[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ55328.1


[Show Plain Result]

## Summary of Sequence Search
   1::392
  44::387    3e-66 29.9% 0048996 00489961 1/1   lasmic binding protein-like I           
  43::389  4.4e-66 30.1% 0049989 00499891 1/1   lasmic binding protein-like I           
  43::389  2.1e-64 30.8% 0045352 00453521 1/1   lasmic binding protein-like I           
  36::387  7.9e-57 28.4% 0046641 00466411 1/1   lasmic binding protein-like I           
  38::387  2.1e-50 28.2% 0039493 00394931 1/1   lasmic binding protein-like I           
  43::387  1.7e-39 26.5% 0036537 00365371 1/1   lasmic binding protein-like I           
   1::392


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNMRKSWSRTLLAATGATALLAAAACGTNEAGESSSTGEGLPDTIKIMSIKEMTGPVSFAGENSTKGIDL
00489961   1/1  -------------------------------------------pikiGvllplsGpaaalgkalragael
00499891   1/1  ------------------------------------------dpikiGvllplsGplaalgkailngael
00453521   1/1  ------------------------------------------dtikiGvllplsGpaaalgksilrgael
00466411   1/1  -----------------------------------laaaaaagdikIGvlfpltslplftdlpelllcgp
00394931   1/1  -------------------------------------aaalpgdikiGvllpltgdyafsgrrvllalel
00365371   1/1  ------------------------------------------gdikiGvllpltgtlasiggarvapAve


                         -         -         *         -         -         -         -:140
query           AVEQINEQGFLGDTKLEIDLKDASDSTQEAASLATQAVSDKSYSAILGPGLSSQASAISPIAEKGEIPVI
00489961   1/1  aveeiNaaGGvlGrkielvveDdqsdpdraaaaarklvdqdgvdavvGpvssgvalavapvaeeagvpli
00499891   1/1  aveeiNaaggilGrklelvvaDdqsdpakavaaarkli.ddgvdavvGplssgvalavapvaeeagipli
00453521   1/1  aveeiNaaggilGrklelvvlDdasdpekavaaarklv.ddgvdaiigplssgvalavapvaeeagvpli
00466411   1/1  laalgyqillaaelAveeiNanggllpgikLglviydtcgdpavavaaalklisstllsslvwlsgqgel
00394931   1/1  AveeinadgllvlsllpgvtlelvvldtecdpstllalaaaldlilsdgvdaiiGpscsssaaavarlas
00365371   1/1  lAveeinadglllpgytlelvvldtesslgicdpsealaaavdllltdgvdaiiGpacsyvaiavarlas


                         +         -         -         -         -         *         -:210
query           YYQAGSDGVLVGDYTYRVTAPAASYYHIIGDYLAEKKVKTAAVLYTSGNPTLTELGEKAVPGVIEENGVT
00489961   1/1  spsatapalt.spyvfrtgasdsqqaaaladylaklggkkvallya..dyaygrgladafkkalkalGge
00499891   1/1  spsatspaltde.gspyvfrtgpsdsqqaaaladylakklgakkvally..sddaygrgladafkkalka
00453521   1/1  spaatapdltdegspyvfrtgpsdsqqaaaladylakklgakkvaliy..pddaygrglaegfkkalkka
00466411   1/1  ipnyscrdltlyddgvvaviGpassgvslavaplaelykiPqisygatspslsdkdqypyffrtvpsdss
00394931   1/1  lwniPlisygatspaflsdkskyptllrtvpsdtslaealvallkhfgwkrvalvysdddygedcrglle
00365371   1/1  ewniPlisygatspalsdksryptffrtvpsdtkqgdalvellkhfgwkrvallys..dddygegedcff


                         -         -         -         +         -         -         -:280
query           IKRSDTVSNDTQDFTAVTSEIIKADPDAVFLLLLGPQNPRAVSQLKQKGYDGEIIGMTTMGAGNLETAGE
00489961   1/1  vvgeeyyplgtttedfsaqltkikaagpdavflagygadaalflkqareaglkakvplvgslglaspell
00499891   1/1  aggevvgeeyyplgatdfsaqllkikaagpdavvlagygadaalflkqarelglkvpllgsdglaspell
00453521   1/1  ggkvvaeeyyplgatdfsallaklkaagpdavvlagsgadaalflkaareaGlkvpiigtdglaseelle
00466411   1/1  qaralaellkhfgwkwvaliys..dddygeglldafkealekagicvafvekipvsldagdtdfsailtk
00394931   1/1  aleealekrgitvafvemiplgdtdfrallkkiks.karviilcgssedarellraaaelgltggeyvwi
00365371   1/1  laealekaleargitvvfvelipdadeadfralLqkiks.karviilcgsgeearlllkaarelgltgge


                         -         *         -         -         -         -         +:350
query           DAAGVVWPSNFSARSEVPSTQEFVKAYEEKYGELPNNYAAEGYDAVWLLARGIKEANSADRVAIREGIAK
00489961   1/1  klagdaaeGvlvtapyfpdldtpankafveaykakyggdappsafaaaaYdavlllaeAlekagsldrea
00499891   1/1  elagdaaegvlltapyfpd.dtpankafveaykakyggppsafaalaydavlllaealekagsldrealr
00453521   1/1  lageaaeGvllaapyfp.ldtpankafvkaykkkygdppsafaalaydavlllaealekag..drealla
00466411   1/1  ikaskarvivvfgsgddaalllrqarelgltggyvwigtdgwdtsdlldelagdaaegvlgfsphsp..e
00394931   1/1  ltdlllssldledfwyagdgtdekaleafegvlgvtllsp..dspefkeflqkvkarfgeppfncsllvs
00365371   1/1  yvfilidllassllvdlagkaaegwlgtdgldeeareayegvltitlyspdnpeykefvervkarakkep


                         -         -         -         -         *         -         -:420
query           VAAEGFDGAQGPLSFENNDVRVEGVIASWNGSEEVVVTLGDD----------------------------
00489961   1/1  vraaleglk...fdgltGpvtfdpnghqavkdvylvq---------------------------------
00499891   1/1  aalegl...dfdgvtgpvtfdpnghqalgpvylvqvkdg-------------------------------
00453521   1/1  alegl...dfdgvtgpvtfdpnghlgvravyivqvkggk-------------------------------
00466411   1/1  ipgfkeflkalkpryypediflkefwelyfncslsal---------------------------------
00394931   1/1  tyaallydAvyllahAlhelllqgggsldgtklleal---------------------------------
00365371   1/1  fncledelvsayaaylyDAvylyalAlnealsdggdv---------------------------------