[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ55274.1


[Show Plain Result]

## Summary of Sequence Search
   1::227
  22::194  7.4e-33 36.5% 0049241 00492411 1/1   proteins                                
  22::200  2.2e-30 32.5% 0048395 00483951 1/1   proteins                                
  21::221  2.1e-29 30.9% 0052813 00528131 1/1   proteins                                
  23::193  5.9e-29 32.0% 0049507 00495071 1/1   proteins                                
  21::194  2.6e-24 27.9% 0049640 00496401 1/1   proteins                                
  21::211  3.6e-24 23.8% 0049022 00490221 1/1   proteins                                
  22::191  1.3e-21 27.6% 0049548 00495481 1/1   proteins                                
  20::202  2.1e-21 23.5% 0051281 00512811 1/1   proteins                                
  21::199  2.7e-21 26.4% 0043718 00437181 1/1   proteins                                
  23::190  3.9e-20 28.7% 0049201 00492011 1/1   proteins                                
  22::205  9.6e-18 25.1% 0042957 00429571 1/1   proteins                                
  20::190    1e-16 29.7% 0051274 00512741 1/1   proteins                                
  22::209    2e-15 23.9% 0046417 00464171 1/1   proteins                                
  22::201  2.1e-15 24.6% 0051705 00517051 1/1   proteins                                
  22::205  5.4e-15 25.0% 0046267 00462671 1/1   proteins                                
  20::205  2.7e-11 24.5% 0036778 00367781 1/1   proteins                                
  22::218  5.5e-10 20.8% 0051820 00518201 1/1   proteins                                
  19::192  1.8e-07 23.3% 0044895 00448951 1/1   proteins                                
  23::191  3.4e-05 22.2% 0052810 00528101 1/1   proteins                                
  26::201  3.5e-05 20.7% 0053358 00533581 1/1   proteins                                
  22::199  6.4e-05 19.6% 0045773 00457731 1/1   proteins                                
  23::188  0.00053 17.3% 0051357 00513571 1/1   proteins                                
   1::227


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MISRTGRPTAGHAEGSRREPPLRLVVVVASARKGRNGGCVAQWFLEQTTGRSELEVDTVDTAVFPLPPEP
00492411   1/1  ---------------------mkilvivgSlrkgsntrklaeaaaellee..gaevelidladlplplld
00483951   1/1  ---------------------mkilvivGSlrkgsnnrklaealaellee.agaevelidladlnlplld
00528131   1/1  --------------------llledllllddlpvldldllllidllellimstpmkilvlygSprrgsnt
00495071   1/1  ----------------------kiliivgsprkgsntralaeaaaegleeallelhpgaevelidladln
00496401   1/1  --------------------smmkiliiygSprlkgsntralaeaaaegleealpgaevelidladldlP
00490221   1/1  --------------------Msm.kiliiygSprkgsntralaeaaaegleea.gaevelidladldldp
00495481   1/1  ---------------------MkkiliiygSprlkgsntralaeaaaegleealpgaevelidladlplp
00512811   1/1  -------------------aPMkiliiygSpr..gnteklaeaiaeglee.agaevelidladlplppcl
00437181   1/1  --------------------M.KvlviygSprgknsntrklaeaaaeglee..gaevevidladlpippc
00492011   1/1  ----------------------KiliiygSprkgsntralaeaaae......gaevelidladldlppcl
00429571   1/1  ---------------------mmmkiliingspregsntralaeaaleglke.pgaevevid..Lydlni
00512741   1/1  -------------------gekkilvlygSlt..gntellaealaeglea.agvevelvdladldlpdl.
00464171   1/1  ---------------------mmmkiLiinasprenslsraladaalegleeagh.evevld..Lydlpf
00517051   1/1  ---------------------MmkilvvygSpr..gnTeklaeaiaegaee.agaevelidvaelplpec
00462671   1/1  ---------------------mmmkiLiingspregsltraladaalegleeagh.evevid..Lyalpf
00367781   1/1  -------------------mmmkvlivygSmy..gnteklaeaiaeglre.agvevelidlsdtdl....
00518201   1/1  ---------------------MmkiliiygSpt..GnTeklaeaiaegleavagvevelidvsdadp...
00448951   1/1  ------------------kkmkkvlivygSmy..gnteklAeaiaeglke.agvevelldlselda....
00528101   1/1  ----------------------KvlivYgSmt..GnTeklAeaiaeglge.agvevelldladadp....
00533581   1/1  -------------------------ilivYgSmtGnTeklAeaiaeglee.agvevellnlsdadp....
00457731   1/1  ---------------------mkililYgSlt..GnTeklAeaiaeglg...gaevelidlddad.....
00513571   1/1  ----------------------AkililygS..qtGnTeklAeaiaegleea.gv.velidldead....


                         -         -         *         -         -         -         -:140
query           HRDPDPTTVQVLSRLTPRLRRADMFVFVVPEYNRSFPASVKSLIDWHTAEWEAKPVGFVSYGGRSGGLRA
00492411   1/1  gdleglpddvq...ellekllaaDglvfatPeYngsipglLKnalDrlsrpggkllagKpvalvstsgga
00483951   1/1  gc......pddvqelrekiaeaDaivlvtPeYngsipgaLKnalDwlsrpwlagkpvalvavsgggsggl
00528131   1/1  rklaeaaaegleaa.gaeveiidladlpl.plgcidclp...ddvaelledllaadgivvgsPtyngsmp
00495071   1/1  l.PlldedllgallcltegqcalpddvaeliekllaaDalvfvtPeYngsiPalLKnfiDrvsrplkgKp
00496401   1/1  lldedlcigcfaclkelsegecvlpddvaallekllaaDaivfgtPeyngsvpallKnfiDrvlrpgfaf
00490221   1/1  cldcdlcaakgkcvelltlaqeellalkegllpddvaellekllaaDaivfgtPvyngsvpaqlKnfiDr
00495481   1/1  pcdgclecalktgacvlpddvqallalsdallekllaaDaivfgtPeyngsvpallKnfiDrvlragfaf
00512811   1/1  gdlecltegecvlpddveelleklleaDaiilgtPtyngsvpaqlknflDrvlrlgfggllkgKpaalfg
00437181   1/1  lgcllcalgfkdgkcaqkvaddvaelleklleaDaivfgsPvyngsvpaqlKafiDrlsrlgpvgllkgK
00492011   1/1  gdlecakgkcplp...ddveallekllaaDaivfgtPeyngsvpaqlKnfiDrvsrlgfafgydgpggll
00429571   1/1  dpcldcddcaallkppegltlsleealalgecalpddveellekllaaDaivfafPlYwfsvPallKnfi
00512741   1/1  ...............leelldadalvVgsPtyngsipgllkafldrllglglkgkkvavfgsgggsgg..
00464171   1/1  dpcldcddcaakftppegltaeqeealalgecvlkddvaeeqekllaADvivfafPlywfgvPalLKgwi
00517051   1/1  lacgdcplk.ddlealledlleaDgiilGsPtyfgsvsaqlkafldrlsrlwlsgalagKpaavftssgg
00462671   1/1  dpcldcddcaalftppegltpeqkqalalgkcplpddvealqekllaADaivfafPlywfsvPallKgwi
00367781   1/1  ............delleelldadaiilGsPtynggvlpqlknfldalsgldlkgKpvavfgsgg..gsge
00518201   1/1  .................edlleaDgiilGsPtygggvpgqlkdfldrlsglwlgllkgKpaavfgsgggs
00448951   1/1  .........peilelleelldadalilgsPtyggeippqlkdfldllgglalkgKlaavfgsggwfgg..
00528101   1/1  ................edlldadalilgtptygggelpddlvkdfldllkldlkgkkvavfgsggs.gfg
00533581   1/1  ................edlldydaiilgsptygggeppedevkdfldrllgklkgkkvavfgsggs.gfg
00457731   1/1  ...............ledleeydaiilgtptygygelpdnlkdfldellgldlsgkkvavFglgdssggg
00513571   1/1  ................ledleeadaiifgtptygfGelpdnlkafldrtfydfleglkglllkgkkyavf


                         +         -         -         -         -         *         -:210
query           VEHLGQVFTELHAVTVRNTVSFHSVEEQFDSEGRPKSPEACAVAAQNLLDQLVWWGRALRRAREESPYRG
00492411   1/1  lgglraleqlrlilgflgavvvpsvvvalgkalelfdedgllld.eellerlke----------------
00483951   1/1  raleqlrqvlaflgalvipsqvlilgag..fdedgvltdeelle.rledlldelvkllkl----------
00528131   1/1  allKnflDrllllggsvgllagKpaavfvtgggsggelaleqlrtllahlgmivvppglsvgvagltfde
00495071   1/1  vllvstsgg.gglrallylrtilgflgatvvpsvvalgvaagelfdedgeltd-----------------
00496401   1/1  gygglgpvgllkgKpaalvvtsggpggglaaetalrplltilgflgmtvvglvl----------------
00490221   1/1  vlragfafgygglgpvgllkgKpaalvvtsggpggayaaggaegtlrqlltpllrgilgflgitvlgpvl
00495481   1/1  gytglggggllkgKpaalivtsggpggglaaesalrylltilgflgmpvvg-------------------
00512811   1/1  tsggpgggaerallqlrtilaflgmivvglglaigvafdafgaplgastlaggvlldedele--------
00437181   1/1  vvavvttsggggaeaalqylrtilaflgmivv.glvyaegvll.gpgdevllgsaygaf-----------
00492011   1/1  kgKpaalvvtsggpgggylesalrylrtilaflgmtvvgsvyaegv..df--------------------
00429571   1/1  DrvlragfafgytgngpegllkgKkvllvvtsggpeeaysaggpnggvddlltpllrgilgflGm-----
00512741   1/1  avkqlrellaelgalvvplgvllv..dedpdeealerieelgeelaklla--------------------
00464171   1/1  DrvlragfafgytgdgpvgllkgKkallivtsGgpeeaysegggagalldlllpylrgilgflGitvvp-
00517051   1/1  sgggqetallslrtlllhlgmivvglglavgglldefrggspygastfagidggvlp.dee---------
00462671   1/1  DrvlraGfafgyggngpvgllkgKkalvivtsGgpeeayseggpaggledlllpylrgilgflGi-----
00367781   1/1  avdllrellkelgakvvgepllv.........kgapde.........edletaeelgkrlaellk-----
00518201   1/1  gggfedalkylrkllkelgmivvglgyfagalggspygallaegap..deedlerarelgkrlaellkkl
00448951   1/1  avktleellkelgakvv.pllei.........kgsptdleeleelgkelakt------------------
00528101   1/1  dalklldellkelgakvvgeglii..........pdeedlekarelgkrla-------------------
00533581   1/1  ealklleellkelgakvvglpllag...................vpdeedlerarelgkrl---------
00457731   1/1  eefcealklldkllaelgakvvgeglladydfeasfalwldglfiglalpeeedlelae-----------
00513571   1/1  glgdslgygeefcaaakkldklllelgakvv.glglidgyd..leedl----------------------


                         -         -         -         +         -         -         -:280
query           SARDIRSQMIEEPQYVR-----------------------------------------------------
00492411   1/1  ----------------------------------------------------------------------
00483951   1/1  ----------------------------------------------------------------------
00528131   1/1  ggrlkdeelld-----------------------------------------------------------
00495071   1/1  ----------------------------------------------------------------------
00496401   1/1  ----------------------------------------------------------------------
00490221   1/1  f---------------------------------------------------------------------
00495481   1/1  ----------------------------------------------------------------------
00512811   1/1  ----------------------------------------------------------------------
00437181   1/1  ----------------------------------------------------------------------
00492011   1/1  ----------------------------------------------------------------------
00429571   1/1  ----------------------------------------------------------------------
00512741   1/1  ----------------------------------------------------------------------
00464171   1/1  ----------------------------------------------------------------------
00517051   1/1  ----------------------------------------------------------------------
00462671   1/1  ----------------------------------------------------------------------
00367781   1/1  ----------------------------------------------------------------------
00518201   1/1  kggktdls--------------------------------------------------------------
00448951   1/1  ----------------------------------------------------------------------
00528101   1/1  ----------------------------------------------------------------------
00533581   1/1  ----------------------------------------------------------------------
00457731   1/1  ----------------------------------------------------------------------
00513571   1/1  ----------------------------------------------------------------------