[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ55377.1


[Show Plain Result]

## Summary of Sequence Search
   1::1060
 326::443    3e-08 29.7% 0051604 00516041 1/1   p containing nucleoside triphosphate hy 
 326::477  9.3e-08 27.4% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
 328::508  3.9e-07 20.9% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
 326::446  8.1e-07 29.7% 0047808 00478081 1/1   p containing nucleoside triphosphate hy 
 326::443  8.4e-07 32.1% 0049606 00496061 1/1   p containing nucleoside triphosphate hy 
 326::454  1.6e-06 25.8% 0049657 00496571 1/1   p containing nucleoside triphosphate hy 
 326::573  2.2e-06 26.0% 0047839 00478391 1/1   p containing nucleoside triphosphate hy 
 325::443  2.6e-06 34.0% 0048689 00486891 1/1   p containing nucleoside triphosphate hy 
 326::408  2.7e-06 35.1% 0049190 00491901 1/1   p containing nucleoside triphosphate hy 
 326::446  4.9e-06 28.3% 0047291 00472911 1/1   p containing nucleoside triphosphate hy 
 326::430    5e-06 31.7% 0045970 00459701 1/1   p containing nucleoside triphosphate hy 
 326::443  7.1e-06 30.2% 0048050 00480501 1/1   p containing nucleoside triphosphate hy 
 326::493  8.7e-06 30.0% 0050194 00501941 1/1   p containing nucleoside triphosphate hy 
 326::454  9.1e-06 29.1% 0047756 00477561 1/1   p containing nucleoside triphosphate hy 
 326::435  9.5e-06 20.8% 0049919 00499191 1/1   p containing nucleoside triphosphate hy 
 324::445  1.8e-05 23.4% 0046258 00462581 1/1   p containing nucleoside triphosphate hy 
 326::443  1.8e-05 31.3% 0047073 00470731 1/1   p containing nucleoside triphosphate hy 
 326::407  1.8e-05 38.5% 0053315 00533151 1/1   p containing nucleoside triphosphate hy 
 326::452    2e-05 32.4% 0049398 00493981 1/1   p containing nucleoside triphosphate hy 
 326::680  2.5e-05 25.9% 0040237 00402371 1/1   p containing nucleoside triphosphate hy 
 326::475  3.8e-05 27.1% 0047420 00474201 1/1   p containing nucleoside triphosphate hy 
 326::475    5e-05 21.4% 0052726 00527261 1/1   p containing nucleoside triphosphate hy 
 326::407  5.8e-05 27.2% 0048706 00487061 1/1   p containing nucleoside triphosphate hy 
 326::443  6.1e-05 23.9% 0053247 00532471 1/1   p containing nucleoside triphosphate hy 
 326::448  7.5e-05 33.3% 0051535 00515351 1/1   p containing nucleoside triphosphate hy 
 326::407  8.3e-05 35.9% 0049306 00493061 1/1   p containing nucleoside triphosphate hy 
 326::351  8.7e-05 50.0% 0047772 00477721 1/1   p containing nucleoside triphosphate hy 
 326::481  8.9e-05 24.6% 0046276 00462761 1/1   p containing nucleoside triphosphate hy 
 326::408  9.4e-05 36.1% 0047813 00478131 1/1   p containing nucleoside triphosphate hy 
 326::351   0.0001 53.8% 0048692 00486921 1/1   p containing nucleoside triphosphate hy 
 326::351  0.00012 53.8% 0046459 00464591 1/1   p containing nucleoside triphosphate hy 
 326::438  0.00012 33.9% 0050867 00508671 1/1   p containing nucleoside triphosphate hy 
 302::445  0.00013 26.5% 0049757 00497571 1/1   p containing nucleoside triphosphate hy 
 326::350  0.00013 64.0% 0048044 00480441 1/1   p containing nucleoside triphosphate hy 
 326::448  0.00013 32.2% 0049933 00499331 1/1   p containing nucleoside triphosphate hy 
 325::453  0.00016 22.5% 0048410 00484101 1/1   p containing nucleoside triphosphate hy 
 326::408  0.00016 33.8% 0051206 00512061 1/1   p containing nucleoside triphosphate hy 
 326::506  0.00017 25.3% 0049491 00494911 1/1   p containing nucleoside triphosphate hy 
 326::350  0.00023 48.0% 0047538 00475381 1/1   p containing nucleoside triphosphate hy 
 326::350  0.00023 44.0% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
 325::351  0.00024 55.6% 0049317 00493171 1/1   p containing nucleoside triphosphate hy 
 326::443  0.00027 29.6% 0046916 00469161 1/1   p containing nucleoside triphosphate hy 
 326::351  0.00033 53.8% 0046162 00461621 1/1   p containing nucleoside triphosphate hy 
 326::443  0.00033 35.1% 0048939 00489391 1/1   p containing nucleoside triphosphate hy 
 326::350  0.00057 56.0% 0049343 00493431 1/1   p containing nucleoside triphosphate hy 
 326::409  0.00058 34.6% 0048963 00489631 1/1   p containing nucleoside triphosphate hy 
 325::351  0.00063 61.5% 0050316 00503161 1/1   p containing nucleoside triphosphate hy 
 326::351  0.00069 53.8% 0051580 00515801 1/1   p containing nucleoside triphosphate hy 
 326::349  0.00076 58.3% 0048702 00487021 1/1   p containing nucleoside triphosphate hy 
 326::351  0.00093 50.0% 0051851 00518511 1/1   p containing nucleoside triphosphate hy 
 326::454  0.00095 25.6% 0045785 00457851 1/1   p containing nucleoside triphosphate hy 
 326::349  0.00096 45.8% 0053350 00533501 1/1   p containing nucleoside triphosphate hy 
   1::1060


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKTLSYTDALRILGGEDGSSLGELGEALTKGTLSALGVPDVLGLHDRLIRHGQNAITGIREKLTGVSRW
00516041   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00486891   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00459701   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00493061   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00486921   1/1  ----------------------------------------------------------------------
00464591   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00503161   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           DRTERVAAADLILRITAFFNALAELLEQHHCPFTLRDLRFTRNEQYRLFSDVLRGIEQDTPTLPPASGGP
00516041   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00486891   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00459701   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00493061   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00486921   1/1  ----------------------------------------------------------------------
00464591   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00503161   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ELATPYRKAAGVLLLFLRGLEVWDRLDDAERTRVTETLEELPSRACRRHIELYRKLAADVPEFGVWANFS
00516041   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00486891   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00459701   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00493061   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00486921   1/1  ----------------------------------------------------------------------
00464591   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00503161   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           AHEKTQEQITEISTGLDELAQILQKLTTSRSRRRLTELENLYQAILDKPILDASEAPNGVVLPSVRDAYL
00516041   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00486891   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00459701   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00493061   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00486921   1/1  ----------------------------------------------------------------------
00464591   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00503161   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           DLGGLLRFTDENATPSSEAWWHEATRYDNLQPLLASLLTQRECLLRPIVLLGHPGAGKSQLTRMLAARLP
00516041   1/1  ---------------------------------------------mlkgklillvGppGsGKtTlarala
00394721   1/1  ---------------------------------------------rnvlLvGppGvGKTtlakalakela
00503741   1/1  -----------------------------------------------vllvGppGvGKTtLakllagllk
00478081   1/1  ---------------------------------------------gkvivltGppGsGKtTlarlLaell
00496061   1/1  ---------------------------------------------gklivltGppGsGKtTlaklLaerl
00496571   1/1  ---------------------------------------------GkgelivllGpsGsGKsTlarlLag
00478391   1/1  ---------------------------------------------msikkgklilltGppGsGKtTlara
00486891   1/1  --------------------------------------------m.livltGppGsGKtTlakaLaerl.
00491901   1/1  ---------------------------------------------lmkgkiilltGppGsGKttlakaLa
00472911   1/1  ---------------------------------------------mkmkkgklilltGppGsGKtTlara
00459701   1/1  ---------------------------------------------MpkvillvGppGsGKTTlakaLakr
00480501   1/1  ---------------------------------------------klillvGppGsGKtTlaralaellg
00501941   1/1  ---------------------------------------------klilltGppGsGKttlaralaeel.
00477561   1/1  ---------------------------------------------kkpkvillvGppGsGKtTlaraLak
00499191   1/1  ---------------------------------------------kgkiigitGpsGsGKsTlaklLael
00462581   1/1  -------------------------------------------edleslllnplvkfedivpkvlddlee
00470731   1/1  ---------------------------------------------arpltfddvvgqdeakeeleellag
00533151   1/1  ---------------------------------------------MsldikkgklivltGppGsGKtTla
00493981   1/1  ---------------------------------------------kpklilltGppGsGKttlaraLaee
00402371   1/1  ---------------------------------------------rnvllvGppGvGKTtlaralagllv
00474201   1/1  ---------------------------------------------deelelleklslllveklrpvlldd
00527261   1/1  ---------------------------------------------npfilgpkvdledfigreeelkele
00487061   1/1  ---------------------------------------------ldMkkgklIvieGppGsGKtTlaka
00532471   1/1  ---------------------------------------------pGkiIvitGpsGsGKsTlarlLael
00515351   1/1  ---------------------------------------------mngklivltGppGsGKtTlaraLae
00493061   1/1  ---------------------------------------------mlIvltGppGsGKtTlakaLaerl.
00477721   1/1  ---------------------------------------------kpklilltGppGsGKttlaraLaee
00462761   1/1  ---------------------------------------------yygdvtaldgvsltikkgevialvG
00478131   1/1  ---------------------------------------------kgkvivltGppGsGKtTlarlLael
00486921   1/1  ---------------------------------------------mlivltGppGsGKtTlakaLaerlg
00464591   1/1  ---------------------------------------------klivltGppGsGKtTlakaLaerlg
00508671   1/1  ---------------------------------------------hvsllklgeldislsikkgevivlv
00497571   1/1  ---------------------aselvqwlldlgildeseilledlenalalllsligaklvkdllllvlk
00480441   1/1  ---------------------------------------------rlivllGpsGaGKsTlaklLaellp
00499331   1/1  ---------------------------------------------PslslkkgklivltGppGsGKtTla
00484101   1/1  --------------------------------------------kgpvigivGpsGsGKTTllraLagll
00512061   1/1  ---------------------------------------------kkkkgklivltGppGsGKtTlakaL
00494911   1/1  ---------------------------------------------llveklrpvllddlvgqeeakeall
00475381   1/1  ---------------------------------------------mkgeiialtGpsGsGKsTlarlLag
00512891   1/1  ---------------------------------------------evilltGppGvGKTTlakalagelg
00493171   1/1  --------------------------------------------mgklivllGpsGaGKsTlaklLaekl
00469161   1/1  ---------------------------------------------llIvieGppGsGKsTlaklLaerlg
00461621   1/1  ---------------------------------------------mkgmiialtGppGsGKsTlaklLae
00489391   1/1  ---------------------------------------------lsikkgklivltGppGsGKtTlaka
00493431   1/1  ---------------------------------------------kGelivllGpsGaGKsTllkllagl
00489631   1/1  ---------------------------------------------MkgklillvGppGsGKtTlaraLae
00503161   1/1  --------------------------------------------pkgrpivLiGpsgsGKs.ladlladr
00515801   1/1  ---------------------------------------------llIvltGppGsGKtTlaklLaerlg
00487021   1/1  ---------------------------------------------rmkiivltGpsGsGKsTlarlLae-
00518511   1/1  ---------------------------------------------klIvleGpsGsGKsTlaklLaeklg
00457851   1/1  ---------------------------------------------PkgklivltGppGsGKtTlakaLae
00533501   1/1  ---------------------------------------------rgeiialtGpsGsGKsTlaklLae-


                         -         -         -         -         *         -         -:420
query           LGNFLPLRVELRSVPADAPIHTQIDEGISATLHARTSWRDLADEAQDALPVVILDGFDELLQATGVNRSD
00516041   1/1  eel...glpfvvidaddl....lrgeelgriielfdearelvpelallfideidellakgkvvildgtgr
00394721   1/1  agsgpilldgvpvvrldlsellsvsdlvgeleggl..........rglltealalakpsvlflDEidrll
00503741   1/1  pkfgeillfgkvvyvnvselldlkellrlllealglpppyqlsggerlrvalaeallalgkpdllilDEi
00478081   1/1  kplgggvvvidtddlrreairelllgldlleilfeglllsdefrelleealalladg.dvvilDgfgrll
00496061   1/1  glpvistddllreevepggtdlgeifqalllagellfddevlgllrerldelielllagg.vvildgf..
00496571   1/1  ll.ggsvldtgepirgeplgelirglvfqdpllldeltvlenlalgrylhlglilaalaagvgvvldrvg
00478391   1/1  laerl..........glpvidgddllrelvgeggrlgrd.......lfdedrllfrellideidl.....
00486891   1/1  .........glpvidtddllreleidgtplgeeirdlllagellfraevrdllyelllealeaggvvldg
00491901   1/1  eelglpf.idtddllrea....klggelaeliedlfvprellidlikellka.gvvil------------
00472911   1/1  Laellgapf.isgddllrglageggkplgllfedaleagfrqrladlirallakgkvvildgtglsrear
00459701   1/1  lgekgvkvvvidtddlrreaikqliglg.lfdedgegalrrreavakllldallkalkagggdvvilDgt
00480501   1/1  .gvvvidgddlrralvgglidgllilfledeaalselvlevllealegggnpdvvildgt..........
00501941   1/1  .........glpfidaddllrelvgesirelfeaagrlaprellldeidellekggivildgfllt....
00477561   1/1  rlaelgkgvv.vidtddlrralifqdeldlfdedreegfrvpeelvrellkellarllaeggdvvilDgt
00499191   1/1  lgatvgdvdgllvgvvfqddfylllpalevlengaflldlllpdaldrelllelll..alveglvvlldr
00462581   1/1  alealaeaklpppkgvllyGppGtGKTtlaralakel........glpfvrinasdllvgllvgelegrl
00470731   1/1  llgikkpkvillvGppGsGKTTlaralakel........gagfilidgddlrekavg.......eleklg
00533151   1/1  rlLaerlglpf.istddllrelvpggldigevfqdaleaglllfddefrglllerle-------------
00493981   1/1  l......glpf....idaddllrelvgegigllfelaeraeflillideidklleegkvvildgtpllle
00402371   1/1  rssgpilldgvpfvrldasellefgkyvgafegglrqllglaraa..kpgvlflDEidsllgarg.gsgv
00474201   1/1  lvgqeeakeallealragrpghvllvGppGtGKTtlaralanelprslpglpfvrvnasdltd....vgl
00527261   1/1  ealpkivlltGprGsGKTtllkalakel...gkpviyidlselsskgyvdleellrelaeelgellellk
00487061   1/1  Laer.gargldvvviyepvdywaavgggdllrlirelllrlgfgepdafdnellgel-------------
00532471   1/1  lnglggivsvddlgrdvgelggaalldivde.grliglvfqdldllpllevlellaarleellerippal
00515351   1/1  rl......glpvistddllreavpggtdigelfqdyllfpfltvdenirglllealeellaagkvvildg
00493061   1/1  ..glpvistddllreavpggtelgeyirdlfdeggllllaevrelllevleealaag-------------
00477721   1/1  l---------------------------------------------------------------------
00462761   1/1  psGsGKsTlaraLagllpeepgsgvvlldgddlr.lglliglvfqdpdllpfl...........tvlenv
00478131   1/1  lkplglgvvvidgddlrreavgqlglglsieeldealllpdalrralleealealkag------------
00486921   1/1  l---------------------------------------------------------------------
00464591   1/1  l---------------------------------------------------------------------
00508671   1/1  GpsGsGKsTlaraLakrLeepgsgvvlldgddlraglsiglilsdedraalrrrlgevfqelllagrlvv
00497571   1/1  ylpsllslldvlrpkvdfddiileeakeelllellelplklpelfkrlglkapkrrgvlLyGppGtGKTl
00480441   1/1  ----------------------------------------------------------------------
00499331   1/1  kaLaerl...glpfidtddllrepvigagtdigevfqdlll..aggllvddevrrlllealdelllaggk
00484101   1/1  kprggrvavigldigrldldellgigylfqdvgllpvltvrenlalllrglpgysaeeleralellelag
00512061   1/1  aerlggl.vvidtddllrea........gkirelfgflgelvfralelgllldeiekl------------
00494911   1/1  ealaagrpghvllvGppGtGKTtlaralanellrlgvlglpfvrvnasellealllsdlfgellgallra
00475381   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00493171   1/1  g---------------------------------------------------------------------
00469161   1/1  ...ltglsvlltredgfgtplgelirelllegfqdlilvpdllvlellaanraglrelikellaagkgvi
00461621   1/1  r---------------------------------------------------------------------
00489391   1/1  Laerl..........glpvistddllreavpggtdlgelfqdlllegellfideiaelllealaeaegkv
00493431   1/1  ----------------------------------------------------------------------
00489631   1/1  llglpfiridgddllrellgellgrgigfgfqqgdlledatvlenlalllldeidkale-----------
00503161   1/1  l---------------------------------------------------------------------
00515801   1/1  l---------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00518511   1/1  l---------------------------------------------------------------------
00457851   1/1  rlglpvistddllreavpggtrlgeviqdlfllggllffdeldellkerieellaag.gvild.......
00533501   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           YLEQVQRFQEHQADLGRPVAVIVTSRTVVAERTRFPFGIPVIRLEPFTDAQIAHLTDVWNRANTAALAER
00516041   1/1  lleldealellgpdlvifldapp-----------------------------------------------
00394721   1/1  dardsesslevlnaLlrlledg.....nvlviattnrpellgrleldpallrrfdv.-------------
00503741   1/1  tnlldpetl.spdvlelLlrlleegkltdkllgltliltthdldllerladrllsrfngkgivielppls
00478081   1/1  darqlleelllllleepppdlvifld--------------------------------------------
00496061   1/1  .........pldlegalllreal-----------------------------------------------
00496571   1/1  lsdlaygfprtlsglgqrqrvalarallkpdlvi------------------------------------
00478391   1/1  ......................................................................
00486891   1/1  f...........pldleqaellr-----------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00472911   1/1  eellellkelgpvlvifldadpevll--------------------------------------------
00459701   1/1  altleqreal------------------------------------------------------------
00480501   1/1  .nlleedrellrellkrlgrpdl-----------------------------------------------
00501941   1/1  .............lrellpepd.lvvfldaslevlleRllkRggrfderiepledleerleilealykee
00477561   1/1  ..nl.........tleqrealrrllkelgrpdlv------------------------------------
00499191   1/1  yprllsggqrqrvai-------------------------------------------------------
00462581   1/1  rglfteav......lanpgvlflDE---------------------------------------------
00470731   1/1  rdlfqvaregglvpdilfideid-----------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00493981   1/1  a....lrellreld...........lvvflda--------------------------------------
00402371   1/1  dpevqnaLlrlleeg..nvrviaatn............................................
00474201   1/1  leellgkllgaat.......fllakpgvlflDEidkl.......dpdvqnaLlrl---------------
00527261   1/1  kllkklsellglsilglelilglsggdleelleelaellkklgkpvililDEiqs---------------
00487061   1/1  ----------------------------------------------------------------------
00532471   1/1  sggqgqrvildrslysrpavlll-----------------------------------------------
00515351   1/1  lsggllqrvallrallrpdlvifldapl------------------------------------------
00493061   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00462761   1/1  llpllaaglivivdgtlllvglrealrkll............gllsgGqkqrvadlvvlld---------
00478131   1/1  ----------------------------------------------------------------------
00486921   1/1  ----------------------------------------------------------------------
00464591   1/1  ----------------------------------------------------------------------
00508671   1/1  ldgtalglelrdelrell----------------------------------------------------
00497571   1/1  lakalakelgrlpfirvn.......---------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00499331   1/1  vvildgfpggllqrealrrllprpdlvi------------------------------------------
00484101   1/1  fdvilieGllelalplilelrelsdgqiqrvap-------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00494911   1/1  lfellrgalel.akggvlflDEidrl.......spdvqnaLlrllee...lpsnvrviattnrpelldpa
00475381   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00469161   1/1  ldrfplsrlayqlsggerqrlai-----------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00489391   1/1  vildgtg.ldi..........eq-----------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00503161   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00457851   1/1  ....gfpldlegaealreallragplpdlvifld------------------------------------
00533501   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           GLHPITADSLLRYRDLAEQPLLLFMLLIFDADANALQRETADLGRAGLYEKLLTSFAEREVRKHHPHLYG
00516041   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00503741   1/1  eeellei........lkk----------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00478391   1/1  ..llakgkvvildgtnlsealdealrrllrpdlvifldapleelleRllkrgrhpeseevleerleryep
00486891   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00459701   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00501941   1/1  adl-------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00402371   1/1  ......................................................................
00474201   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00493061   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00486921   1/1  ----------------------------------------------------------------------
00464591   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00494911   1/1  llsRflvielpppsle------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00503161   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           EELAQAVEDELRSLEVVAIAMFARHQQWVSAEQLEADLAALFPGAGVHAEETGLSGHITTSHQVLGRFFF
00516041   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00478391   1/1  llepeaadlvidt---------------------------------------------------------
00486891   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00459701   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00402371   1/1  ..................................................rpelvklgeldpallrRfd.
00474201   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00493061   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00486921   1/1  ----------------------------------------------------------------------
00464591   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00503161   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           VHEARAIQQGDTRSVYEFLHATFGEHLVARAVVNELARLVEDRAYYARRRAPLPENSDFLFYAFTSFAAL
00516041   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00486891   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00459701   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00402371   1/1  vielplpdleerleilklllekllkrlglelsdealealaelsyglpgar--------------------
00474201   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00493061   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00486921   1/1  ----------------------------------------------------------------------
00464591   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00503161   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           AGRAAIVESAAELLAVKAADARERAAYRSLLVDMFREAPYPRPFPKRDYQPFKATITHRLAAYTANLVTL
00516041   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00486891   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00459701   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00493061   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00486921   1/1  ----------------------------------------------------------------------
00464591   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00503161   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           LVLIADEIDLSELFPDSGPPWLPWRELVGTWRSLPGDDWYGLLDTVRMRHLGHWGEDETPRALLCREQRT
00516041   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00486891   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00459701   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00493061   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00486921   1/1  ----------------------------------------------------------------------
00464591   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00503161   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           PVNVGECVGFELRVNASGRLEITNPYRLTVPYPNETSRMLRSVSLLMQGWSARLVLMVGPYLEHGGSTIG
00516041   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00486891   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00459701   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00493061   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00486921   1/1  ----------------------------------------------------------------------
00464591   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00503161   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           TWAMEEAVYSDPDEEEAEDAHLPIPVSWMPSSDILELRLGPCGVPETAASRLFRYQRILEWSLSRGFVLG
00516041   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00486891   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00459701   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00493061   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00486921   1/1  ----------------------------------------------------------------------
00464591   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00503161   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1050
query           RHEWAALRQAGEELAAIQDATTDPVFREVYQNLRVIIEAHLHRVEKVMPKRKLLEPVLETLRPHLNDPSV
00516041   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00486891   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00459701   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00493061   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00486921   1/1  ----------------------------------------------------------------------
00464591   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00503161   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:1120
query           IDRVLDLATS------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00486891   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00459701   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00501941   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00493061   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00486921   1/1  ----------------------------------------------------------------------
00464591   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00503161   1/1  ----------------------------------------------------------------------
00515801   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------