGadaiivsngigggtgltplelagvhgglsglplapasle
00507171   1/2  ----------------------------------------------------------------------
00380722   2/2  ------akelglklivlvapttpverlkevaelgagfiylvsltgvtggrkalpetllelirrireavdv
00495871   1/1  aivvsgh............................................ggggl..............
00524812   2/2  ------------------diediakalveaGadaivvsntthggrqldiegvdlivaqgpeagglsGnal
00467211   1/2  ----------------------------------------------------------------------
00507172   2/2  aesgaeivtvalrrvnlggdgaldllldllkeggvallpntagartaveavriavlareiglgtdavkle
00449281   1/2  ----------------------------------------------------------------------
00524811   1/2  ----------------------------------------------------------------------
00500031   1/2  ----------------------------------------------------------------------
00518991   1/2  leeikk----------------------------------------------------------------
00498481   1/2  ----------------------------------------------------------------------
00426111   1/2  ----------------------------------------------------------------------
00491462   2/2  ------ikklglkaivlinpttslerlkaiaklgdgflymvvipGvtGqktgfipevlelvkevkkatdi
00476511   1/1  .................wtleeairlakaleeagygllwi....EePlpad.dleglaelreavgipiaa
00492281   1/1  kaikklgkkvgvaln.......................patplealeaile....gadyvlvgsvnpgft
00447602   2/2  ---------------------------------------------------eaikevke..sipvianGg
00500032   2/2  ------------------diaeiaraaeeagadgiivtNttggrlldlepllgveagglsgaalkpl..a
00498482   2/2  ------------------eiveaaraaveaGadfiktstgggsg...gatlevlaliveavggkipviaa
00491461   1/2  ----------------------------------------------------------------------
00515691   1/1  gvlgaggstpeeavaaaavkkalakkllggaapgalvdaaeravalleagadaividvahgvstslgwpd
00480292   2/2  --------------------vedAkaaeeaGaDaivvsgaGGtg...ldvgpptlealaevaealgelgl
00496741   1/1  kvgvaln.......................pstplealkalldl....adyvlvmsvnpgfggqkfipas
00383081   1/2  ----------------------------------------------------------------------
00471011   1/1  .........................lklgvslnpstplerlkellklllgvdyvllmsvlpgftgqkfip
00426112   2/2  ------------------ealelakaleeagldylhvsegrveglvlliasilvgegyflelaeaireav
00488322   2/2  --------------------veaalalidaGaDavkvgggeg.sghtgrvvdgvgvpqltalpevadavr
00480291   1/2  ----------------------------------------------------------------------
00389721   1/2  ----------------------------------------------------------------------
00475612   2/2  ----------------gvatvedAkkaeeaGaDaivvsgggggghtgrlstgvllpqivavrlvaeaavg
00490041   1/2  ----------------------------------------------------------------------
00501811   1/1  glplipG..vaTpee...........alaaleaGadyvkigPasitt.....gvpqlkallavlpgipvi
00411522   2/2  ------------------eivelaealieaGaDgikvsgGfggigatlealrliaevvke.kipiiadGG
00509161   1/2  ----------------------------------------------------------------------
00366282   2/2  ---Gadaitvhgyagsd.tlkelleaakelglgvlvllspstegllelllelvllvaylavelgvdgvvv
00383082   2/2  --spldlveggldsltleealelakaleeagvdylhvsggtvegvpegafldlaaavrkavkipviavgg
00523561   1/2  ----------------------------------------------------------------------
00499222   2/2  -------------------slerlkaiaelgsgfiylvsllgvTGaktgvspdllellkrvkkatdlpvi
00514891   1/2  ----------------------------------------------------------------------
00490042   2/2  --------------------lerlkliaelgsgfiylvslaGvTGarsevlppllellerireltdlpvl
00523562   2/2  ----------------------------------------------gatelellkelrealpdipvivdg
00527141   1/1  ................pstplerlkaildladyvlvmsvlpgftgqkfipss..lekikalrkligelgl
00465302   2/2  ----------------gvatvedAlaaveaGaDaivvggggGggltgrevlgvgvptltalpevadavkg
00486611   1/2  ----------------------------------------------------------------------
00454712   2/2  -----ellg.gliiGvsthsleealeaeelgadyvglGpvfpTptkpgaspplglellrelaelalslPv
00499221   1/2  ----------------------------------------------------------------------
00366281   1/2  ----------------------------------------------------------------------
00389722   2/2  --spldlveggldsltleealelakaleelgldylhvsegrveipvgegyflelaelirkavkipviavg
00496752   2/2  ---------------pstplelleeilelslldlvllmsvepgfggqkfipsvlekikelrkligdipii
00502462   2/2  -----------------------alaalelgadyvklfpaep......ggpeylkalrgplpdipivatG
00482941   1/2  ----------------------------------------------------------------------
00514892   2/2  ------------------eavelakaleeagvdllhvshgrtsglstpaipgafldlaaavkkavsipvi
00465301   1/2  ----------------------------------------------------------------------
00416582   2/2  ------------------eiveaakaaaeaGadfiktstGfggggatlealrlilevvkd.kipviaaGG
00475611   1/2  ----------------------------------------------------------------------
00496751   1/2  ----------------------------------------------------------------------
00488321   1/2  ----------------------------------------------------------------------
00509162   2/2  --------------------derlkaiaelssgfvylvsllGvTgarlelsadllelverirkltdlpvl
00448031   1/2  ----------------------------------------------------------------------
00363401   1/2  ----------------------------------------------------------------------
00363402   2/2  ----------------------------------------------salglellrkvvg..pvpvivtgG
00454711   1/2  ----------------------------------------------------------------------
00482942   2/2  ------------------eiakaallaaeaGadfiktst....Gfllggatledvllmleavggldvgvk
00486612   2/2  ------------------dsnplellvelakaleeagadgkgvdylhvsegtyedlvstpvpegyfldla
00502461   1/2  ----------------------------------------------------------------------
00416931   1/2  ----------------------------------------------------------------------
00448032   2/2  ------------------ealelaklleeagldylhvsegrvegpvgegyflelaelireavkipviavg
00394822   2/2  ---------------tdveflveaaraaaeaGAdfikvsdGgtvggatpeavallvealrevavgvkipv


                         -         -         -         +         -         -         -:280
query           AGAVEHFAPAVDAGANAVLAASVFHFGEITISDVKAELRAKGYPVR------------------------
00496291   1/1  igsledaaellaaGadavlvGsallggplllkeikelleelgievr------------------------
00397811   1/1  kirggtelgdidavelakaleeaGadailvtgrtrdgtlsgadlel------------------------
00471251   1/1  sGGigtpedaaklleaGadgvivGsalfggplileeakalleelgke-----------------------
00489981   1/1  sGGigsledlkellelsnlletgadgvlvgsallggplt-------------------------------
00503221   1/1  GGigsledlaaalellalGadgvlvGsallggpeslaea-------------------------------
00399921   1/1  irspedaakalaaGAdaVlvgsallggpelvreikegleeggllvrln----------------------
00465991   1/1  tnttagghlglellkpilkvgigglsgrplrplalelv--------------------------------
00457121   1/1  dligvnnr..dgttggvdlellkelaeavpkdipvi----------------------------------
00502011   1/1  vviagGGistpedaaelle.gAdgvvvGsaifkgedplkea-----------------------------
00497391   1/1  dGGIgtpedaakalelGAdgVlvGsaia------------------------------------------
00450461   1/1  asGGi.tpenaaealeaGadgvavgsailgapdpaeaaka------------------------------
00362581   1/1  likalkeavg...lpvivklapgltgvdtvelakraeeaG------------------------------
00515981   1/1  lelvrevkeavpipvinfaaGGIgtpedaaaalelGAdgV------------------------------
00424451   1/1  fiv..............gvRlspddlvgggltleeavelak-----------------------------
00384291   1/1  nkrtdeyGgslenrarfllevveavreavgdfpvgvrlspl-----------------------------
00511641   1/1  ellkevveavdipviaeGgIntpedakkalalGadavmv-------------------------------
00471401   1/1  vreavpgipvianGGIrtgedalealaaGAdaVmvgsall------------------------------
00514421   1/1  gppdlellrevve.vgipviadGGIrtpedaakalaaGA-------------------------------
00447601   1/2  ----------------------------------------------------------------------
00421101   1/1  aeavggipviadGGirtggdvakalalGAdaVgiGraflyalea--------------------------
00526101   1/1  gt..pvdlelvkevkkavpdipvivgGGIsspedak----------------------------------
00487681   1/1  lalgadiigvnnrgltglevdldtllellklvpe..dip-------------------------------
00364571   1/1  qFlspltnkrtdeyGgslenrarfllevveavraavgadf------------------------------
00497211   1/1  aagaleglellkelvelagripivagGG------------------------------------------
00385831   1/1  gatnrnleqieelleairellgdvpviagGGistpn----------------------------------
00380721   1/2  ----------------------------------------------------------------------
00411521   1/2  ----------------------------------------------------------------------
00501351   1/1  dipviadGGirtgedaakalalGAdaVlvgrallyaleaggegv--------------------------
00496611   1/1  vgiPwvilsGGvsspefleavkaaieaGAsGvivGRavwqgplpl-------------------------
00394821   1/2  ----------------------------------------------------------------------
00478891   1/1  ellrelre.ldipvivdGGi.tpedaaealeaGadgvvvGsaitka------------------------
00472421   1/1  .................dvgipt..laalpevveavdvpviadG--------------------------
00470261   1/1  ...................dvgvptlealpevaeavggdipvia--------------------------
00416581   1/2  ----------------------------------------------------------------------
00449282   2/2  vpviagGGigtgndaaaalalGadgVlvGsallkaedpaaa-----------------------------
00497081   1/2  ----------------------------------------------------------------------
00416932   2/2  PgrtgvdlspetlarlaeeipnivgiKdasgdlgrlerllrllelt------------------------
00518992   2/2  gdalpplalellaevaeavgdipviadGGIrsgedaakal------------------------------
00497082   2/2  aalrealggripviavGGIrtgedaakalaaGAdgVmvgral----------------------------
00467212   2/2  vlaelreavggripviadGGirsgedaakalalGAdaV--------------------------------
00507171   1/2  ----------------------------------------------------------------------
00380722   2/2  pvivggGistpedvaelleaGAdgvv--------------------------------------------
00495871   1/1  ...............dvgvptlealpevaeavggdipviadGGi--------------------------
00524812   2/2  apaaleliaeiadavkgdipviadGGIrsgedaakalalG------------------------------
00467211   1/2  ----------------------------------------------------------------------
00507172   2/2  vigddlillpdvletleaaealvkag--------------------------------------------
00449281   1/2  ----------------------------------------------------------------------
00524811   1/2  ----------------------------------------------------------------------
00500031   1/2  ----------------------------------------------------------------------
00518991   1/2  ----------------------------------------------------------------------
00498481   1/2  ----------------------------------------------------------------------
00426111   1/2  ----------------------------------------------------------------------
00491462   2/2  pvivggGIstpedakealeaGAdgv---------------------------------------------
00476511   1/1  dEsvtsledlkelleagaadavqiklakiG----------------------------------------
00492281   1/1  gqkfipgvleklkalrkligelgldipiivdGGI.npenikkaiea------------------------
00447602   2/2  irtpedaakaleatGadgVmigraalgnpelfgeikeglggegiv-------------------------
00500032   2/2  lrlvaevreavggdipiigvGGIrtgedalealaaGAsaV------------------------------
00498482   2/2  GGirtaedalkalaaGAdavgvgsalai------------------------------------------
00491461   1/2  ----------------------------------------------------------------------
00515691   1/1  lkilrl......................------------------------------------------
00480292   2/2  rgripviadGGirtgedaakalalGA--------------------------------------------
00496741   1/1  leklkelrkligelgldipivvdGGi.npenikkaleaGadgvvvGs-----------------------
00383081   1/2  ----------------------------------------------------------------------
00471011   1/1  aslekikelrkligdipiivdGGI----------------------------------------------
00426112   2/2  kipviavggi.tpelaeealeegladlvalgRaflanP--------------------------------
00488322   2/2  eyleegglgipviadGGirdggdiakal------------------------------------------
00480291   1/2  ----------------------------------------------------------------------
00389721   1/2  ----------------------------------------------------------------------
00475612   2/2  vdipviadGGIrtggdvakAlalGAda-------------------------------------------
00490041   1/2  ----------------------------------------------------------------------
00501811   1/1  atGGis.lgniakalaaGadavavgsalagadespgevlel-----------------------------
00411522   2/2  IrsgedalkalaaGAdlvgvgsal----------------------------------------------
00509161   1/2  ----------------------------------------------------------------------
00366282   2/2  gatnlellkeirellgdvplivdgGirt------------------------------------------
00383082   2/2  i.dpelaeealeeggaDlvaigRa----------------------------------------------
00523561   1/2  ----------------------------------------------------------------------
00499222   2/2  vGfGIstpenakell..gAdgvvV----------------------------------------------
00514891   1/2  ----------------------------------------------------------------------
00490042   2/2  vgfGistpeqvkaaleaGAdgvvv----------------------------------------------
00523562   2/2  GigtpgedaaealeaGadgvvv------------------------------------------------
00527141   1/1  dipivvdGGi.npetikkaieaGadgvvvGsaifkae.dpkea---------------------------
00465302   2/2  rdipviadGGIrtggdvakalalGAdaV------------------------------------------
00486611   1/2  ----------------------------------------------------------------------
00454712   2/2  vAiGGi.tlenaaevleaGadgvav---------------------------------------------
00499221   1/2  ----------------------------------------------------------------------
00366281   1/2  ----------------------------------------------------------------------
00389722   2/2  gi.tpelaeealaegladlvalgr----------------------------------------------
00496752   2/2  vdGGin.petikkaieaGadivvvGsaifkae.dpeeaikalrka-------------------------
00502462   2/2  Gisl.dnaaeylaaGavavavgsal---------------------------------------------
00482941   1/2  ----------------------------------------------------------------------
00514892   2/2  avggitspedaeealeeggadlvalgRallanPdlvlkiaegle--------------------------
00465301   1/2  ----------------------------------------------------------------------
00416582   2/2  IrtgeDalkalaaGadri----------------------------------------------------
00475611   1/2  ----------------------------------------------------------------------
00496751   1/2  ----------------------------------------------------------------------
00488321   1/2  ----------------------------------------------------------------------
00509162   2/2  vGfGIstpeqvkealeaGadgvvv----------------------------------------------
00448031   1/2  ----------------------------------------------------------------------
00363401   1/2  ----------------------------------------------------------------------
00363402   2/2  irtpsggdgdqkrvltaaeale------------------------------------------------
00454711   1/2  ----------------------------------------------------------------------
00482942   2/2  aaGGirtledalkllaaGad........riGtsslleilael----------------------------
00486612   2/2  aairkavgipviavggitltpeda----------------------------------------------
00502461   1/2  ----------------------------------------------------------------------
00416931   1/2  ----------------------------------------------------------------------
00448032   2/2  gi.tpelaeealeegladlvalgR----------------------------------------------
00394822   2/2  hasGGirtdedaakalal----------------------------------------------------