[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ55520.1


[Show Plain Result]

## Summary of Sequence Search
   1::389
   3::231  2.1e-19 22.9% 0050445 00504451 1/1   ase-like                                
 233::377  2.8e-19 28.7% 0049940 00499401 1/1   ase-like                                
   5::233    1e-17 25.3% 0049939 00499391 1/1   ase-like                                
 230::382  3.7e-17 25.6% 0035033 00350332 2/2   ase-like                                
   5::232  7.9e-17 23.5% 0048944 00489441 1/1   ase-like                                
 231::384  3.4e-15 29.6% 0044962 00449622 2/2   ase-like                                
   1::230  6.5e-15 28.0% 0038812 00388121 1/2   ase-like                                
 232::377  1.9e-14 28.9% 0042745 00427452 2/2   ase-like                                
   1::230  2.2e-13 27.3% 0041153 00411531 1/2   ase-like                                
   7::351  3.6e-13 21.9% 0049604 00496041 1/1   ase-like                                
   3::230  7.3e-12 20.9% 0035032 00350321 1/1   ase-like                                
   4::227  2.1e-10 24.8% 0047209 00472091 1/2   ase-like                                
   7::228  3.5e-09 21.8% 0036930 00369301 1/1   ase-like                                
 208::381  1.2e-07 22.1% 0038813 00388132 2/2   ase-like                                
  12::232  8.6e-06 22.0% 0049764 00497641 1/1   ase-like                                
 208::304  6.7e-05 22.0% 0044257 00442572 2/2   ase-like                                
 208::302  8.6e-05 25.3% 0041154 00411541 1/1   ase-like                                
  21::231  0.00032 25.2% 0044256 00442561 1/2   ase-like                                
   2::47        13 27.5% 0042745 00427451 1/2   ase-like                                
 234::281       14 29.2% 0047209 00472092 2/2   ase-like                                
 233::281       15 30.6% 0041153 00411532 2/2   ase-like                                
   2::47        18 30.2% 0044962 00449621 1/2   ase-like                                
 236::281       20 26.1% 0044256 00442562 2/2   ase-like                                
 233::281       42 28.6% 0038812 00388122 2/2   ase-like                                
  13::54        43 28.6% 0044257 00442571 1/2   ase-like                                
  11::52        46 31.0% 0035033 00350331 1/2   ase-like                                
  12::54        91 27.9% 0038813 00388131 1/2   ase-like                                
   1::389


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNITPTAIAGLGMTQLGKVYGRTPAEFAVEAVTRAAADAGLALADIDGLLVNPGVNNDTDLRLQSTLQLR
00504451   1/1  --lllmrdvvivgadrtpfgksprgalamdpaqrlaleaakealedlagldpedvddvivGvvlgaglqg
00499401   1/1  ----------------------------------------------------------------------
00499391   1/1  ----dvvivgaartpigkrrgaladvsasdLaaeaarealeragldpedidlvivGtvlpdglqgpnlar
00350332   2/2  ----------------------------------------------------------------------
00489441   1/1  ----dvvivdaartpigkrrgaladdpaadlaaeaarealeragldpedvddvivGvvlgagqgpniarr
00449622   2/2  ----------------------------------------------------------------------
00388121   1/2  mslllllllmrrvvivgigvylPlgvvtneeladllggssgkilertgigsrrgalvferavdlaaeaar
00427452   2/2  ----------------------------------------------------------------------
00411531   1/2  llllllmrpvaIvgigvylPggvvsneelwellgtsdefiavrtgigerrgaladepavdlaleaareal
00496041   1/1  ------lllelsrdepvaivegmgcrfPglavsleefwelllegrdaiseipavrilllgsylpdryvtn
00350321   1/1  --lllllggfmddvvivgfdrtpfgksprgalamdpaqdlaleaarealedaplslgldpeevddvivGv
00472091   1/2  ---epvgIlgigvylPelvvtneelaellgtsderilartgikerrvalpdedasdlaleAareaLedag
00369301   1/1  ------dlllpslserlalaleeavdlaveAarkaledagldpsdidllivatstgddtpslaalvanll
00388132   2/2  ----------------------------------------------------------------------
00497641   1/1  -----------sleerldialeeavdlaveAarkaLeeagldpsdidllivatstgdatpslaallanll
00442572   2/2  ----------------------------------------------------------------------
00411541   1/1  ----------------------------------------------------------------------
00442561   1/2  --------------------vvIlglgsylPegvvtneeleklldtsdewilartgilerrialkdetts
00427451   1/2  -lkplarivgyavagda...palmglgpvlAirkaleraglspddid-----------------------
00472092   2/2  ----------------------------------------------------------------------
00411532   2/2  ----------------------------------------------------------------------
00449621   1/2  -Glkplarivgyavagda...papmglgpvlAirkalkraglspddi-----------------------
00442562   2/2  ----------------------------------------------------------------------
00388122   2/2  ----------------------------------------------------------------------
00442571   1/2  ------------lvalgrdvpklaltalveairealekagltpddidlfvlhqa----------------
00350331   1/2  ----------rglkplarivgyavagddpalmglgpvlAirkalekaglspd------------------
00388131   1/2  -----------glamdgrevpapavealaeairkalekagltpddidyvelhqa----------------


                         -         -         *         -         -         -         -:140
query           DLRLLTTIQGFGSSAIQMVQYASMAISAGMANVVACVYADAPLKEGRGSGAAYAGGNRPLTGVEALPAAA
00504451   1/1  ynlarraalllglpvsgpaltvdtaCsSglvAvhlAaqairsGeadvalagGvesmsrpplllg......
00499401   1/1  ----------------------------------------------------------------------
00499391   1/1  laalalglplgvpaftvnraCsSglvAlhlAaqairsGeadvvlagGvesmsrvpllldralfgdgagav
00350332   2/2  ----------------------------------------------------------------------
00489441   1/1  valalglpvggpaftvnraCaSglqAialAaqairsGeadvvlagGvesmsrapllldr..rtgalfgdg
00449622   2/2  ----------------------------------------------------------------------
00388121   1/2  ealedagldpedidgvivgtatggilgpslaaavalrlglp.gvpavtvstaCasglaalplAadlirsg
00427452   2/2  ----------------------------------------------------------------------
00411531   1/2  edagldpedidgvivgtvtgdyalpslaarvalllglpg.vpafdvdtaCasglaalalAadlirsgead
00496041   1/1  ggllddvdefdaartgispreaalmdeaqrlaleaarealedagldpedidgvivgtvtgallpslaarv
00350321   1/1  vlgaglggniarraallaglpvsgpaltvntaCsSglvAihlAaqairaGeadvalAgGvesmsraplll
00472091   1/2  ldpddidlvivgtvtgdyllpslaarvaallglrg.apafdvnaaCasglaALalAaqlirsgladraLv
00369301   1/1  glrgdvaraflvgagCsgglaaLdlAkdlleagpgarvLVvgaEllsllldfgdrstlsm..........
00388132   2/2  ----------------------------------------------------------------------
00497641   1/1  glrpdvrafdlggmgCsaglaaLrlAkdlleagpgarvLVvaaEllsllldlgdrstldn..........
00442572   2/2  ----------------------------------------------------------------------
00411541   1/1  ----------------------------------------------------------------------
00442561   1/2  dlalaaarealedagldpedidlvivgtvtpdyllpataalvalrlgl..ngpafdvnaaCasglyAlal
00427451   1/2  ----------------------------------------------------------------------
00472092   2/2  ----------------------------------------------------------------------
00411532   2/2  ----------------------------------------------------------------------
00449621   1/2  ----------------------------------------------------------------------
00442562   2/2  ----------------------------------------------------------------------
00388122   2/2  ----------------------------------------------------------------------
00442571   1/2  ----------------------------------------------------------------------
00350331   1/2  ----------------------------------------------------------------------
00388131   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           GLKSAPARYAIAARRHMETYGTTSEQLGAVAVAARAWAAMNPLAQMREPITIDDHQNSRMIADPLRLLDC
00504451   1/1  .....fdalgalsldgrltpllmgltaenvaekygisreeqdafAlkshcrafdapadgffrgegvpvvv
00499401   1/1  ----------------------------------------------------------------------
00499391   1/1  llfdaladglllaeglgdpvlkrlmgataenvaekygisreeqdafavkshrraaaaikaglfkaeivpv
00350332   2/2  ----------------------------------------------------------------------
00489441   1/1  arafdleadglvlgegaglmgltaeelalrygisredqdafalrshiraaaagaagffdgeivpvtvpdg
00449622   2/2  ----------------------------------------------------------------------
00388121   1/2  radvvlvvgaeamslpr.....................................................
00427452   2/2  ----------------------------------------------------------------------
00411531   1/2  vvLvvgvelmsrpr........................................................
00496041   1/1  alllglppngpaftvdtagCssglvAlhlAaqlirsgeadvaLvggvelmsrald...............
00350321   1/1  lgplllvdlsllrals.............pagasrpfgataegvargegigrevldelAlkshqraaaae
00472091   1/2  vgaellslgl............................................................
00369301   1/1  ......................................................................
00388132   2/2  -------------------------------------------------------------------gdg
00497641   1/1  ......................................................................
00442572   2/2  -------------------------------------------------------------------gna
00411541   1/1  -------------------------------------------------------------------gna
00442561   1/2  AaalirsgladvvLvggaealsrll.............................................
00427451   1/2  ----------------------------------------------------------------------
00472092   2/2  ----------------------------------------------------------------------
00411532   2/2  ----------------------------------------------------------------------
00449621   1/2  ----------------------------------------------------------------------
00442562   2/2  ----------------------------------------------------------------------
00388122   2/2  ----------------------------------------------------------------------
00442571   1/2  ----------------------------------------------------------------------
00350331   1/2  ----------------------------------------------------------------------
00388131   1/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           CLVSNGAIAIIVTSAERAADLAQPPVHIWGWGQAHPGYTSYRDSNFGLVSGAAQSGPAALRMAGVTVDEI
00504451   1/1  lkrledaladgddilvrrgtt-------------------------------------------------
00499401   1/1  ----------------------kplarivgyava.......gvdpllmllgpvlAarkaleraglslddi
00499391   1/1  dvpdrkgdvvvahdegirigttl-----------------------------------------------
00350332   2/2  -------------------rglkplarivgyavagd.......dpalmglgpvlAirkalekaglspddi
00489441   1/1  kgqarvirdalaragltledld------------------------------------------------
00449622   2/2  --------------------Glkplarivgyavagda.......papmglgpvlAirkalkraglspddi
00388121   1/2  ....................--------------------------------------------------
00427452   2/2  ---------------------lkplarivgyavagda.......palmglgpvlAirkaleraglspddi
00411531   1/2  ....................--------------------------------------------------
00496041   1/1  .....................................................pegfaslvalsalfgdg
00350321   1/1  dagafgdeivpvivgsgvnv--------------------------------------------------
00472091   1/2  .................-----------------------------------------------------
00369301   1/1  lvgnalfgdGAaAvllsa----------------------------------------------------
00388132   2/2  flfgdGAaavvLesleaaralglrilavivglamdgrevpap......avealaeairkalekagltpdd
00497641   1/1  lvgnalfGdGAaAvvlsadpgl------------------------------------------------
00442572   2/2  slfgdGAaAvllesdegaralglrplarg......llvalgrdvpklaltalveairealekagltpddi
00411541   1/1  slfgDGAaAvvleseedarglgllplatig.....llamlgrdvpklavaalvpairkalekagltlddi
00442561   1/2  .....................-------------------------------------------------
00427451   1/2  ----------------------------------------------------------------------
00472092   2/2  -----------------------epvgIlgigvylPelvvtneelaellgtsderilartgikerrvalp
00411532   2/2  ----------------------llllllmrpvaIvgigvylPggvvsneelwellgtsdefiavrtgige
00449621   1/2  ----------------------------------------------------------------------
00442562   2/2  -------------------------vvIlglgsylPegvvtneeleklldtsdewilartgilerrialk
00388122   2/2  ----------------------mslllllllmrrvvivgigvylPlgvvtneeladllggssgkilertg
00442571   1/2  ----------------------------------------------------------------------
00350331   1/2  ----------------------------------------------------------------------
00388131   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           DIREIYDCFTYTTLLTLEDYGFCAKGEGGEFVASGALAPGGSHPTNTGGGELSSYYMWGMTPLSEAVIQA
00504451   1/1  ----------------------------------------------------------------------
00499401   1/1  dlielneafaaqvlavlealglaedge................kvnvnGGaialGhPlgatGarllvell
00499391   1/1  ----------------------------------------------------------------------
00350332   2/2  dlielheafaaqvlaalealgldle..................kvnvsGgalalGhplgasGarllvell
00489441   1/1  ----------------------------------------------------------------------
00449622   2/2  dlvelheaftaldlaelealglvlg...............gplpvnvsGgaialGhplgasGarllvell
00388121   1/2  ----------------------------------------------------------------------
00427452   2/2  dlvelheaftaqdlaelealgl..................grlpvnvsGgaialGhplgAsGarllvtll
00411531   1/2  ----------------------------------------------------------------------
00496041   1/1  acavfltaadgsvlgegagavvlkslsdalrdgdrilavirgsavngdglgk..gvpapagegqarairk
00350321   1/1  ----------------------------------------------------------------------
00472091   1/2  ----------------------------------------------------------------------
00369301   1/1  ----------------------------------------------------------------------
00388132   2/2  idyvelhqagtrildavekklglppe................kvkvn.......tghplGntgaaslpla
00497641   1/1  ----------------------------------------------------------------------
00442572   2/2  dlfvlhqanaaildavakklglpp----------------------------------------------
00411541   1/1  dlfvlhqagarildavakklgl------------------------------------------------
00442561   1/2  ----------------------------------------------------------------------
00427451   1/2  ----------------------------------------------------------------------
00472092   2/2  d---------------------------------------------------------------------
00411532   2/2  r---------------------------------------------------------------------
00449621   1/2  ----------------------------------------------------------------------
00442562   2/2  d---------------------------------------------------------------------
00388122   2/2  i---------------------------------------------------------------------
00442571   1/2  ----------------------------------------------------------------------
00350331   1/2  ----------------------------------------------------------------------
00388131   1/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           RGQGGQRQVAKNDLIMVSGNGGVLDFHATLIVSPHAKTR-------------------------------
00504451   1/1  ----------------------------------------------------------------------
00499401   1/1  lqLrgrggkrglataciggglgialll-------------------------------------------
00499391   1/1  ----------------------------------------------------------------------
00350332   2/2  lqLrggalglav.......lciggGfgganvv--------------------------------------
00489441   1/1  ----------------------------------------------------------------------
00449622   2/2  lqLrgrggrrgl.......asscggggtgaalil------------------------------------
00388121   1/2  ----------------------------------------------------------------------
00427452   2/2  lalrgrggrralatlcggggqgaalvl-------------------------------------------
00411531   1/2  ----------------------------------------------------------------------
00496041   1/1  a---------------------------------------------------------------------
00350321   1/1  ----------------------------------------------------------------------
00472091   1/2  ----------------------------------------------------------------------
00369301   1/1  ----------------------------------------------------------------------
00388132   2/2  llallregrlkpgdrvlllgfGaGltngalv---------------------------------------
00497641   1/1  ----------------------------------------------------------------------
00442572   2/2  ----------------------------------------------------------------------
00411541   1/1  ----------------------------------------------------------------------
00442561   1/2  ----------------------------------------------------------------------
00427451   1/2  ----------------------------------------------------------------------
00472092   2/2  ----------------------------------------------------------------------
00411532   2/2  ----------------------------------------------------------------------
00449621   1/2  ----------------------------------------------------------------------
00442562   2/2  ----------------------------------------------------------------------
00388122   2/2  ----------------------------------------------------------------------
00442571   1/2  ----------------------------------------------------------------------
00350331   1/2  ----------------------------------------------------------------------
00388131   1/2  ----------------------------------------------------------------------