[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ55524.1


[Show Plain Result]

## Summary of Sequence Search
   1::656
   5::384  9.2e-84 37.9% 0038308 00383081 1/1   inked oxidoreductases                   
   8::378  1.6e-83 35.2% 0042611 00426111 1/1   inked oxidoreductases                   
   9::377  2.3e-83 36.7% 0044803 00448031 1/1   inked oxidoreductases                   
   8::368    9e-82 36.6% 0038429 00384291 1/1   inked oxidoreductases                   
   7::383  1.7e-81 38.2% 0048661 00486611 1/1   inked oxidoreductases                   
   6::377    3e-80 36.2% 0038972 00389721 1/1   inked oxidoreductases                   
   8::347  3.5e-79 37.2% 0042445 00424451 1/1   inked oxidoreductases                   
   4::346  2.7e-76 37.9% 0036457 00364571 1/1   inked oxidoreductases                   
   9::361  4.8e-74 38.9% 0051489 00514891 1/1   inked oxidoreductases                   
  12::344  5.2e-41 30.5% 0046721 00467211 1/1   inked oxidoreductases                   
  25::358  5.1e-36 30.4% 0044760 00447601 1/1   inked oxidoreductases                   
 348::522  2.6e-33 31.8% 0048807 00488071 1/2   otide-binding domain                    
 347::517  1.2e-32 32.2% 0036459 00364591 1/2   otide-binding domain                    
 348::656    7e-32 31.4% 0049150 00491501 1/1   AD(P)-binding domain                    
   3::343  1.4e-30 29.1% 0049708 00497081 1/1   inked oxidoreductases                   
 385::641  2.3e-29 27.4% 0052963 00529631 1/1   AD(P)-binding domain                    
 349::656    3e-29 26.0% 0037441 00374411 1/1   AD(P)-binding domain                    
 387::550  2.5e-28 34.0% 0047141 00471411 1/1   otide-binding domain                    
 391::656  1.3e-27 28.5% 0045870 00458701 1/1   AD(P)-binding domain                    
 392::658  1.5e-27 27.0% 0047022 00470221 1/1   AD(P)-binding domain                    
 390::611  3.4e-27 30.5% 0046156 00461561 1/1   otide-binding domain                    
 390::656  8.4e-26 31.7% 0049990 00499901 1/1   otide-binding domain                    
 391::656  2.3e-25 29.7% 0043577 00435771 1/1   AD(P)-binding domain                    
 359::548  9.1e-25 29.8% 0049222 00492221 1/1   AD(P)-binding domain                    
 388::633  2.9e-24 27.2% 0050363 00503631 1/1   AD(P)-binding domain                    
 389::612  3.2e-24 29.6% 0048016 00480161 1/1   otide-binding domain                    
  14::349  5.3e-23 25.2% 0047140 00471401 1/1   inked oxidoreductases                   
 389::573    8e-23 31.3% 0048583 00485831 1/1   AD(P)-binding domain                    
 385::656    1e-22 25.8% 0046057 00460571 1/1   otide-binding domain                    
 370::656  2.9e-22 25.9% 0046270 00462701 1/1   AD(P)-binding domain                    
 389::572  2.9e-22 30.4% 0047564 00475641 1/1   AD(P)-binding domain                    
 383::656  6.7e-22 26.6% 0036092 00360921 1/1   AD(P)-binding domain                    
 478::637  1.7e-21 32.0% 0046344 00463442 2/2   AD(P)-binding domain                    
 370::656    4e-21 28.2% 0046446 00464461 1/1   AD(P)-binding domain                    
 383::656  5.2e-21 29.5% 0049003 00490031 1/1   AD(P)-binding domain                    
  19::356  2.9e-20 24.6% 0039781 00397811 1/1   ose-phoshate binding barrel             
 367::502  3.8e-20 35.0% 0045519 00455191 1/2   AD(P)-binding domain                    
 388::656  4.4e-20 27.4% 0045797 00457971 1/1   AD(P)-binding domain                    
 383::498  6.7e-20 30.2% 0047909 00479091 1/2   )-binding Rossmann-fold domains         
 389::611  8.7e-20 32.2% 0050364 00503641 1/1   AD(P)-binding domain                    
 389::517    1e-19 37.3% 0048865 00488651 1/2   AD(P)-binding domain                    
 386::635  1.2e-19 23.9% 0048494 00484941 1/1   AD(P)-binding domain                    
 390::644  1.5e-19 24.5% 0046274 00462741 1/1   AD(P)-binding domain                    
 391::527    2e-19 31.9% 0050960 00509601 1/2   AD(P)-binding domain                    
 350::476  3.3e-19 36.8% 0046344 00463441 1/2   AD(P)-binding domain                    
 389::556    8e-19 34.0% 0046750 00467501 1/1   AD(P)-binding domain                    
 370::483  1.3e-18 35.9% 0048045 00480451 1/2   AD(P)-binding domain                    
 392::503  1.3e-18 34.2% 0048607 00486071 1/1   AD(P)-binding domain                    
 392::656  1.4e-18 28.1% 0040035 00400351 1/1   AD(P)-binding domain                    
 366::483  2.4e-18 38.5% 0053322 00533221 1/2   AD(P)-binding domain                    
  14::343  2.8e-18 26.6% 0051899 00518991 1/1   inked oxidoreductases                   
 381::563    3e-18 33.1% 0047068 00470681 1/1   AD(P)-binding domain                    
 367::483  4.3e-18 35.6% 0048009 00480091 1/2   AD(P)-binding domain                    
 387::656  4.5e-18 24.8% 0052926 00529261 1/1   AD(P)-binding domain                    
 393::656  5.5e-18 25.2% 0041341 00413411 1/1   AD(P)-binding domain                    
 388::658  6.9e-18 29.6% 0040602 00406021 1/1   AD(P)-binding domain                    
 371::483    7e-18 35.6% 0038449 00384491 1/2   AD(P)-binding domain                    
 367::481  9.4e-18 36.3% 0036889 00368891 1/2   AD(P)-binding domain                    
  21::351  1.1e-17 23.2% 0036258 00362581 1/1   inked oxidoreductases                   
 369::483  1.8e-17 37.5% 0048200 00482001 1/2   AD(P)-binding domain                    
 388::658  1.8e-17 26.1% 0053321 00533211 1/1   AD(P)-binding domain                    
 389::658  2.1e-17 26.6% 0046834 00468341 1/1   AD(P)-binding domain                    
 387::658  2.4e-17 28.7% 0044098 00440981 1/1   AD(P)-binding domain                    
 377::483  2.5e-17 40.6% 0048866 00488661 1/2   AD(P)-binding domain                    
 389::590  2.8e-17 23.3% 0052313 00523131 1/1   AD(P)-binding domain                    
 385::484  3.9e-17 35.0% 0042446 00424461 1/2   AD(P)-binding domain                    
 390::656    5e-17 27.0% 0048771 00487711 1/1   AD(P)-binding domain                    
 366::482  7.9e-17 32.1% 0036654 00366541 1/2   AD(P)-binding domain                    
 154::344  1.5e-16 30.6% 0039992 00399921 1/1   ose-phoshate binding barrel             
 366::482    2e-16 32.1% 0048365 00483651 1/2   AD(P)-binding domain                    
 386::599  2.2e-16 27.5% 0050148 00501481 1/1   AD(P)-binding domain                    
 376::501  2.5e-16 32.8% 0047270 00472701 1/2   AD(P)-binding domain                    
 386::482  2.6e-16 42.3% 0044705 00447051 1/2   AD(P)-binding domain                    
 367::484  3.5e-16 33.6% 0040619 00406191 1/2   AD(P)-binding domain                    
 388::523  4.2e-16 30.1% 0036300 00363001 1/2   AD(P)-binding domain                    
 388::656  4.4e-16 25.7% 0046514 00465141 1/1   AD(P)-binding domain                    
 389::658  4.8e-16 28.9% 0047712 00477121 1/1   AD(P)-binding domain                    
 367::483  5.1e-16 34.7% 0047271 00472711 1/2   AD(P)-binding domain                    
 388::656  7.2e-16 25.6% 0052032 00520321 1/1   AD(P)-binding domain                    
 380::481  7.8e-16 36.3% 0047565 00475651 1/2   AD(P)-binding domain                    
 366::484  9.1e-16 36.4% 0050961 00509611 1/2   AD(P)-binding domain                    
 393::656  1.1e-15 28.6% 0052600 00526001 1/1   AD(P)-binding domain                    
 380::484  1.3e-15 35.1% 0048584 00485841 1/2   AD(P)-binding domain                    
 348::552  1.8e-15 23.4% 0052911 00529111 1/1   AD(P)-binding domain                    
 390::511  2.2e-15 30.3% 0037643 00376431 1/2   AD(P)-binding domain                    
 388::625  2.7e-15 25.7% 0048356 00483561 1/1   AD(P)-binding domain                    
 373::484  2.9e-15 33.0% 0046761 00467611 1/2   AD(P)-binding domain                    
 124::383  3.7e-15 31.6% 0052917 00529171 1/1   se C-terminal domain-like               
 381::483    5e-15 36.7% 0049679 00496791 1/2   AD(P)-binding domain                    
 365::483  5.8e-15 37.3% 0046972 00469721 1/2   AD(P)-binding domain                    
 345::483  6.1e-15 29.3% 0038468 00384681 1/2   AD(P)-binding domain                    
 370::493  6.8e-15 35.8% 0048199 00481991 1/2   AD(P)-binding domain                    
  23::346  7.6e-15 23.9% 0052481 00524811 1/1   inked oxidoreductases                   
 393::635  9.5e-15 24.8% 0040660 00406601 1/1   AD(P)-binding domain                    
 386::656  1.6e-14 24.8% 0035989 00359891 1/1   AD(P)-binding domain                    
 391::656  1.8e-14 29.7% 0050927 00509271 1/1   AD(P)-binding domain                    
  92::348  2.6e-14 24.5% 0041152 00411521 1/1   ase                                     
   7::343    4e-14 25.4% 0050135 00501351 1/1   inked oxidoreductases                   
 391::614  5.8e-14 22.9% 0045795 00457951 1/1   otide-binding domain                    
 375::485  6.5e-14 38.0% 0048108 00481081 1/2   AD(P)-binding domain                    
 391::657  7.3e-14 26.5% 0046416 00464161 1/1   AD(P)-binding domain                    
 389::510  8.8e-14 32.2% 0038074 00380741 1/2   AD(P)-binding domain                    
 387::539  1.1e-13 25.9% 0046579 00465791 1/1   AD(P)-binding domain                    
 386::493  2.5e-13 33.7% 0045481 00454811 1/2    N-terminal domain                      
 365::483  3.5e-13 33.0% 0046973 00469731 1/2   AD(P)-binding domain                    
 389::656  1.3e-12 27.5% 0047133 00471331 1/1   AD(P)-binding domain                    
 389::658  1.6e-12 27.8% 0040688 00406881 1/1   AD(P)-binding domain                    
 391::657  1.8e-12 29.7% 0048364 00483641 1/1   AD(P)-binding domain                    
 389::483  2.6e-12 36.5% 0036301 00363011 1/2   AD(P)-binding domain                    
   2::339  2.8e-12 23.9% 0048029 00480291 1/1   inked oxidoreductases                   
 366::481  2.8e-12 31.4% 0041940 00419401 1/2   AD(P)-binding domain                    
 392::613  3.5e-12 26.0% 0047327 00473271 1/1   otide-binding domain                    
 366::482  5.1e-12 33.7% 0045798 00457981 1/2   AD(P)-binding domain                    
 377::482    6e-12 35.8% 0038285 00382851 1/2   AD(P)-binding domain                    
 393::656    1e-11 26.8% 0040049 00400491 1/1   AD(P)-binding domain                    
 152::330  1.3e-11 28.6% 0049848 00498481 1/1   ase                                     
 110::390  1.7e-11 26.6% 0047651 00476511 1/1   se C-terminal domain-like               
 384::483    2e-11 34.0% 0036016 00360161 1/2   AD(P)-binding domain                    
 393::655  2.4e-11 25.9% 0045881 00458811 1/1   AD(P)-binding domain                    
 393::614  2.6e-11 30.2% 0046128 00461281 1/1   AD(P)-binding domain                    
 370::658  3.1e-11 24.1% 0039664 00396641 1/1   AD(P)-binding domain                    
 390::483  1.4e-10 31.2% 0044559 00445591 1/2   )-binding Rossmann-fold domains         
 391::487  1.8e-10 31.8% 0046357 00463571 1/1   )-binding Rossmann-fold domains         
 393::644  1.9e-10 25.8% 0047029 00470291 1/1   AD(P)-binding domain                    
 159::344  2.2e-10 29.6% 0051442 00514421 1/1   ose-phoshate binding barrel             
 371::483  3.5e-10 27.4% 0047276 00472761 1/1   )-binding Rossmann-fold domains         
 380::515  4.5e-10 27.3% 0037437 00374371 1/2   )-binding Rossmann-fold domains         
 388::526  6.2e-10 27.0% 0045518 00455181 1/2   AD(P)-binding domain                    
 393::614  8.1e-10 27.0% 0044413 00444131 1/1   AD(P)-binding domain                    
 382::481    1e-09 29.8% 0052964 00529641 1/2   AD(P)-binding domain                    
 121::343  1.1e-09 23.7% 0046599 00465991 1/1   inked oxidoreductases                   
 155::343  1.1e-09 26.2% 0050003 00500031 1/1   inked oxidoreductases                   
 389::504  1.1e-09 37.0% 0042342 00423421 1/1   )-binding Rossmann-fold domains         
 390::483  2.2e-09 32.9% 0047992 00479921 1/1   )-binding Rossmann-fold domains         
 387::507  2.8e-09 22.6% 0050443 00504431 1/1   )-binding Rossmann-fold domains         
 384::491    4e-09 34.4% 0042534 00425341 1/1   )-binding Rossmann-fold domains         
 153::345  8.8e-09 25.8% 0051164 00511641 1/1   ose-phoshate binding barrel             
 386::550  1.2e-08 24.5% 0042340 00423401 1/1   )-binding Rossmann-fold domains         
 149::342  1.4e-08 27.8% 0051598 00515981 1/1   ose-phoshate binding barrel             
 390::634  2.3e-08 25.6% 0047682 00476821 1/1   AD(P)-binding domain                    
 372::483  6.5e-08 27.7% 0047278 00472781 1/1   )-binding Rossmann-fold domains         
 155::339  7.5e-08 28.7% 0047026 00470261 1/1   inked oxidoreductases                   
 154::356    8e-08 26.3% 0049629 00496291 1/1   ose-phoshate binding barrel             
 383::493    1e-07 30.6% 0048687 00486871 1/1    N-terminal domain                      
 391::430  1.1e-07 37.5% 0048227 00482271 1/1   )-binding Rossmann-fold domains         
 372::611  1.6e-07 25.5% 0053383 00533831 1/1   )-binding Rossmann-fold domains         
 103::327  2.7e-07 22.6% 0051737 00517371 1/1   s)glycosidases                          
 391::484  2.7e-07 39.2% 0048102 00481021 1/1   )-binding Rossmann-fold domains         
 485::611  2.7e-07 29.1% 0042446 00424462 2/2   AD(P)-binding domain                    
 372::483  6.7e-07 24.5% 0053172 00531721 1/1   )-binding Rossmann-fold domains         
  84::349  7.5e-07 23.3% 0045046 00450461 1/1   in phosphate synthase                   
 368::527    2e-06 22.1% 0048035 00480351 1/1   )-binding Rossmann-fold domains         
 348::483  2.7e-06 24.8% 0047510 00475101 1/1   )-binding Rossmann-fold domains         
 389::484  3.3e-06 40.5% 0036785 00367851 1/1   )-binding Rossmann-fold domains         
 391::545  4.3e-06 30.5% 0035535 00355351 1/1   )-binding Rossmann-fold domains         
 156::342  4.6e-06 23.8% 0052610 00526101 1/1   inked oxidoreductases                   
 391::483  1.4e-05 29.0% 0047032 00470321 1/1   )-binding Rossmann-fold domains         
 392::656  1.7e-05 24.3% 0046760 00467601 1/1   AD(P)-binding domain                    
 287::342  1.9e-05 25.0% 0050322 00503221 1/1   ose-phoshate binding barrel             
 387::424  1.9e-05 28.9% 0046673 00466731 1/1   )-binding Rossmann-fold domains         
 484::610  2.1e-05 27.7% 0038285 00382852 2/2   AD(P)-binding domain                    
 486::611  2.1e-05 22.2% 0036016 00360162 2/2   AD(P)-binding domain                    
 388::488  2.2e-05 33.3% 0035477 00354771 1/1   )-binding Rossmann-fold domains         
 391::423  2.5e-05 51.5% 0048186 00481861 1/1   )-binding Rossmann-fold domains         
 200::340    3e-05 28.0% 0049739 00497391 1/1   like                                    
 391::424  3.2e-05 35.3% 0050910 00509101 1/1   )-binding Rossmann-fold domains         
 391::445  3.6e-05 36.4% 0050269 00502691 1/1   )-binding Rossmann-fold domains         
 287::342  4.3e-05 23.2% 0048998 00489981 1/1   ose-phoshate binding barrel             
 388::485  4.3e-05 27.6% 0045621 00456211 1/1   )-binding Rossmann-fold domains         
 128::334  4.4e-05 22.0% 0039482 00394821 1/1   ase                                     
 485::611    5e-05 28.6% 0050961 00509612 2/2   AD(P)-binding domain                    
 484::611  5.4e-05 30.6% 0048866 00488662 2/2   AD(P)-binding domain                    
 391::424  6.8e-05 38.2% 0048755 00487551 1/1   )-binding Rossmann-fold domains         
 235::342  7.1e-05 30.9% 0047125 00471251 1/1   ose-phoshate binding barrel             
 354::451  7.3e-05 25.8% 0035290 00352901 1/1   )-binding Rossmann-fold domains         
 528::656  8.1e-05 24.4% 0036300 00363002 2/2   AD(P)-binding domain                    
 121::333  8.4e-05 21.5% 0047242 00472421 1/1   inked oxidoreductases                   
 391::510  0.00019 27.3% 0036664 00366641 1/1   )-binding Rossmann-fold domains         
 156::339   0.0002 25.0% 0049587 00495871 1/1   inked oxidoreductases                   
 391::533   0.0002 26.7% 0042180 00421801 1/1   )-binding Rossmann-fold domains         
 391::485  0.00023 24.2% 0048585 00485851 1/1   )-binding Rossmann-fold domains         
 281::349  0.00025 25.8% 0047889 00478891 1/1   ose-phoshate binding barrel             
 391::422  0.00029 50.0% 0049730 00497301 1/1   )-binding Rossmann-fold domains         
 390::425  0.00032 38.9% 0051213 00512131 1/1   )-binding Rossmann-fold domains         
 391::540  0.00033 26.1% 0051305 00513051 1/1   )-binding Rossmann-fold domains         
 528::614  0.00036 26.7% 0045519 00455192 2/2   AD(P)-binding domain                    
 129::389  0.00038 24.3% 0048445 00484451 1/1   se C-terminal domain-like               
 391::425  0.00049 34.3% 0040651 00406511 1/1   )-binding Rossmann-fold domains         
 391::547  0.00049 24.8% 0045243 00452431 1/1   )-binding Rossmann-fold domains         
 391::421  0.00053 43.3% 0052329 00523291 1/1   )-binding Rossmann-fold domains         
 391::423  0.00054 51.5% 0038784 00387841 1/1   )-binding Rossmann-fold domains         
 287::347  0.00086 27.1% 0050201 00502011 1/1   inked oxidoreductases                   
 287::342   0.0009 25.5% 0045712 00457121 1/1   ose-phoshate binding barrel             
 391::424  0.00092 32.4% 0051797 00517971 1/1   )-binding Rossmann-fold domains         
 391::459  0.00097 20.3% 0048027 00480271 1/1   )-binding Rossmann-fold domains         
 391::518  0.00097 29.0% 0050228 00502281 1/1   )-binding Rossmann-fold domains         
 528::611    0.001 26.8% 0048009 00480092 2/2   AD(P)-binding domain                    
 528::611   0.0018 28.0% 0048045 00480452 2/2   AD(P)-binding domain                    
 528::611   0.0021 26.8% 0053322 00533222 2/2   AD(P)-binding domain                    
 486::611   0.0022 26.2% 0040619 00406192 2/2   AD(P)-binding domain                    
 528::611   0.0029 22.9% 0038449 00384492 2/2   AD(P)-binding domain                    
 528::610   0.0031 22.5% 0048365 00483652 2/2   AD(P)-binding domain                    
 528::656   0.0034 23.6% 0047270 00472702 2/2   AD(P)-binding domain                    
 528::613   0.0048 26.5% 0048108 00481082 2/2   AD(P)-binding domain                    
 528::609   0.0051 27.2% 0036889 00368892 2/2   AD(P)-binding domain                    
 484::611   0.0063 25.4% 0038468 00384682 2/2   AD(P)-binding domain                    
 485::612   0.0069 28.1% 0048584 00485842 2/2   AD(P)-binding domain                    
 525::657   0.0074 26.0% 0048865 00488652 2/2   AD(P)-binding domain                    
 484::610   0.0088 29.0% 0044705 00447052 2/2   AD(P)-binding domain                    
 528::611    0.017 25.6% 0036301 00363012 2/2   AD(P)-binding domain                    
 528::609    0.018 23.2% 0047565 00475652 2/2   AD(P)-binding domain                    
 528::625    0.018 27.2% 0047909 00479092 2/2   )-binding Rossmann-fold domains         
 528::611    0.019 25.6% 0046972 00469722 2/2   AD(P)-binding domain                    
 528::611    0.039 23.8% 0048200 00482002 2/2   AD(P)-binding domain                    
 528::611    0.039 24.4% 0049679 00496792 2/2   AD(P)-binding domain                    
 528::656    0.053 25.6% 0048199 00481992 2/2   AD(P)-binding domain                    
 528::610    0.054 21.7% 0036654 00366542 2/2   AD(P)-binding domain                    
 486::611    0.059 26.2% 0047271 00472712 2/2   AD(P)-binding domain                    
 485::609    0.063 24.2% 0052964 00529642 2/2   AD(P)-binding domain                    
 528::617    0.064 25.6% 0036459 00364592 2/2   otide-binding domain                    
 528::610    0.097 23.2% 0045798 00457982 2/2   AD(P)-binding domain                    
 528::656      0.1 24.0% 0038074 00380742 2/2   AD(P)-binding domain                    
 528::611     0.13 25.3% 0046973 00469732 2/2   AD(P)-binding domain                    
 528::658     0.15 18.7% 0050960 00509602 2/2   AD(P)-binding domain                    
 528::658     0.19 24.8% 0037643 00376432 2/2   AD(P)-binding domain                    
 528::609     0.21 22.0% 0041940 00419402 2/2   AD(P)-binding domain                    
 528::612        1 23.8% 0046761 00467612 2/2   AD(P)-binding domain                    
 528::657      1.1 22.8% 0048807 00488072 2/2   otide-binding domain                    
 528::615      1.7 31.5% 0037437 00374372 2/2   )-binding Rossmann-fold domains         
 528::631      6.4 22.4% 0045481 00454812 2/2    N-terminal domain                      
 528::611       14 23.4% 0044559 00445592 2/2   )-binding Rossmann-fold domains         
 528::656       21 22.8% 0045518 00455182 2/2   AD(P)-binding domain                    
   1::656


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKPRETTQFTHLFTPIRVGRMDLPNRIMATPHATPIGNLWSPDEAEADRNIAYWAARARAGLAWVGGISA
00383081   1/1  ----lslkmskLfePlklggltlknRivmaPmtryra....edgvptdlllryyaqragagliiteatav
00426111   1/1  -------kmskLfePlklggltlknRivmaPmtryra....edgvptdllleyyaqrAkgggliiteat.
00448031   1/1  --------mskLfePlklggltlkNRivmaPmtryla....edgvptdllleyyaqrAkgggliiteata
00384291   1/1  -------kmskLfePlklggltLknRvvmaPmtrylatl..ddgvptdlalryyaqragagliiteata.
00486611   1/1  ------sllldllllsmsmskLfePlklggltlkNRivmaPmtryral..dedgvptldlllayyaqrAk
00389721   1/1  -----llklskLfePlklggltlknRivmaPmtryra....edgvptdllleyyaqrAkgggliiteat.
00424451   1/1  -------kmsrLfeplklggltlknRivmaPmtryla....ddgvptdlllayyaqrakggagliiteat
00364571   1/1  ---letlslskLfePlklggltLknRivmaPmtryr......dgvptdllleyyalralggagliiteat
00514891   1/1  --------lslLfeplklggltlkNRivmaPmtryla..ldedgvptdlllayyaqrAkggaGliiteat
00467211   1/1  -----------alrrllrpllfylddevtlrlnllafddilllprvlpdvsldvdlsttllgltlknPlv
00447601   1/1  ------------------------nrlvlAPMvgv...........tdlpfrlllarlgaglvytemvta
00488071   1/2  ----------------------------------------------------------------------
00364591   1/2  ----------------------------------------------------------------------
00491501   1/1  ----------------------------------------------------------------------
00497081   1/1  --lnlldlralalrrllrpllfyldgetahrltlaflrigllprvlv.vsdvdlstellglklknPfgla
00529631   1/1  ----------------------------------------------------------------------
00374411   1/1  ----------------------------------------------------------------------
00471411   1/1  ----------------------------------------------------------------------
00458701   1/1  ----------------------------------------------------------------------
00470221   1/1  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00499901   1/1  ----------------------------------------------------------------------
00435771   1/1  ----------------------------------------------------------------------
00492221   1/1  ----------------------------------------------------------------------
00503631   1/1  ----------------------------------------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00471401   1/1  -------------LstellgltlknPlvlApmadv...........tdlelrraaarggaglvvtemvta
00485831   1/1  ----------------------------------------------------------------------
00460571   1/1  ----------------------------------------------------------------------
00462701   1/1  ----------------------------------------------------------------------
00475641   1/1  ----------------------------------------------------------------------
00360921   1/1  ----------------------------------------------------------------------
00463442   2/2  ----------------------------------------------------------------------
00464461   1/1  ----------------------------------------------------------------------
00490031   1/1  ----------------------------------------------------------------------
00397811   1/1  ------------------gllglelpiriaPmldvtdglvvrllqgkygaalvykemvfsdllllgdp..
00455191   1/2  ----------------------------------------------------------------------
00457971   1/1  ----------------------------------------------------------------------
00479091   1/2  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------
00488651   1/2  ----------------------------------------------------------------------
00484941   1/1  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00509601   1/2  ----------------------------------------------------------------------
00463441   1/2  ----------------------------------------------------------------------
00467501   1/1  ----------------------------------------------------------------------
00480451   1/2  ----------------------------------------------------------------------
00486071   1/1  ----------------------------------------------------------------------
00400351   1/1  ----------------------------------------------------------------------
00533221   1/2  ----------------------------------------------------------------------
00518991   1/1  -------------DlstellglklknPiglApm.gv.........skdaeaiaalaagglGiielgtvtl
00470681   1/1  ----------------------------------------------------------------------
00480091   1/2  ----------------------------------------------------------------------
00529261   1/1  ----------------------------------------------------------------------
00413411   1/1  ----------------------------------------------------------------------
00406021   1/1  ----------------------------------------------------------------------
00384491   1/2  ----------------------------------------------------------------------
00368891   1/2  ----------------------------------------------------------------------
00362581   1/1  --------------------merlaelmlpkrlipyllvgldrevthrlnlkaldrvalipevtagdpdl
00482001   1/2  ----------------------------------------------------------------------
00533211   1/1  ----------------------------------------------------------------------
00468341   1/1  ----------------------------------------------------------------------
00440981   1/1  ----------------------------------------------------------------------
00488661   1/2  ----------------------------------------------------------------------
00523131   1/1  ----------------------------------------------------------------------
00424461   1/2  ----------------------------------------------------------------------
00487711   1/1  ----------------------------------------------------------------------
00366541   1/2  ----------------------------------------------------------------------
00399921   1/1  ----------------------------------------------------------------------
00483651   1/2  ----------------------------------------------------------------------
00501481   1/1  ----------------------------------------------------------------------
00472701   1/2  ----------------------------------------------------------------------
00447051   1/2  ----------------------------------------------------------------------
00406191   1/2  ----------------------------------------------------------------------
00363001   1/2  ----------------------------------------------------------------------
00465141   1/1  ----------------------------------------------------------------------
00477121   1/1  ----------------------------------------------------------------------
00472711   1/2  ----------------------------------------------------------------------
00520321   1/1  ----------------------------------------------------------------------
00475651   1/2  ----------------------------------------------------------------------
00509611   1/2  ----------------------------------------------------------------------
00526001   1/1  ----------------------------------------------------------------------
00485841   1/2  ----------------------------------------------------------------------
00529111   1/1  ----------------------------------------------------------------------
00376431   1/2  ----------------------------------------------------------------------
00483561   1/1  ----------------------------------------------------------------------
00467611   1/2  ----------------------------------------------------------------------
00529171   1/1  ----------------------------------------------------------------------
00496791   1/2  ----------------------------------------------------------------------
00469721   1/2  ----------------------------------------------------------------------
00384681   1/2  ----------------------------------------------------------------------
00481991   1/2  ----------------------------------------------------------------------
00524811   1/1  ----------------------lLsttllglklknPlg..laaglvdkdaeailalaalgfgiielgtvt
00406601   1/1  ----------------------------------------------------------------------
00359891   1/1  ----------------------------------------------------------------------
00509271   1/1  ----------------------------------------------------------------------
00411521   1/1  ----------------------------------------------------------------------
00501351   1/1  ------rnllafddvllvprvlpevdvsdvdlsttllgltlknPliiapm.....gggtlsapagnpala
00457951   1/1  ----------------------------------------------------------------------
00481081   1/2  ----------------------------------------------------------------------
00464161   1/1  ----------------------------------------------------------------------
00380741   1/2  ----------------------------------------------------------------------
00465791   1/1  ----------------------------------------------------------------------
00454811   1/2  ----------------------------------------------------------------------
00469731   1/2  ----------------------------------------------------------------------
00471331   1/1  ----------------------------------------------------------------------
00406881   1/1  ----------------------------------------------------------------------
00483641   1/1  ----------------------------------------------------------------------
00363011   1/2  ----------------------------------------------------------------------
00480291   1/1  -delllllglrllyllelllpelrqylsladleelafrrlprslfdyldggaddeltlgrnlaafddvll
00419401   1/2  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00457981   1/2  ----------------------------------------------------------------------
00382851   1/2  ----------------------------------------------------------------------
00400491   1/1  ----------------------------------------------------------------------
00498481   1/1  ----------------------------------------------------------------------
00476511   1/1  ----------------------------------------------------------------------
00360161   1/2  ----------------------------------------------------------------------
00458811   1/1  ----------------------------------------------------------------------
00461281   1/1  ----------------------------------------------------------------------
00396641   1/1  ----------------------------------------------------------------------
00445591   1/2  ----------------------------------------------------------------------
00463571   1/1  ----------------------------------------------------------------------
00470291   1/1  ----------------------------------------------------------------------
00514421   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00374371   1/2  ----------------------------------------------------------------------
00455181   1/2  ----------------------------------------------------------------------
00444131   1/1  ----------------------------------------------------------------------
00529641   1/2  ----------------------------------------------------------------------
00465991   1/1  ----------------------------------------------------------------------
00500031   1/1  ----------------------------------------------------------------------
00423421   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00511641   1/1  ----------------------------------------------------------------------
00423401   1/1  ----------------------------------------------------------------------
00515981   1/1  ----------------------------------------------------------------------
00476821   1/1  ----------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00470261   1/1  ----------------------------------------------------------------------
00496291   1/1  ----------------------------------------------------------------------
00486871   1/1  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00517371   1/1  ----------------------------------------------------------------------
00481021   1/1  ----------------------------------------------------------------------
00424462   2/2  ----------------------------------------------------------------------
00531721   1/1  ----------------------------------------------------------------------
00450461   1/1  ----------------------------------------------------------------------
00480351   1/1  ----------------------------------------------------------------------
00475101   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00526101   1/1  ----------------------------------------------------------------------
00470321   1/1  ----------------------------------------------------------------------
00467601   1/1  ----------------------------------------------------------------------
00503221   1/1  ----------------------------------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00382852   2/2  ----------------------------------------------------------------------
00360162   2/2  ----------------------------------------------------------------------
00354771   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00497391   1/1  ----------------------------------------------------------------------
00509101   1/1  ----------------------------------------------------------------------
00502691   1/1  ----------------------------------------------------------------------
00489981   1/1  ----------------------------------------------------------------------
00456211   1/1  ----------------------------------------------------------------------
00394821   1/1  ----------------------------------------------------------------------
00509612   2/2  ----------------------------------------------------------------------
00488662   2/2  ----------------------------------------------------------------------
00487551   1/1  ----------------------------------------------------------------------
00471251   1/1  ----------------------------------------------------------------------
00352901   1/1  ----------------------------------------------------------------------
00363002   2/2  ----------------------------------------------------------------------
00472421   1/1  ----------------------------------------------------------------------
00366641   1/1  ----------------------------------------------------------------------
00495871   1/1  ----------------------------------------------------------------------
00421801   1/1  ----------------------------------------------------------------------
00485851   1/1  ----------------------------------------------------------------------
00478891   1/1  ----------------------------------------------------------------------
00497301   1/1  ----------------------------------------------------------------------
00512131   1/1  ----------------------------------------------------------------------
00513051   1/1  ----------------------------------------------------------------------
00455192   2/2  ----------------------------------------------------------------------
00484451   1/1  ----------------------------------------------------------------------
00406511   1/1  ----------------------------------------------------------------------
00452431   1/1  ----------------------------------------------------------------------
00523291   1/1  ----------------------------------------------------------------------
00387841   1/1  ----------------------------------------------------------------------
00502011   1/1  ----------------------------------------------------------------------
00457121   1/1  ----------------------------------------------------------------------
00517971   1/1  ----------------------------------------------------------------------
00480271   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00480092   2/2  ----------------------------------------------------------------------
00480452   2/2  ----------------------------------------------------------------------
00533222   2/2  ----------------------------------------------------------------------
00406192   2/2  ----------------------------------------------------------------------
00384492   2/2  ----------------------------------------------------------------------
00483652   2/2  ----------------------------------------------------------------------
00472702   2/2  ----------------------------------------------------------------------
00481082   2/2  ----------------------------------------------------------------------
00368892   2/2  ----------------------------------------------------------------------
00384682   2/2  ----------------------------------------------------------------------
00485842   2/2  ----------------------------------------------------------------------
00488652   2/2  ----------------------------------------------------------------------
00447052   2/2  ----------------------------------------------------------------------
00363012   2/2  ----------------------------------------------------------------------
00475652   2/2  ----------------------------------------------------------------------
00479092   2/2  ----------------------------------------------------------------------
00469722   2/2  ----------------------------------------------------------------------
00482002   2/2  ----------------------------------------------------------------------
00496792   2/2  ----------------------------------------------------------------------
00481992   2/2  ----------------------------------------------------------------------
00366542   2/2  ----------------------------------------------------------------------
00472712   2/2  ----------------------------------------------------------------------
00529642   2/2  ----------------------------------------------------------------------
00364592   2/2  ----------------------------------------------------------------------
00457982   2/2  ----------------------------------------------------------------------
00380742   2/2  ----------------------------------------------------------------------
00469732   2/2  ----------------------------------------------------------------------
00509602   2/2  ----------------------------------------------------------------------
00376432   2/2  ----------------------------------------------------------------------
00419402   2/2  ----------------------------------------------------------------------
00467612   2/2  ----------------------------------------------------------------------
00488072   2/2  ----------------------------------------------------------------------
00374372   2/2  ----------------------------------------------------------------------
00454812   2/2  ----------------------------------------------------------------------
00445592   2/2  ----------------------------------------------------------------------
00455182   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ALENHLVPGFEPTGVGAAARGVFRLPYFHDRIRKLTDTLHEAGAYVTAQLIMQGGMPHGPSPTVTAYVAN
00383081   1/1  ..........spegrgypgtlgiwsdeqieglkkltdavhaeggkiflQLahaGrvaspalllgglppva
00426111   1/1  .........avspegrgypgtpgiwsdeqveglkkltdavhaaggkiflQLwhaGrvaspslllggllpv
00448031   1/1  vs..........pegrgypgtpgiwsdeqieglkkltdavhaagakiflQLwhaGrvaspalllggllpv
00384291   1/1  .........vspegrgypgtlgiwsdeqveglkkvtdavhaaggkialQLwhagrvaspsllpggllpva
00486611   1/1  ggagliiteatav..........spegrgypgvpgiwsdeqieglkkvtdavhaagakiflqLwhaGrva
00389721   1/1  .........avspegrgypgtpgiwsdeqieglkklvdavhakgakiflQLwhaGrvaspdllpggllpv
00424451   1/1  avs..........pegrgypgtlglwsdeqieglkkltdavhaeggkifiqLahagrvasgllpvapsai
00364571   1/1  avspegrgttpgtpglwsde.........qieglkklvdavhaagalifiqLwhaGrvaspsllgllpva
00514891   1/1  avsplgrgypgv..........lglwsdeqieglkkltdavhaagaliaiqLwhaGrvallgllpvaPsa
00467211   1/1  lapm.t.............vtdaelaialaalgagl.ivlgtvtveplegnvsprllrlpedeaiinlyg
00447601   1/1  kdllr........................gglkrlllavdeegrplvvqlagsd................
00488071   1/2  ----------------------------------------------------------------------
00364591   1/2  ----------------------------------------------------------------------
00491501   1/1  ----------------------------------------------------------------------
00497081   1/1  pm.gdk...........nlelaralaalgaglvvtgtvtpvpqegnpkprlfrlpedealinlyglnn..
00529631   1/1  ----------------------------------------------------------------------
00374411   1/1  ----------------------------------------------------------------------
00471411   1/1  ----------------------------------------------------------------------
00458701   1/1  ----------------------------------------------------------------------
00470221   1/1  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00499901   1/1  ----------------------------------------------------------------------
00435771   1/1  ----------------------------------------------------------------------
00492221   1/1  ----------------------------------------------------------------------
00503631   1/1  ----------------------------------------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00471401   1/1  eqpqegnpkprlfrlpedevllvaevlglinrmglnnlglealleeiralkdaagdlpvivqlgvgsd..
00485831   1/1  ----------------------------------------------------------------------
00460571   1/1  ----------------------------------------------------------------------
00462701   1/1  ----------------------------------------------------------------------
00475641   1/1  ----------------------------------------------------------------------
00360921   1/1  ----------------------------------------------------------------------
00463442   2/2  ----------------------------------------------------------------------
00464461   1/1  ----------------------------------------------------------------------
00490031   1/1  ----------------------------------------------------------------------
00397811   1/1  .velakayeeaGadalhvldldaafaggvtrgvllelikeiaeavpipvqvgggir..............
00455191   1/2  ----------------------------------------------------------------------
00457971   1/1  ----------------------------------------------------------------------
00479091   1/2  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------
00488651   1/2  ----------------------------------------------------------------------
00484941   1/1  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00509601   1/2  ----------------------------------------------------------------------
00463441   1/2  ----------------------------------------------------------------------
00467501   1/1  ----------------------------------------------------------------------
00480451   1/2  ----------------------------------------------------------------------
00486071   1/1  ----------------------------------------------------------------------
00400351   1/1  ----------------------------------------------------------------------
00533221   1/2  ----------------------------------------------------------------------
00518991   1/1  apqegvtdprvrrlgaglinleglnnrglealllelakaagikglplgvniggsgp..............
00470681   1/1  ----------------------------------------------------------------------
00480091   1/2  ----------------------------------------------------------------------
00529261   1/1  ----------------------------------------------------------------------
00413411   1/1  ----------------------------------------------------------------------
00406021   1/1  ----------------------------------------------------------------------
00384491   1/2  ----------------------------------------------------------------------
00368891   1/2  ----------------------------------------------------------------------
00362581   1/1  sttilglelknPlvlapmaggnaelaaalaagGagaievgtvtpdpqagnpvprlarlralagginrmgl
00482001   1/2  ----------------------------------------------------------------------
00533211   1/1  ----------------------------------------------------------------------
00468341   1/1  ----------------------------------------------------------------------
00440981   1/1  ----------------------------------------------------------------------
00488661   1/2  ----------------------------------------------------------------------
00523131   1/1  ----------------------------------------------------------------------
00424461   1/2  ----------------------------------------------------------------------
00487711   1/1  ----------------------------------------------------------------------
00366541   1/2  ----------------------------------------------------------------------
00399921   1/1  ----------------------------------------------------------------------
00483651   1/2  ----------------------------------------------------------------------
00501481   1/1  ----------------------------------------------------------------------
00472701   1/2  ----------------------------------------------------------------------
00447051   1/2  ----------------------------------------------------------------------
00406191   1/2  ----------------------------------------------------------------------
00363001   1/2  ----------------------------------------------------------------------
00465141   1/1  ----------------------------------------------------------------------
00477121   1/1  ----------------------------------------------------------------------
00472711   1/2  ----------------------------------------------------------------------
00520321   1/1  ----------------------------------------------------------------------
00475651   1/2  ----------------------------------------------------------------------
00509611   1/2  ----------------------------------------------------------------------
00526001   1/1  ----------------------------------------------------------------------
00485841   1/2  ----------------------------------------------------------------------
00529111   1/1  ----------------------------------------------------------------------
00376431   1/2  ----------------------------------------------------------------------
00483561   1/1  ----------------------------------------------------------------------
00467611   1/2  ----------------------------------------------------------------------
00529171   1/1  -----------------------------------------------------Ggkvrdrvpvyat....
00496791   1/2  ----------------------------------------------------------------------
00469721   1/2  ----------------------------------------------------------------------
00384681   1/2  ----------------------------------------------------------------------
00481991   1/2  ----------------------------------------------------------------------
00524811   1/1  la...pmagvtdprlrrlgagllnreglnndgleaalkllrralkagkpglpvgvnlggnr.........
00406601   1/1  ----------------------------------------------------------------------
00359891   1/1  ----------------------------------------------------------------------
00509271   1/1  ----------------------------------------------------------------------
00411521   1/1  ---------------------lldlanlidltllkpdltledieklidealey....gfaavcvnplyvk
00501351   1/1  raaara.Gglgvigsgglgsle......................elaeairrvrd..lapggplgvnlgg
00457951   1/1  ----------------------------------------------------------------------
00481081   1/2  ----------------------------------------------------------------------
00464161   1/1  ----------------------------------------------------------------------
00380741   1/2  ----------------------------------------------------------------------
00465791   1/1  ----------------------------------------------------------------------
00454811   1/2  ----------------------------------------------------------------------
00469731   1/2  ----------------------------------------------------------------------
00471331   1/1  ----------------------------------------------------------------------
00406881   1/1  ----------------------------------------------------------------------
00483641   1/1  ----------------------------------------------------------------------
00363011   1/2  ----------------------------------------------------------------------
00480291   1/1  rprvlvdvddvdlsttilglklknPlvlapmg..fgglsepieaeialaraaaelgggipiilgemgnvs
00419401   1/2  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00457981   1/2  ----------------------------------------------------------------------
00382851   1/2  ----------------------------------------------------------------------
00400491   1/1  ----------------------------------------------------------------------
00498481   1/1  ----------------------------------------------------------------------
00476511   1/1  ---------------------------------------vrdgvpvyatlgg..................
00360161   1/2  ----------------------------------------------------------------------
00458811   1/1  ----------------------------------------------------------------------
00461281   1/1  ----------------------------------------------------------------------
00396641   1/1  ----------------------------------------------------------------------
00445591   1/2  ----------------------------------------------------------------------
00463571   1/1  ----------------------------------------------------------------------
00470291   1/1  ----------------------------------------------------------------------
00514421   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00374371   1/2  ----------------------------------------------------------------------
00455181   1/2  ----------------------------------------------------------------------
00444131   1/1  ----------------------------------------------------------------------
00529641   1/2  ----------------------------------------------------------------------
00465991   1/1  --------------------------------------------------pkdvpllstlilglklknPi
00500031   1/1  ----------------------------------------------------------------------
00423421   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00511641   1/1  ----------------------------------------------------------------------
00423401   1/1  ----------------------------------------------------------------------
00515981   1/1  ----------------------------------------------------------------------
00476821   1/1  ----------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00470261   1/1  ----------------------------------------------------------------------
00496291   1/1  ----------------------------------------------------------------------
00486871   1/1  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00517371   1/1  --------------------------------pfwallpvtwryyyggiplmailelpydvvvydidyfd
00481021   1/1  ----------------------------------------------------------------------
00424462   2/2  ----------------------------------------------------------------------
00531721   1/1  ----------------------------------------------------------------------
00450461   1/1  -------------iimllkriylildvdiedllelaeaaleaGadaiqlrvkdp......spegllelae
00480351   1/1  ----------------------------------------------------------------------
00475101   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00526101   1/1  ----------------------------------------------------------------------
00470321   1/1  ----------------------------------------------------------------------
00467601   1/1  ----------------------------------------------------------------------
00503221   1/1  ----------------------------------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00382852   2/2  ----------------------------------------------------------------------
00360162   2/2  ----------------------------------------------------------------------
00354771   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00497391   1/1  ----------------------------------------------------------------------
00509101   1/1  ----------------------------------------------------------------------
00502691   1/1  ----------------------------------------------------------------------
00489981   1/1  ----------------------------------------------------------------------
00456211   1/1  ----------------------------------------------------------------------
00394821   1/1  ---------------------------------------------------------leeklriakllla
00509612   2/2  ----------------------------------------------------------------------
00488662   2/2  ----------------------------------------------------------------------
00487551   1/1  ----------------------------------------------------------------------
00471251   1/1  ----------------------------------------------------------------------
00352901   1/1  ----------------------------------------------------------------------
00363002   2/2  ----------------------------------------------------------------------
00472421   1/1  --------------------------------------------------dllnladlealakrrlpkra
00366641   1/1  ----------------------------------------------------------------------
00495871   1/1  ----------------------------------------------------------------------
00421801   1/1  ----------------------------------------------------------------------
00485851   1/1  ----------------------------------------------------------------------
00478891   1/1  ----------------------------------------------------------------------
00497301   1/1  ----------------------------------------------------------------------
00512131   1/1  ----------------------------------------------------------------------
00513051   1/1  ----------------------------------------------------------------------
00455192   2/2  ----------------------------------------------------------------------
00484451   1/1  ----------------------------------------------------------kvrdrvpvyatl
00406511   1/1  ----------------------------------------------------------------------
00452431   1/1  ----------------------------------------------------------------------
00523291   1/1  ----------------------------------------------------------------------
00387841   1/1  ----------------------------------------------------------------------
00502011   1/1  ----------------------------------------------------------------------
00457121   1/1  ----------------------------------------------------------------------
00517971   1/1  ----------------------------------------------------------------------
00480271   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00480092   2/2  ----------------------------------------------------------------------
00480452   2/2  ----------------------------------------------------------------------
00533222   2/2  ----------------------------------------------------------------------
00406192   2/2  ----------------------------------------------------------------------
00384492   2/2  ----------------------------------------------------------------------
00483652   2/2  ----------------------------------------------------------------------
00472702   2/2  ----------------------------------------------------------------------
00481082   2/2  ----------------------------------------------------------------------
00368892   2/2  ----------------------------------------------------------------------
00384682   2/2  ----------------------------------------------------------------------
00485842   2/2  ----------------------------------------------------------------------
00488652   2/2  ----------------------------------------------------------------------
00447052   2/2  ----------------------------------------------------------------------
00363012   2/2  ----------------------------------------------------------------------
00475652   2/2  ----------------------------------------------------------------------
00479092   2/2  ----------------------------------------------------------------------
00469722   2/2  ----------------------------------------------------------------------
00482002   2/2  ----------------------------------------------------------------------
00496792   2/2  ----------------------------------------------------------------------
00481992   2/2  ----------------------------------------------------------------------
00366542   2/2  ----------------------------------------------------------------------
00472712   2/2  ----------------------------------------------------------------------
00529642   2/2  ----------------------------------------------------------------------
00364592   2/2  ----------------------------------------------------------------------
00457982   2/2  ----------------------------------------------------------------------
00380742   2/2  ----------------------------------------------------------------------
00469732   2/2  ----------------------------------------------------------------------
00509602   2/2  ----------------------------------------------------------------------
00376432   2/2  ----------------------------------------------------------------------
00419402   2/2  ----------------------------------------------------------------------
00467612   2/2  ----------------------------------------------------------------------
00488072   2/2  ----------------------------------------------------------------------
00374372   2/2  ----------------------------------------------------------------------
00454812   2/2  ----------------------------------------------------------------------
00445592   2/2  ----------------------------------------------------------------------
00455182   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           QVSHALDRDEIAWFINEYAESARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLL
00383081   1/1  PSaipapllllllllllgllallagavpralteeeieeiiedfaeAArraieaGfDgveihgAhgyLldq
00426111   1/1  aPSaiplpgglllllldlgllllvvtpralteeeieeiiedfaqAArrAieaGfDgveihgAhgYLldqF
00448031   1/1  aPsaiplplelllallllllllvpralteeeieeiiedfaqAArraieaGfDgveihgAhgyLldqFlsp
00384291   1/1  PSaipapggvfllllllelalvafvvpraltveeikriiedfaeAArraieaGfdgveihgAhgyLldqF
00486611   1/1  spsllpegglppvaPsakiplpgglllllgllfvvpraltleeieeiiedfaeaArraieaGfdgveiha
00389721   1/1  apsaiplplelllllllllllvvpralteeeikeiiedfaqAArrAieAGfDgveihgAhgYLldqFlsp
00424451   1/1  paplg.lvvpraltleeieeiiedfaeaarraleaGfdgveihgahgyLldqFlsplsnvrtdeyGgsle
00364571   1/1  psaiplplllllvpraltveeiaeiiedfaeaArraieaGfdgveihgahgYLldqFlspltnkrtdeyG
00514891   1/1  ipldl.llevpraltleeigeiiedfaeaAkraieaGfdgvelhgahgyLldqFlspltnvrtdeyGgsl
00467211   1/1  lndpgleellervkaagiki........................pvganlgvdeilplgarvedfaeaar
00447601   1/1  ..............pedlaeaaklaee.gadgidln.........fgcpvskvrrdgyGaallkdpelvl
00488071   1/2  ----------------------------------------------------------------------
00364591   1/2  ----------------------------------------------------------------------
00491501   1/1  ----------------------------------------------------------------------
00497081   1/1  egldallerlkalkallllllleaggplivqiggsglfgsrp..edlaeaaellepladaielnlscPak
00529631   1/1  ----------------------------------------------------------------------
00374411   1/1  ----------------------------------------------------------------------
00471411   1/1  ----------------------------------------------------------------------
00458701   1/1  ----------------------------------------------------------------------
00470221   1/1  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00499901   1/1  ----------------------------------------------------------------------
00435771   1/1  ----------------------------------------------------------------------
00492221   1/1  ----------------------------------------------------------------------
00503631   1/1  ----------------------------------------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00471401   1/1  ...........................pedlaeaarraeeaGadaieln..........lgcPntkvlrg
00485831   1/1  ----------------------------------------------------------------------
00460571   1/1  ----------------------------------------------------------------------
00462701   1/1  ----------------------------------------------------------------------
00475641   1/1  ----------------------------------------------------------------------
00360921   1/1  ----------------------------------------------------------------------
00463442   2/2  ----------------------------------------------------------------------
00464461   1/1  ----------------------------------------------------------------------
00490031   1/1  ----------------------------------------------------------------------
00397811   1/1  .............................sledlaaaiivfleaaiillnaGadaviigsaaltnpdeah
00455191   1/2  ----------------------------------------------------------------------
00457971   1/1  ----------------------------------------------------------------------
00479091   1/2  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------
00488651   1/2  ----------------------------------------------------------------------
00484941   1/1  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00509601   1/2  ----------------------------------------------------------------------
00463441   1/2  ----------------------------------------------------------------------
00467501   1/1  ----------------------------------------------------------------------
00480451   1/2  ----------------------------------------------------------------------
00486071   1/1  ----------------------------------------------------------------------
00400351   1/1  ----------------------------------------------------------------------
00533221   1/2  ----------------------------------------------------------------------
00518991   1/1  ................eelaeaakllvrlleagadaielnigcp..............ntgggaallldp
00470681   1/1  ----------------------------------------------------------------------
00480091   1/2  ----------------------------------------------------------------------
00529261   1/1  ----------------------------------------------------------------------
00413411   1/1  ----------------------------------------------------------------------
00406021   1/1  ----------------------------------------------------------------------
00384491   1/2  ----------------------------------------------------------------------
00368891   1/2  ----------------------------------------------------------------------
00362581   1/1  nnlgldalleelravrlavvkraapdvpvgvnlggnkpa...........................efgv
00482001   1/2  ----------------------------------------------------------------------
00533211   1/1  ----------------------------------------------------------------------
00468341   1/1  ----------------------------------------------------------------------
00440981   1/1  ----------------------------------------------------------------------
00488661   1/2  ----------------------------------------------------------------------
00523131   1/1  ----------------------------------------------------------------------
00424461   1/2  ----------------------------------------------------------------------
00487711   1/1  ----------------------------------------------------------------------
00366541   1/2  ----------------------------------------------------------------------
00399921   1/1  -------------mlakriipaldlkdgrvvrlivglnggdpedpveaakaaeeaGadaielndldpall
00483651   1/2  ----------------------------------------------------------------------
00501481   1/1  ----------------------------------------------------------------------
00472701   1/2  ----------------------------------------------------------------------
00447051   1/2  ----------------------------------------------------------------------
00406191   1/2  ----------------------------------------------------------------------
00363001   1/2  ----------------------------------------------------------------------
00465141   1/1  ----------------------------------------------------------------------
00477121   1/1  ----------------------------------------------------------------------
00472711   1/2  ----------------------------------------------------------------------
00520321   1/1  ----------------------------------------------------------------------
00475651   1/2  ----------------------------------------------------------------------
00509611   1/2  ----------------------------------------------------------------------
00526001   1/1  ----------------------------------------------------------------------
00485841   1/2  ----------------------------------------------------------------------
00529111   1/1  ----------------------------------------------------------------------
00376431   1/2  ----------------------------------------------------------------------
00483561   1/1  ----------------------------------------------------------------------
00467611   1/2  ----------------------------------------------------------------------
00529171   1/1  .............dpeelaeaarraleaGfdavKlkv..gvlllqflspllnlrtdeyggllenrdlrld
00496791   1/2  ----------------------------------------------------------------------
00469721   1/2  ----------------------------------------------------------------------
00384681   1/2  ----------------------------------------------------------------------
00481991   1/2  ----------------------------------------------------------------------
00524811   1/1  .....................pedlaeaarlleeagadailelnlgcp..............ntlggsal
00406601   1/1  ----------------------------------------------------------------------
00359891   1/1  ----------------------------------------------------------------------
00509271   1/1  ----------------------------------------------------------------------
00411521   1/1  lakdllgglkvaavvgfPlGasttedkveeakaaveagadeieinishgnl...................
00501351   1/1  a..............................qdaepgveeaaraaeeagadalelnvdlpqlgsreld..
00457951   1/1  ----------------------------------------------------------------------
00481081   1/2  ----------------------------------------------------------------------
00464161   1/1  ----------------------------------------------------------------------
00380741   1/2  ----------------------------------------------------------------------
00465791   1/1  ----------------------------------------------------------------------
00454811   1/2  ----------------------------------------------------------------------
00469731   1/2  ----------------------------------------------------------------------
00471331   1/1  ----------------------------------------------------------------------
00406881   1/1  ----------------------------------------------------------------------
00483641   1/1  ----------------------------------------------------------------------
00363011   1/2  ----------------------------------------------------------------------
00480291   1/1  lerlaaavsgagglgsfglyalgdlevleellrrakaagikpigvnlgkpgeggalaaikvseagad...
00419401   1/2  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00457981   1/2  ----------------------------------------------------------------------
00382851   1/2  ----------------------------------------------------------------------
00400491   1/1  ----------------------------------------------------------------------
00498481   1/1  -----------gstlevkaeeaeaaveaGadeidlvincgalkag...................dpelvl
00476511   1/1  ............gdpeelaeaaeelldeGftavkikvgap........................dleldl
00360161   1/2  ----------------------------------------------------------------------
00458811   1/1  ----------------------------------------------------------------------
00461281   1/1  ----------------------------------------------------------------------
00396641   1/1  ----------------------------------------------------------------------
00445591   1/2  ----------------------------------------------------------------------
00463571   1/1  ----------------------------------------------------------------------
00470291   1/1  ----------------------------------------------------------------------
00514421   1/1  ------------------peeaeaaleaGadgvvlgaaagyllglellaelvkaakelgpglivlv....
00472761   1/1  ----------------------------------------------------------------------
00374371   1/2  ----------------------------------------------------------------------
00455181   1/2  ----------------------------------------------------------------------
00444131   1/1  ----------------------------------------------------------------------
00529641   1/2  ----------------------------------------------------------------------
00465991   1/1  ilApmadvtdaelaaalalaggggvlgktmtpepqagnpvprarrldeaginrlgfndlgaaaelrrllk
00500031   1/1  --------------vedyvelarrlee.gadaleln.........vssPntpglrelqlglalgllpell
00423421   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00511641   1/1  ------------viidptleevdalleagadvvaldatalp.......................rpelve
00423401   1/1  ----------------------------------------------------------------------
00515981   1/1  --------qgggidpedpaelaraaeeaGadaielndgcpfdsrlldg......................
00476821   1/1  ----------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00470261   1/1  --------------pellaellrraeaagadaivltvglpvlgvrerdlrlgfllppaaggalladlara
00496291   1/1  -------------mlamriiPaldlkdgrvvklvqgkllryagdpvelaklyleagadelhlvdldgall
00486871   1/1  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00517371   1/1  gglgrfppelidelhekGlkviayl......dvgesedsrpdwdglllldnpdwllkrldgWpgsvwldy
00481021   1/1  ----------------------------------------------------------------------
00424462   2/2  ----------------------------------------------------------------------
00531721   1/1  ----------------------------------------------------------------------
00450461   1/1  aikelakkvdvplivndg...velaleagadgvhlgg...............................pd
00480351   1/1  ----------------------------------------------------------------------
00475101   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00526101   1/1  ---------------lkkglivaltlgdpdkedlvelakaleeaGadaieldgsf...............
00470321   1/1  ----------------------------------------------------------------------
00467601   1/1  ----------------------------------------------------------------------
00503221   1/1  ----------------------------------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00382852   2/2  ----------------------------------------------------------------------
00360162   2/2  ----------------------------------------------------------------------
00354771   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00497391   1/1  -----------------------------------------------------------deaavllpdvi
00509101   1/1  ----------------------------------------------------------------------
00502691   1/1  ----------------------------------------------------------------------
00489981   1/1  ----------------------------------------------------------------------
00456211   1/1  ----------------------------------------------------------------------
00394821   1/1  llidhtllgppatseeireliaeaaklvkgfaavcvypgdvglaaellkgagllevkiatvigfplGgsl
00509612   2/2  ----------------------------------------------------------------------
00488662   2/2  ----------------------------------------------------------------------
00487551   1/1  ----------------------------------------------------------------------
00471251   1/1  ----------------------------------------------------------------------
00352901   1/1  ----------------------------------------------------------------------
00363002   2/2  ----------------------------------------------------------------------
00472421   1/1  fdyldggagdevtlrrnrlafddvllvprvlvdvsdvdlsttllglklslPlviapmagvtllhpdgeaa
00366641   1/1  ----------------------------------------------------------------------
00495871   1/1  ---------------gvlaelleraeeagadaivltvd........spllgqrardlrggfllglkvtae
00421801   1/1  ----------------------------------------------------------------------
00485851   1/1  ----------------------------------------------------------------------
00478891   1/1  ----------------------------------------------------------------------
00497301   1/1  ----------------------------------------------------------------------
00512131   1/1  ----------------------------------------------------------------------
00513051   1/1  ----------------------------------------------------------------------
00455192   2/2  ----------------------------------------------------------------------
00484451   1/1  gg..........gdpeelaelaeealeaagfraiKlkvgapd........................leld
00406511   1/1  ----------------------------------------------------------------------
00452431   1/1  ----------------------------------------------------------------------
00523291   1/1  ----------------------------------------------------------------------
00387841   1/1  ----------------------------------------------------------------------
00502011   1/1  ----------------------------------------------------------------------
00457121   1/1  ----------------------------------------------------------------------
00517971   1/1  ----------------------------------------------------------------------
00480271   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00480092   2/2  ----------------------------------------------------------------------
00480452   2/2  ----------------------------------------------------------------------
00533222   2/2  ----------------------------------------------------------------------
00406192   2/2  ----------------------------------------------------------------------
00384492   2/2  ----------------------------------------------------------------------
00483652   2/2  ----------------------------------------------------------------------
00472702   2/2  ----------------------------------------------------------------------
00481082   2/2  ----------------------------------------------------------------------
00368892   2/2  ----------------------------------------------------------------------
00384682   2/2  ----------------------------------------------------------------------
00485842   2/2  ----------------------------------------------------------------------
00488652   2/2  ----------------------------------------------------------------------
00447052   2/2  ----------------------------------------------------------------------
00363012   2/2  ----------------------------------------------------------------------
00475652   2/2  ----------------------------------------------------------------------
00479092   2/2  ----------------------------------------------------------------------
00469722   2/2  ----------------------------------------------------------------------
00482002   2/2  ----------------------------------------------------------------------
00496792   2/2  ----------------------------------------------------------------------
00481992   2/2  ----------------------------------------------------------------------
00366542   2/2  ----------------------------------------------------------------------
00472712   2/2  ----------------------------------------------------------------------
00529642   2/2  ----------------------------------------------------------------------
00364592   2/2  ----------------------------------------------------------------------
00457982   2/2  ----------------------------------------------------------------------
00380742   2/2  ----------------------------------------------------------------------
00469732   2/2  ----------------------------------------------------------------------
00509602   2/2  ----------------------------------------------------------------------
00376432   2/2  ----------------------------------------------------------------------
00419402   2/2  ----------------------------------------------------------------------
00467612   2/2  ----------------------------------------------------------------------
00488072   2/2  ----------------------------------------------------------------------
00374372   2/2  ----------------------------------------------------------------------
00454812   2/2  ----------------------------------------------------------------------
00445592   2/2  ----------------------------------------------------------------------
00455182   2/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           EIIDAIRAEVGPDFTLGVRMNLYEALDGGYDAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSYIQPHYY
00383081   1/1  FlspltnkrtdeyGGslenrarfllevveavraavg.dfpvgvRlspldlveggldsltleealelakal
00426111   1/1  lspltNkRtDeYGGslenRarfllevveavreavg.dfpvgvRlspldlveglldldplelgltleeale
00448031   1/1  ltNkRtDeYGGslenRarfllevveavreavgadfvlgvrlsatdfvegglsltleealelaklleeag.
00384291   1/1  lspltnkrtdeyGgslenrarfllevveavreavg.dfpvgvrlspldlvggmarlgltledavelakal
00486611   1/1  AhgyLldqFlspltNkRtDeYGGslenrarfllevvdavreavgad.pvgvRlspldlveggltledsnp
00389721   1/1  ltNkRtDeYGGslenRaRfllevveavreavg.dfpvgvRlspldlveggldsltleealelakaleelg
00424451   1/1  nrprlllevveavreavgadfivgvRlspddlvgggltleeavelakaleeaG.adyihvsgg.tleglv
00364571   1/1  gslenrarfllevveavraavgadfpvgvRlspddlvegggltledavelakaleeag.ldylhvsggtr
00514891   1/1  enrarfllevveavreavg..fpvgvrlspldlvegglnleeavelakaleeag.vdllhvshg.....r
00467211   1/1  laee.gadaieln.........fssPnlpnlrsdeyggslenrprllleiikavreavgedvpvivKls.
00447601   1/1  eivkavreavpipvtvkirl........gwdledtvelakaleeaG.adaltvhgr.......trsqryt
00488071   1/2  ----------------------------------------------------------------------
00364591   1/2  ----------------------------------------------------------------------
00491501   1/1  ----------------------------------------------------------------------
00497081   1/1  pglggllgaalledfiaaarraveagadiielgiasgylldgfliplanlraleyG....ndpellleli
00529631   1/1  ----------------------------------------------------------------------
00374411   1/1  ----------------------------------------------------------------------
00471411   1/1  ----------------------------------------------------------------------
00458701   1/1  ----------------------------------------------------------------------
00470221   1/1  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00499901   1/1  ----------------------------------------------------------------------
00435771   1/1  ----------------------------------------------------------------------
00492221   1/1  ----------------------------------------------------------------------
00503631   1/1  ----------------------------------------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00471401   1/1  ggaallqdpellleivkavreavgipvivKlrpggd..........dtvelaraaeeaG.adgiivhnrt
00485831   1/1  ----------------------------------------------------------------------
00460571   1/1  ----------------------------------------------------------------------
00462701   1/1  ----------------------------------------------------------------------
00475641   1/1  ----------------------------------------------------------------------
00360921   1/1  ----------------------------------------------------------------------
00463442   2/2  ----------------------------------------------------------------------
00464461   1/1  ----------------------------------------------------------------------
00490031   1/1  ----------------------------------------------------------------------
00397811   1/1  gyllsqfllpllaelakeygaqaivvgidakrgkggaallddpelveaiveavkeavpvpvtvkirggte
00455191   1/2  ----------------------------------------------------------------------
00457971   1/1  ----------------------------------------------------------------------
00479091   1/2  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------
00488651   1/2  ----------------------------------------------------------------------
00484941   1/1  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00509601   1/2  ----------------------------------------------------------------------
00463441   1/2  ----------------------------------------------------------------------
00467501   1/1  ----------------------------------------------------------------------
00480451   1/2  ----------------------------------------------------------------------
00486071   1/1  ----------------------------------------------------------------------
00400351   1/1  ----------------------------------------------------------------------
00533221   1/2  ----------------------------------------------------------------------
00518991   1/1  elllelikalreavgipvivKirp........gidtaedveiakaleeaGladaiivsnrtggtlaadig
00470681   1/1  ----------------------------------------------------------------------
00480091   1/2  ----------------------------------------------------------------------
00529261   1/1  ----------------------------------------------------------------------
00413411   1/1  ----------------------------------------------------------------------
00406021   1/1  ----------------------------------------------------------------------
00384491   1/2  ----------------------------------------------------------------------
00368891   1/2  ----------------------------------------------------------------------
00362581   1/1  ddyelarraleaGadaivlnvsapnl........pglrkdqgggallpdpelvlelikalkeavglpviv
00482001   1/2  ----------------------------------------------------------------------
00533211   1/1  ----------------------------------------------------------------------
00468341   1/1  ----------------------------------------------------------------------
00440981   1/1  ----------------------------------------------------------------------
00488661   1/2  ----------------------------------------------------------------------
00523131   1/1  ----------------------------------------------------------------------
00424461   1/2  ----------------------------------------------------------------------
00487711   1/1  ----------------------------------------------------------------------
00366541   1/2  ----------------------------------------------------------------------
00399921   1/1  gp........................ealleviraireavgipvivgggirspedaralleaGadavivg
00483651   1/2  ----------------------------------------------------------------------
00501481   1/1  ----------------------------------------------------------------------
00472701   1/2  ----------------------------------------------------------------------
00447051   1/2  ----------------------------------------------------------------------
00406191   1/2  ----------------------------------------------------------------------
00363001   1/2  ----------------------------------------------------------------------
00465141   1/1  ----------------------------------------------------------------------
00477121   1/1  ----------------------------------------------------------------------
00472711   1/2  ----------------------------------------------------------------------
00520321   1/1  ----------------------------------------------------------------------
00475651   1/2  ----------------------------------------------------------------------
00509611   1/2  ----------------------------------------------------------------------
00526001   1/1  ----------------------------------------------------------------------
00485841   1/2  ----------------------------------------------------------------------
00529111   1/1  ----------------------------------------------------------------------
00376431   1/2  ----------------------------------------------------------------------
00483561   1/1  ----------------------------------------------------------------------
00467611   1/2  ----------------------------------------------------------------------
00529171   1/1  lervravreavGpdvdlmvDan......gawtleeairlakaleeygllwi...................
00496791   1/2  ----------------------------------------------------------------------
00469721   1/2  ----------------------------------------------------------------------
00384681   1/2  ----------------------------------------------------------------------
00481991   1/2  ----------------------------------------------------------------------
00524811   1/1  lkdpelllelleavkeavdvpvivKis........pgvgiediediakalveaG.adaivvsntthggrq
00406601   1/1  ----------------------------------------------------------------------
00359891   1/1  ----------------------------------------------------------------------
00509271   1/1  ----------------------------------------------------------------------
00411521   1/1  legdlelllelikaikeavg.gvvvkvil.....gtvlldeeeivelaealieaG.aDgi..kvsgGfgg
00501351   1/1  ..............rprlllellealreavg..vpvivKl........vggvltv.edaralleaG.ada
00457951   1/1  ----------------------------------------------------------------------
00481081   1/2  ----------------------------------------------------------------------
00464161   1/1  ----------------------------------------------------------------------
00380741   1/2  ----------------------------------------------------------------------
00465791   1/1  ----------------------------------------------------------------------
00454811   1/2  ----------------------------------------------------------------------
00469731   1/2  ----------------------------------------------------------------------
00471331   1/1  ----------------------------------------------------------------------
00406881   1/1  ----------------------------------------------------------------------
00483641   1/1  ----------------------------------------------------------------------
00363011   1/2  ----------------------------------------------------------------------
00480291   1/1  ............................................aidlnlgaplvdpvvdvgsistlggd
00419401   1/2  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00457981   1/2  ----------------------------------------------------------------------
00382851   1/2  ----------------------------------------------------------------------
00400491   1/1  ----------------------------------------------------------------------
00498481   1/1  elikavreavg.gvpvkvilet.....glltveeiveaaraaveaG.adfiktst............ggg
00476511   1/1  elveavreavgpdiplrvDan......ggwtleeairlakaleeagygllwi..................
00360161   1/2  ----------------------------------------------------------------------
00458811   1/1  ----------------------------------------------------------------------
00461281   1/1  ----------------------------------------------------------------------
00396641   1/1  ----------------------------------------------------------------------
00445591   1/2  ----------------------------------------------------------------------
00463571   1/1  ----------------------------------------------------------------------
00470291   1/1  ----------------------------------------------------------------------
00514421   1/1  ...........................gvltlee....akaaeeaG.adaigvsnigltgtvagvgpp..
00472761   1/1  ----------------------------------------------------------------------
00374371   1/2  ----------------------------------------------------------------------
00455181   1/2  ----------------------------------------------------------------------
00444131   1/1  ----------------------------------------------------------------------
00529641   1/2  ----------------------------------------------------------------------
00465991   1/1  llvksiaevpiivnlvgggireldaedarllleagadave.............lnigcpntpvlgallak
00500031   1/1  levveavkkavglpvivKlapd........lteediaeiaraaeeag.adgiivtNttggrlldlepllg
00423421   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00511641   1/1  elvelvkkaltlgllvladva.............tveeAkraeeaG.adaigv...gvhggtdvtkdggl
00423401   1/1  ----------------------------------------------------------------------
00515981   1/1  sgllpdp.eiikavrkavsvpvivkgrigsdedvelalaagadgvtvgtlagedpeelleaakelglpvi
00476821   1/1  ----------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00470261   1/1  lalvlagadelvlvvsdgdpeg....lleliealreatgvpvivkgvatved..............araa
00496291   1/1  grpv.....................nlelikeiaeavpiplqvgggirslediellleagadkviigsaa
00486871   1/1  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00517371   1/1  tnpev.reflldvlkflleyGfDGfflDgvdsylyp......andnydgypltredlldllrelaeaar.
00481021   1/1  ----------------------------------------------------------------------
00424462   2/2  ----------------------------------------------------------------------
00531721   1/1  ----------------------------------------------------------------------
00450461   1/1  llleaarel.glgvivgv.............svhtleealeaeelg.adyill....gpvfptgtkpgf.
00480351   1/1  ----------------------------------------------------------------------
00475101   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00526101   1/1  ........gvtvenvlelvkavke.vdvpvvlkgginpilrigvdgvlipdlpveepeefaeaaaeag.a
00470321   1/1  ----------------------------------------------------------------------
00467601   1/1  ----------------------------------------------------------------------
00503221   1/1  ----------------------------------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00382852   2/2  ----------------------------------------------------------------------
00360162   2/2  ----------------------------------------------------------------------
00354771   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00497391   1/1  evldaakklvklglkvl............vtgvdtlelakrledaGa.dailvtg.gpggt.......gl
00509101   1/1  ----------------------------------------------------------------------
00502691   1/1  ----------------------------------------------------------------------
00489981   1/1  ----------------------------------------------------------------------
00456211   1/1  ----------------------------------------------------------------------
00394821   1/1  ldvkvaeaeaaveaGadeidlvinl...................gallsgdpeevleeiravveaakdlg
00509612   2/2  ----------------------------------------------------------------------
00488662   2/2  ----------------------------------------------------------------------
00487551   1/1  ----------------------------------------------------------------------
00471251   1/1  ------------------------atkgglevtpidavelakraeelg.adailltsrtvtgtlsgpd..
00352901   1/1  ----------------------------------------------------------------------
00363002   2/2  ----------------------------------------------------------------------
00472421   1/1  laiaaaeaGglgvlgtgssasieevkkaapg..plivqlyvldretteellkraeaagadalvltv.dap
00366641   1/1  ----------------------------------------------------------------------
00495871   1/1  ilalrlvppgealispahgdpilsledlkalrealgvpvivkgvltved..............allaaea
00421801   1/1  ----------------------------------------------------------------------
00485851   1/1  ----------------------------------------------------------------------
00478891   1/1  ----------------------------------------------------------------------
00497301   1/1  ----------------------------------------------------------------------
00512131   1/1  ----------------------------------------------------------------------
00513051   1/1  ----------------------------------------------------------------------
00455192   2/2  ----------------------------------------------------------------------
00484451   1/1  lerveavreavgpdvrlrvDangg......wdleeairlakaleeyg.llwi..................
00406511   1/1  ----------------------------------------------------------------------
00452431   1/1  ----------------------------------------------------------------------
00523291   1/1  ----------------------------------------------------------------------
00387841   1/1  ----------------------------------------------------------------------
00502011   1/1  ----------------------------------------------------------------------
00457121   1/1  ----------------------------------------------------------------------
00517971   1/1  ----------------------------------------------------------------------
00480271   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00480092   2/2  ----------------------------------------------------------------------
00480452   2/2  ----------------------------------------------------------------------
00533222   2/2  ----------------------------------------------------------------------
00406192   2/2  ----------------------------------------------------------------------
00384492   2/2  ----------------------------------------------------------------------
00483652   2/2  ----------------------------------------------------------------------
00472702   2/2  ----------------------------------------------------------------------
00481082   2/2  ----------------------------------------------------------------------
00368892   2/2  ----------------------------------------------------------------------
00384682   2/2  ----------------------------------------------------------------------
00485842   2/2  ----------------------------------------------------------------------
00488652   2/2  ----------------------------------------------------------------------
00447052   2/2  ----------------------------------------------------------------------
00363012   2/2  ----------------------------------------------------------------------
00475652   2/2  ----------------------------------------------------------------------
00479092   2/2  ----------------------------------------------------------------------
00469722   2/2  ----------------------------------------------------------------------
00482002   2/2  ----------------------------------------------------------------------
00496792   2/2  ----------------------------------------------------------------------
00481992   2/2  ----------------------------------------------------------------------
00366542   2/2  ----------------------------------------------------------------------
00472712   2/2  ----------------------------------------------------------------------
00529642   2/2  ----------------------------------------------------------------------
00364592   2/2  ----------------------------------------------------------------------
00457982   2/2  ----------------------------------------------------------------------
00380742   2/2  ----------------------------------------------------------------------
00469732   2/2  ----------------------------------------------------------------------
00509602   2/2  ----------------------------------------------------------------------
00376432   2/2  ----------------------------------------------------------------------
00419402   2/2  ----------------------------------------------------------------------
00467612   2/2  ----------------------------------------------------------------------
00488072   2/2  ----------------------------------------------------------------------
00374372   2/2  ----------------------------------------------------------------------
00454812   2/2  ----------------------------------------------------------------------
00445592   2/2  ----------------------------------------------------------------------
00455182   2/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           QPAQWADLAAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDPEIITKTAQGRVHEIRP
00383081   1/1  eeag.vdylhvsggtvegv.........pegafldlaaavrkavkipviavggi.dpelaeealeeggaD
00426111   1/1  lakaleeag.ldylhvsegrveglvlliasilvgegyflelaeaireavkipviavggi.tpelaeeale
00448031   1/1  ldylhvsegrveg........pvgegyflelaelireavkipviavggi.tpelaeealeegladlvalg
00384291   1/1  eeaG.adylhvsdgdgag..........geganlelieaireavgipviasGgi.tpedaeealaaglad
00486611   1/1  lellvelakaleeagadgkg.vdylhvsegtyedlv....stpvpegyfldlaaairkavgipviavggi
00389721   1/1  .ldylhvsegrve........ipvgegyflelaelirkavkipviavggi.tpelaeealaegladlval
00424451   1/1  plestpvpggadlelaravreavsipviavggirtpedaeealeaggadlvavgraflanPdlvakl---
00364571   1/1  eglvlliatlilvrggydldlakavkeavkipviavggittpedaeealeaggadlvavgraflan----
00514891   1/1  tsglstpaipgafldlaaavkkavsipviavggitspedaeealeeggadlvalgRallanPdlvlkiae
00467211   1/1  .....pgldvediedlakaleeaG.adaiivsngigggtgltplelagvhgglsglplapasl.------
00447601   1/1  gpadleaikevke...sipvianGgirtpedaakaleatGadgVmigraalgnpelfgeikeglggegiv
00488071   1/2  -------------------------------------------------------------------irv
00364591   1/2  ------------------------------------------------------------------mgrv
00491501   1/1  -------------------------------------------------------------------Mir
00497081   1/1  kalreavgvPlvivKir........pglsvedieeiakaleeaG.adgiivsnttagghgrts-------
00529631   1/1  ----------------------------------------------------------------------
00374411   1/1  --------------------------------------------------------------------pv
00471411   1/1  ----------------------------------------------------------------------
00458701   1/1  ----------------------------------------------------------------------
00470221   1/1  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00499901   1/1  ----------------------------------------------------------------------
00435771   1/1  ----------------------------------------------------------------------
00492221   1/1  ----------------------------------------------------------------------
00503631   1/1  ----------------------------------------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00471401   1/1  gtqlidvearkallglglgsinetgglsgpaippaaleliaevreavpgipvianGGIrtgedaleala-
00485831   1/1  ----------------------------------------------------------------------
00460571   1/1  ----------------------------------------------------------------------
00462701   1/1  ----------------------------------------------------------------------
00475641   1/1  ----------------------------------------------------------------------
00360921   1/1  ----------------------------------------------------------------------
00463442   2/2  ----------------------------------------------------------------------
00464461   1/1  ----------------------------------------------------------------------
00490031   1/1  ----------------------------------------------------------------------
00397811   1/1  lgd..idavelakaleeaG.adailvtgrtrdgtls........gadle.lirevkeavkiPViasGGig
00455191   1/2  ----------------------------------------------------------------------
00457971   1/1  ----------------------------------------------------------------------
00479091   1/2  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------
00488651   1/2  ----------------------------------------------------------------------
00484941   1/1  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00509601   1/2  ----------------------------------------------------------------------
00463441   1/2  ---------------------------------------------------------------------v
00467501   1/1  ----------------------------------------------------------------------
00480451   1/2  ----------------------------------------------------------------------
00486071   1/1  ----------------------------------------------------------------------
00400351   1/1  ----------------------------------------------------------------------
00533221   1/2  ----------------------------------------------------------------------
00518991   1/1  pgsllttrlvehgglsgdalpplalellaevaeavgdipviadGGIrsgedaakalalG.Ada-------
00470681   1/1  ----------------------------------------------------------------------
00480091   1/2  ----------------------------------------------------------------------
00529261   1/1  ----------------------------------------------------------------------
00413411   1/1  ----------------------------------------------------------------------
00406021   1/1  ----------------------------------------------------------------------
00384491   1/2  ----------------------------------------------------------------------
00368891   1/2  ----------------------------------------------------------------------
00362581   1/1  kla........pgltgvdtvelakraeeaG.adavvvsnttggrgldgttrrvaeagglsGaplkpasle
00482001   1/2  ----------------------------------------------------------------------
00533211   1/1  ----------------------------------------------------------------------
00468341   1/1  ----------------------------------------------------------------------
00440981   1/1  ----------------------------------------------------------------------
00488661   1/2  ----------------------------------------------------------------------
00523131   1/1  ----------------------------------------------------------------------
00424461   1/2  ----------------------------------------------------------------------
00487711   1/1  ----------------------------------------------------------------------
00366541   1/2  ----------------------------------------------------------------------
00399921   1/1  salledpellaellealgpevivvaidvkavgvpvtvkirggldltdvdavelakaleeagada------
00483651   1/2  ----------------------------------------------------------------------
00501481   1/1  ----------------------------------------------------------------------
00472701   1/2  ----------------------------------------------------------------------
00447051   1/2  ----------------------------------------------------------------------
00406191   1/2  ----------------------------------------------------------------------
00363001   1/2  ----------------------------------------------------------------------
00465141   1/1  ----------------------------------------------------------------------
00477121   1/1  ----------------------------------------------------------------------
00472711   1/2  ----------------------------------------------------------------------
00520321   1/1  ----------------------------------------------------------------------
00475651   1/2  ----------------------------------------------------------------------
00509611   1/2  ----------------------------------------------------------------------
00526001   1/1  ----------------------------------------------------------------------
00485841   1/2  ----------------------------------------------------------------------
00529111   1/1  -------------------------------------------------------------------lls
00376431   1/2  ----------------------------------------------------------------------
00483561   1/1  ----------------------------------------------------------------------
00467611   1/2  ----------------------------------------------------------------------
00529171   1/1  EePvppddleglarlrratpipiaagEslysledfrelleagavdiiqpdlarvGGitealkiaalAeaf
00496791   1/2  ----------------------------------------------------------------------
00469721   1/2  ----------------------------------------------------------------------
00384681   1/2  ----------------------------------------------------------------ftprvl
00481991   1/2  ----------------------------------------------------------------------
00524811   1/1  ldiegvdlivaqgpeagglsGnalapaale.liaeiadavkgdipviadGGIrsgedaakalalG.----
00406601   1/1  ----------------------------------------------------------------------
00359891   1/1  ----------------------------------------------------------------------
00509271   1/1  ----------------------------------------------------------------------
00411521   1/1  i......gatlealrliaevvke..kipiiadGGIrsgedalkalaaG.Adlvgvgsalaileellgl--
00501351   1/1  ivvsgggggghidvetlravgaattggllgvgvptlallaevrealgdipviadGGirtgeda-------
00457951   1/1  ----------------------------------------------------------------------
00481081   1/2  ----------------------------------------------------------------------
00464161   1/1  ----------------------------------------------------------------------
00380741   1/2  ----------------------------------------------------------------------
00465791   1/1  ----------------------------------------------------------------------
00454811   1/2  ----------------------------------------------------------------------
00469731   1/2  ----------------------------------------------------------------------
00471331   1/1  ----------------------------------------------------------------------
00406881   1/1  ----------------------------------------------------------------------
00483641   1/1  ----------------------------------------------------------------------
00363011   1/2  ----------------------------------------------------------------------
00480291   1/1  pel..........vledlkalreavgvpvivKlvptved..............Akaaee-----------
00419401   1/2  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00457981   1/2  ----------------------------------------------------------------------
00382851   1/2  ----------------------------------------------------------------------
00400491   1/1  ----------------------------------------------------------------------
00498481   1/1  sggatlevlaliveavggkipviaaGGirtaedalkalaaG.Adavgvgs--------------------
00476511   1/1  EePlpaddleglaelreavgipiaadEsvtsledlkelleagaadavqiklakiGgltealkiaalAeaa
00360161   1/2  ----------------------------------------------------------------------
00458811   1/1  ----------------------------------------------------------------------
00461281   1/1  ----------------------------------------------------------------------
00396641   1/1  ----------------------------------------------------------------------
00445591   1/2  ----------------------------------------------------------------------
00463571   1/1  ----------------------------------------------------------------------
00470291   1/1  ----------------------------------------------------------------------
00514421   1/1  dlellrevve.....vgipviadGGIrtpedaakalaaG.AdgvlvGsallgapeppgeakell------
00472761   1/1  ----------------------------------------------------------------------
00374371   1/2  ----------------------------------------------------------------------
00455181   1/2  ----------------------------------------------------------------------
00444131   1/1  ----------------------------------------------------------------------
00529641   1/2  ----------------------------------------------------------------------
00465991   1/1  dpelvaivvaavkkavkvpvvvkivpgvdd..........lveiakaleeaG.adaiivtntt-------
00500031   1/1  veagglsgaalkpl.....alrlvaevreavggdipiigvGGIrtgedalealaaG.AsaVqv-------
00423421   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00511641   1/1  ggpdl.ellkevveavdipviaeGgIntpedakkalalG.adavmvGsailgnpeileaakelle-----
00423401   1/1  ----------------------------------------------------------------------
00515981   1/1  vgardakealraarlgrealrtkgikllpdvvttveaaraaeeaG.advigvtggdltgtkr--------
00476821   1/1  ----------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00470261   1/1  aeaG.adaivvsggggggl........dvgvptlealpevaeavggdipviadGGIrtg-----------
00496291   1/1  ledpelvaelakafgkqaivvsvdvkrvdgdglvatrggleltgvdlvelakaaeeaGa.dailvtsidr
00486871   1/1  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00517371   1/1  algpdlililkngfeil.rsdlpg..............lqdyvdfvv-----------------------
00481021   1/1  ----------------------------------------------------------------------
00424462   2/2  ----------------------------------------------------------------------
00531721   1/1  ----------------------------------------------------------------------
00450461   1/1  gplgl.ellrelveavkipviasGGi.tpenaaealeaG.adgvavgsailgap.dpaeaakalleavk-
00480351   1/1  ----------------------------------------------------------------------
00475101   1/1  -------------------------------------------------------------------sep
00367851   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00526101   1/1  diivlhapttgdlrlikeaggfayvvlnpgtsvagvtgarpvlglvdlvlaaavaeglsgll--------
00470321   1/1  ----------------------------------------------------------------------
00467601   1/1  ----------------------------------------------------------------------
00503221   1/1  ------ellrevaeavdipviasGGigsledlaaalellalGadgvlvGsallggpeslaea--------
00466731   1/1  ----------------------------------------------------------------------
00382852   2/2  ----------------------------------------------------------------------
00360162   2/2  ----------------------------------------------------------------------
00354771   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00497391   1/1  gvadl.ellrevaeavdiPviadGGIgtpedaakalelG.AdgVlvGsaiagaedPgema----------
00509101   1/1  ----------------------------------------------------------------------
00502691   1/1  ----------------------------------------------------------------------
00489981   1/1  ------ellkklaeavsipviasGGigsledlkellelsnlletgadgvlvgsallggpltl--------
00456211   1/1  ----------------------------------------------------------------------
00394821   1/1  vpvkvile.....tglltdveflveaaraaaeaG.AdfikvsdGg.....tvgg----------------
00509612   2/2  ----------------------------------------------------------------------
00488662   2/2  ----------------------------------------------------------------------
00487551   1/1  ----------------------------------------------------------------------
00471251   1/1  .......lellkevaeavsipviasGGigtpedaaklleaG.adgvivGsalfggplileea--------
00352901   1/1  ----------------------------------------------------------------------
00363002   2/2  ----------------------------------------------------------------------
00472421   1/1  llgirerdlrlgfglppglgglntldlvvipegrllgadvilldaahgdplll-----------------
00366641   1/1  ----------------------------------------------------------------------
00495871   1/1  G.adaivvsghggggl........dvgvptlealpevaeavggdipviadGGirtggDv-----------
00421801   1/1  ----------------------------------------------------------------------
00485851   1/1  ----------------------------------------------------------------------
00478891   1/1  fgpaglellrelre.ldipvivdGGi.tpedaaealeaG.adgvvvGsaitkaedpaeaaralrealke-
00497301   1/1  ----------------------------------------------------------------------
00512131   1/1  ----------------------------------------------------------------------
00513051   1/1  ----------------------------------------------------------------------
00455192   2/2  ----------------------------------------------------------------------
00484451   1/1  EePlpaddleglaelrealgipiaadEsltsledlrrlleagavdiiqiklaklGgltealkiaalAeaa
00406511   1/1  ----------------------------------------------------------------------
00452431   1/1  ----------------------------------------------------------------------
00523291   1/1  ----------------------------------------------------------------------
00387841   1/1  ----------------------------------------------------------------------
00502011   1/1  ------ellkalreavgipvviagGGistpedaaelle.g.AdgvvvGsaifkgedplkeaieflka---
00457121   1/1  ------ellkelaeavpkdipviasGGisspediaelleaG.adgvlvGsalmkapdplkea--------
00517971   1/1  ----------------------------------------------------------------------
00480271   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00480092   2/2  ----------------------------------------------------------------------
00480452   2/2  ----------------------------------------------------------------------
00533222   2/2  ----------------------------------------------------------------------
00406192   2/2  ----------------------------------------------------------------------
00384492   2/2  ----------------------------------------------------------------------
00483652   2/2  ----------------------------------------------------------------------
00472702   2/2  ----------------------------------------------------------------------
00481082   2/2  ----------------------------------------------------------------------
00368892   2/2  ----------------------------------------------------------------------
00384682   2/2  ----------------------------------------------------------------------
00485842   2/2  ----------------------------------------------------------------------
00488652   2/2  ----------------------------------------------------------------------
00447052   2/2  ----------------------------------------------------------------------
00363012   2/2  ----------------------------------------------------------------------
00475652   2/2  ----------------------------------------------------------------------
00479092   2/2  ----------------------------------------------------------------------
00469722   2/2  ----------------------------------------------------------------------
00482002   2/2  ----------------------------------------------------------------------
00496792   2/2  ----------------------------------------------------------------------
00481992   2/2  ----------------------------------------------------------------------
00366542   2/2  ----------------------------------------------------------------------
00472712   2/2  ----------------------------------------------------------------------
00529642   2/2  ----------------------------------------------------------------------
00364592   2/2  ----------------------------------------------------------------------
00457982   2/2  ----------------------------------------------------------------------
00380742   2/2  ----------------------------------------------------------------------
00469732   2/2  ----------------------------------------------------------------------
00509602   2/2  ----------------------------------------------------------------------
00376432   2/2  ----------------------------------------------------------------------
00419402   2/2  ----------------------------------------------------------------------
00467612   2/2  ----------------------------------------------------------------------
00488072   2/2  ----------------------------------------------------------------------
00374372   2/2  ----------------------------------------------------------------------
00454812   2/2  ----------------------------------------------------------------------
00445592   2/2  ----------------------------------------------------------------------
00455182   2/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           CIGCNECIHRRLVDKLPFACAINPYASRELDGPLPPARTPRRVLVVGGGPAGMELAGLLAERGHEVTLWE
00383081   1/1  lvaigRaflanPdlvlklaeglplnirdcitfyl------------------------------------
00426111   1/1  egladlvalgRaflanPdlvlklaegl.------------------------------------------
00448031   1/1  RaflanPdlvlklaegl..plnpcirc-------------------------------------------
00384291   1/1  lValGrallanpdlvakl----------------------------------------------------
00486611   1/1  tltpedaeealeega.dlvalgRalladPdlvl-------------------------------------
00389721   1/1  grafladPdlvlklaegl..plnpcir-------------------------------------------
00424451   1/1  ----------------------------------------------------------------------
00364571   1/1  ----------------------------------------------------------------------
00514891   1/1  gleleildcit-----------------------------------------------------------
00467211   1/1  ----------------------------------------------------------------------
00447601   1/1  vigakevl--------------------------------------------------------------
00488071   1/2  cilcelacllllllgpvlilllelaaalllpllllpatkkkdvaviGaGpaGlaaAlalaraGlkVtllE
00364591   1/2  cppcegaclllllagpvailllepaladelllgllplllpamskkkdvvvvGaGpaGlaaAlalaraGlk
00491501   1/1  vcpalce.............slvvlaaglepplpplsaskkkdvvviGaGpaGlaaAyrLaraGlkVtvl
00497081   1/1  ----------------------------------------------------------------------
00529631   1/1  ----------------------------------mp..tkkdVaiIGAGpaGLaaAllLaraGhdldVtv
00374411   1/1  liglle.............sliidtalllgllpplsaskkydvvviGaGpaGlaaAleLaraGlkVtvlE
00471411   1/1  ------------------------------------mstkkdvaiiGaGpaGlsaAiyLaraGlddvtvl
00458701   1/1  ----------------------------------------ydVvvvGAGiaGlaaAlrLaeaGltdvlvl
00470221   1/1  -----------------------------------------myDVvviGgGiaGlaaAlrLaraGlkVlv
00461561   1/1  ---------------------------------------gkkvaviGaGpaGlaaAllLakalpghdvtv
00499901   1/1  ---------------------------------------kkdvvviGAGiaGlaaAlrLaeaGhkVtvlE
00435771   1/1  ----------------------------------------kdVaviGAGiaGlaaAyeLaraGlkVtvlE
00492221   1/1  --------MmktpvliklleslladtalrlpplpplsldeeyDVvvvGAGpaGlaaAyeLarapGlkVlv
00503631   1/1  -------------------------------------masmsmkydvvIiGaGpaGlaaAlrLaraGlkv
00480161   1/1  --------------------------------------tgkkVavvGaGpAGlaaAaqLaraldlseelg
00471401   1/1  ----------------------------------------------------------------------
00485831   1/1  --------------------------------------lsedkeyDVvviGgGpaGlaaAlalaraGlkV
00460571   1/1  ----------------------------------pmmskkkdvvViGaGiaGlsaAlaLaraGysVtvlE
00462701   1/1  -------------------MMsp.lllalllllpllllaldeeydvvviGaGpaGlaaAlalaraGlkVl
00475641   1/1  --------------------------------------lldkeyDVvviGgGpaGlaaAlrlaraGlkvl
00360921   1/1  --------------------------------pplmmdeeydvvViGaGpaGlaaAlrLaraGlkVlvlE
00463442   2/2  ----------------------------------------------------------------------
00464461   1/1  -------------------Mmplslllatalelplp..alaldkkyDvvViGaGpaGlaaAlalaraGlk
00490031   1/1  --------------------------------lMlpeslleplpalsaseeydVvViGaGpaGlaaAlal
00397811   1/1  tpedaa----------------------------------------------------------------
00455191   1/2  ----------------ppipgve..llltsddalalkelpkdvvviGgGpaGleaAlalarlgakvtlie
00457971   1/1  -------------------------------------sekydvviiGaGpaGlaaAlrlarlaglkvlli
00479091   1/2  --------------------------------mmsylplfldlkgkrVliiGgGpaGltaAlelakaGak
00503641   1/1  --------------------------------------epklPdipGledFkgelfhsarwphdlvdltg
00488651   1/2  --------------------------------------mlpkdvviiGgGpaGleaalalarlglklevt
00484941   1/1  -----------------------------------aa.kkydvvIiGaGpaGlaaAlrLaraGlkVtvlE
00462741   1/1  ---------------------------------------mlMkkkyDviiiGaGpaGlaaAleLaraGlk
00509601   1/2  ----------------------------------------kdvvviGgGpaGleaAlalar.glkvtlie
00463441   1/2  viatgsapvvitqlpipgadlarvltleevl..lgkaktgkrVlVvdgGgGpaGleaAealarrGheVtl
00467501   1/1  --------------------------------------kkkdvvvvGgGpaGltaAlrlarlgpdlevtl
00480451   1/2  -------------------pgldlelvltsddlldleelpkdvvviGgGpaGleaAlalarlgakvtlve
00486071   1/1  -----------------------------------------myDvviiGaGpaGlaaAlrLaraGlkVlv
00400351   1/1  -----------------------------------------DvvvvGaGpaGlaaAlrLaraGlkVlvlE
00533221   1/2  ---------------ipgldlegvltsrdlldllel...pkdvvviGgGpaGleaAlalarlgaevtvve
00518991   1/1  ----------------------------------------------------------------------
00470681   1/1  ------------------------------lllllmmmlhydvvviGgGpAGlaaAlrlarldpgarvll
00480091   1/2  ----------------ppipgle..gvltsrdlldllelpkdvvviGgGpaGleaAlalarlgaevtvve
00529261   1/1  ------------------------------------lniksielflsiieraldeglvppsmemmmekyd
00413411   1/1  ------------------------------------------MpmsseeyDvvViGaGpaGlaaAlrlar
00406021   1/1  -------------------------------------MseyDvvvvGaGpaGlaaAlrlaraGlkvlllE
00384491   1/2  --------------------lpgvellltsddalaleelpkdvvviGgGpaGleaAlalarlglkvtvve
00368891   1/2  ----------------ppipgle..llltsddalellelpkdvvviGgGpaGleaAlalarlglkvtlie
00362581   1/1  l---------------------------------------------------------------------
00482001   1/2  ------------------llpipglevltsdgaldllelpkdvvviGgGpaGleaAlalarlglkvtlve
00533211   1/1  -------------------------------------mekydvviiGaGpaGlaaAlrlaraGlkvlvlE
00468341   1/1  --------------------------------------smasesdydvvIiGaGpaGlsaAlrLaralgk
00440981   1/1  ------------------------------------MeskkydvvviGaGpaGlaaAlylaraglkvtll
00488661   1/2  --------------------------srprvlpipgldlegvlllrtlldsdallellalpkdvvviGgG
00523131   1/1  --------------------------------------msydVvvvGAGiaGlsaAlaLarrGlrvllle
00424461   1/2  ----------------------------------vPrvlpipgidlggvlhaldfldpkalkgkkVaviG
00487711   1/1  ---------------------------------------kydvviiGaGiaGlsaAleLarrGlkdVtvl
00366541   1/2  ---------------vlpipgldgegvltsrdlldllelpkdvvviGgGpaGleaAaalarlgakvtvve
00399921   1/1  ----------------------------------------------------------------------
00483651   1/2  ---------------ipgldlpgvlllltsddalallellllakpkdvvviGgGpaGleaAlalarlGak
00501481   1/1  -----------------------------------lmeleydvvviGgGpaGlaaAlylaraglkvtlie
00472701   1/2  -------------------------l.edllldllsmstkkdvvviGaGpaGleaAlalarlglkvtlie
00447051   1/2  -----------------------------------arprllpipgedlflgkgvltsatilgalllfkgk
00406191   1/2  ----------------prvlpipGedlcgvlslrdfvgdynlhpaawllppdltgkrVvviGaGpaGlda
00363001   1/2  -------------------------------------mekydvvviGaGlaGlsaAlelaragldvtvle
00465141   1/1  -------------------------------------eieydvvViGaGpaGlaaAlrlaraGlkVtviE
00477121   1/1  --------------------------------------ektdVaIvGAGpaGlaaAlaLaraGldvtvlE
00472711   1/2  ----------------PrlpdipglelflgkgvhtsatldgllfkgkdvvviGgGpaGleaAlalarlgl
00520321   1/1  -------------------------------------MmdeeyDvviiGaGpaGlsaAlrLaraGlkVlv
00475651   1/2  -----------------------------srdlldllelpkdvvviGgGpaGleaAlalarlgakvtvve
00509611   1/2  ---------------lPrllpipglegvlllrtlldsdlllellelpkdvvviGgGpaGleaAlalarlg
00526001   1/1  ------------------------------------------MseeyDvvvvGaGpaGltaAleLaraGl
00485841   1/2  -----------------------------sddlldleelpkdvvviGgGviGleaAlalarlgakvtvve
00529111   1/1  nlplgrllp.fllptslwldtlplpllellisraileralpdldmdkeyDVvIvGAGpaGLsaAyyLaka
00376431   1/2  ---------------------------------------eydvvvvGaGpaGlaaAlalaraglkvllle
00483561   1/1  -------------------------------------MskkydvviiGaGiaGlsaAlrLaraGlkVlll
00467611   1/2  ----------------------gvlllltsddalalkelpkdvvviGgGyiGleaAlalarllpegakvt
00529171   1/1  gvpvaphgm.espiglaaalhlaaalpnllile-------------------------------------
00496791   1/2  ------------------------------atldglefrgkdvvviGgGpaGleaAlylarlglkvtlie
00469721   1/2  --------------dlpgve.....llltsddalalkelpkdvvviGgGpaGleaAlalarlgakvtlie
00384681   1/2  pipgeeacglltade.pvailflerlihsyavkdgppftgkdVaViGaGpaGldaAlylarlgakkvtlv
00481991   1/2  -------------------klllatgslplipplegllldgvlllrtlldalallemlkkeydvvviGgG
00524811   1/1  ----------------------------------------------------------------------
00406601   1/1  ------------------------------------------MddlpeeyDVvViGaGlaGlaaAaaLar
00359891   1/1  -----------------------------------eldeeyDvviiGaGpaGlsaAlrLaraG.kVlvlE
00509271   1/1  ----------------------------------------vydvviiGaGpaGlaaAlrlaraglklsev
00411521   1/1  ----------------------------------------------------------------------
00501351   1/1  ----------------------------------------------------------------------
00457951   1/1  ----------------------------------------yDVvIiGaGpaGlsaAlrLaraGldlgsel
00481081   1/2  ------------------------aalliliaslglellpadylvlaigssdgaldlpklpkrvvvvGgG
00464161   1/1  ----------------------------------------MleydvvviGgGpaGlaaAlrlaraGlkvl
00380741   1/2  --------------------------------------keydvvviGgGpaGlaaAlrlaraGlkvllle
00465791   1/1  ------------------------------------m.keyDvvIiGaGiaGlsaAlrLakaGlkVlvlE
00454811   1/2  -----------------------------------tdlkgkrVvViGaGlsGlaaarlllrlGaevtvld
00469731   1/2  --------------dipgle.....llltsddalalkelpkdvvviGgGyiGleaAaalarlgaevtlve
00471331   1/1  --------------------------------------tmkydvviiGaGpaGlaaAlrlaraGlkvlll
00406881   1/1  --------------------------------------keydvvviGgGpaGlaaAlrlaraGlkvllle
00483641   1/1  ----------------------------------------ydvviiGgGpaGltaaiylarlgpdlkvtl
00363011   1/2  --------------------------------------ppipgldlegvftlrtlddalalreallagkr
00480291   1/1  ----------------------------------------------------------------------
00419401   1/2  ---------------lPdipgle..lvltsddalelke.pkkvvviGgGyiGleaAsalrrlgaevtlie
00473271   1/1  -----------------------------------------MyDviviGaGiaGlaaAyrLakaGlkVlv
00457981   1/2  ---------------iPgle.....lvltsddaldleelpkrlvviGgGyiGlelAsalrrlgpdaaevt
00382851   1/2  --------------------------srPrvlpipgldlegvlllrtledalellellelpkrvvviGgG
00400491   1/1  ------------------------------------------vvvvGaGpaGlaaAlalaragpdlkval
00498481   1/1  ----------------------------------------------------------------------
00476511   1/1  glpvvvhsslesgiglaaalhlaaalpnilileldtplll------------------------------
00360161   1/2  ---------------------------------lepdltgkrVvviGgGpaGldaArlllksldellktd
00458811   1/1  ------------------------------------------llydvvIiGaGpaGlsaAlrLaraGlkV
00461281   1/1  ------------------------------------------glellllslltemmskeyDvvvvGaGpa
00396641   1/1  -------------------MsylasaallaalpslletieyDVlviGgGpaGlsaAlelarlapdaGlkV
00445591   1/2  ---------------------------------------pkkvaviGaGgvGlalAlllaaagggdVtlv
00463571   1/1  ----------------------------------------mKiaviGaGyvGlelAavla.lgheVtlvd
00470291   1/1  ------------------------------------------lllllslsllllllsslllmmskeyDvv
00514421   1/1  ----------------------------------------------------------------------
00472761   1/1  --------------------ysrplllgligllgakvlpgkkvaviGaGgvGlalAlalaaagaagevtl
00374371   1/2  -----------------------------agrlavleaalllervltglgalagllpgkrvlViGaGgiG
00455181   1/2  -------------------------------------MseydvvviGgGpaGlaaAlrlaeaGlkvlvlE
00444131   1/1  ------------------------------------------MsdedyDviviGaGiaGlvaAarLakaG
00529641   1/2  -------------------------------ePripdipglleefkgkvlhsaayrdpedfkgkrVvViG
00465991   1/1  ----------------------------------------------------------------------
00500031   1/1  ----------------------------------------------------------------------
00423421   1/1  --------------------------------------ldllplfldlrgkdvlviGgGdvGlaaarlll
00479921   1/1  ---------------------------------------pkkvaviGaGavGlalAlalaraGaageVvl
00504431   1/1  ------------------------------------lmeikkvaviGaGlmGlgiAavlaraGleVvlvd
00425341   1/1  ---------------------------------lsmvlkgkkvaviGaGliGlalalllallglgeVvly
00511641   1/1  ----------------------------------------------------------------------
00423401   1/1  -----------------------------------aGylavllaalllcrflgglgllltlagglagkkv
00515981   1/1  ----------------------------------------------------------------------
00476821   1/1  ---------------------------------------lallslllllllglllalpdlamdkeyDvvv
00472781   1/1  ---------------------ldifvkrlikelivvklpgkkvvviGaGpvGlalAlalallgavgkVvl
00470261   1/1  ----------------------------------------------------------------------
00496291   1/1  dgtlsg----------------------------------------------------------------
00486871   1/1  --------------------------------llllllkikkvafiGlGgmGmsalAllllkaGyeVtgs
00482271   1/1  ----------------------------------------mkiaviGaGyvGlplAallaeaGheVvgvD
00533831   1/1  ---------------------lellgvallevlgkrilkgkkvaviGaGgvGlalAllllelgvaaeVtl
00517371   1/1  ----------------------------------------------------------------------
00481021   1/1  ----------------------------------------lllmlkmmkiaviGaGavGtalAallaeng
00424462   2/2  ----------------------------------------------------------------------
00531721   1/1  ---------------------rrsrlllliglegqeklkgakVaviGaGgvGlalAllLalagvagevvl
00450461   1/1  ----------------------------------------------------------------------
00480351   1/1  -----------------gllldtallvllllllllldlkgkvalVtGasggiGlaiAralaaaGarVvla
00475101   1/1  iadtvlvlilnllrdllgarqrlsagllrlkpllglelkgkkvviiGaGnvGralakvlralGaevtvyd
00367851   1/1  --------------------------------------kgkkvlviGaGgiGralaraLaeaGaevtvad
00355351   1/1  ----------------------------------------GkkvaviGlGsmGlalAallaaaGheVlvw
00526101   1/1  ----------------------------------------------------------------------
00470321   1/1  ----------------------------------------llGdntdglgavellerlggdlkgktvlvi
00467601   1/1  -----------------------------------------MkeyDvvviGaGpaGlaaAlrlarlgldk
00503221   1/1  ----------------------------------------------------------------------
00466731   1/1  ------------------------------------mlkikkvaViGaGlmGsgiAavlaaaGikVvlvD
00382852   2/2  ----------------------------------------------------------------------
00360162   2/2  ----------------------------------------------------------------------
00354771   1/1  -------------------------------------MlkgmkvlVtGAaGgiGsalalrlaarglagld
00481861   1/1  ----------------------------------------kkvlvtGAsGgiGsalalllaargaevvll
00497391   1/1  ----------------------------------------------------------------------
00509101   1/1  ----------------------------------------mkigiiGaGnmGralaagLlkaGhsevtva
00502691   1/1  ----------------------------------------kkvgiiGlGlmGlalarnlaaaGyeVvvyd
00489981   1/1  ----------------------------------------------------------------------
00456211   1/1  -------------------------------------lkplkvlvtGAaGqiGsalalllalggladldl
00394821   1/1  ----------------------------------------------------------------------
00509612   2/2  ----------------------------------------------------------------------
00488662   2/2  ----------------------------------------------------------------------
00487551   1/1  ----------------------------------------mmkigviGlGlmGlplalnlakagheVvvy
00471251   1/1  ----------------------------------------------------------------------
00352901   1/1  ---fgalnlgrlllgllglvpctplgilellerlgidlsgkvalVtGasggiGraiallLaraGatVtvt
00363002   2/2  ----------------------------------------------------------------------
00472421   1/1  ----------------------------------------------------------------------
00366641   1/1  ----------------------------------------ntesvaelalalllalarrlpeaaagvrtg
00495871   1/1  ----------------------------------------------------------------------
00421801   1/1  ----------------------------------------DgigavsllkrllvdlpgkkvlvlGaGgiG
00485851   1/1  ----------------------------------------mKiaviGaGnvgsalalllalagladelvl
00478891   1/1  ----------------------------------------------------------------------
00497301   1/1  ----------------------------------------lkiavlGaGswGtaLAvlladnghevllwg
00512131   1/1  ---------------------------------------mkkvaiiGaGyiGlslalllaekgllgkvvl
00513051   1/1  ----------------------------------------naesvaelalalllalarnlleaaallrag
00455192   2/2  ----------------------------------------------------------------------
00484451   1/1  glpvvphsalesgiglaaalhlaaalpnlliledldtpl-------------------------------
00406511   1/1  ----------------------------------------mhviiiGlGrvGlalarlLlelgidvvvid
00452431   1/1  ----------------------------------------tisvaelalalllalarnlpgaapllragi
00523291   1/1  ----------------------------------------kkvgviGlGlmGlalalnlak.gfevvvyd
00387841   1/1  ----------------------------------------kkvlvtGAsGgiGsalalllakegaevvlv
00502011   1/1  ----------------------------------------------------------------------
00457121   1/1  ----------------------------------------------------------------------
00517971   1/1  ----------------------------------------mkigiiGaGnmGsalakgllkaghevvvad
00480271   1/1  ----------------------------------------mhviiiGlGrvGrlvarlLlelgidvvvid
00502281   1/1  ----------------------------------------mmkvlitGAtGfiGselvrlLlehgdhevt
00480092   2/2  ----------------------------------------------------------------------
00480452   2/2  ----------------------------------------------------------------------
00533222   2/2  ----------------------------------------------------------------------
00406192   2/2  ----------------------------------------------------------------------
00384492   2/2  ----------------------------------------------------------------------
00483652   2/2  ----------------------------------------------------------------------
00472702   2/2  ----------------------------------------------------------------------
00481082   2/2  ----------------------------------------------------------------------
00368892   2/2  ----------------------------------------------------------------------
00384682   2/2  ----------------------------------------------------------------------
00485842   2/2  ----------------------------------------------------------------------
00488652   2/2  ----------------------------------------------------------------------
00447052   2/2  ----------------------------------------------------------------------
00363012   2/2  ----------------------------------------------------------------------
00475652   2/2  ----------------------------------------------------------------------
00479092   2/2  ----------------------------------------------------------------------
00469722   2/2  ----------------------------------------------------------------------
00482002   2/2  ----------------------------------------------------------------------
00496792   2/2  ----------------------------------------------------------------------
00481992   2/2  ----------------------------------------------------------------------
00366542   2/2  ----------------------------------------------------------------------
00472712   2/2  ----------------------------------------------------------------------
00529642   2/2  ----------------------------------------------------------------------
00364592   2/2  ----------------------------------------------------------------------
00457982   2/2  ----------------------------------------------------------------------
00380742   2/2  ----------------------------------------------------------------------
00469732   2/2  ----------------------------------------------------------------------
00509602   2/2  ----------------------------------------------------------------------
00376432   2/2  ----------------------------------------------------------------------
00419402   2/2  ----------------------------------------------------------------------
00467612   2/2  ----------------------------------------------------------------------
00488072   2/2  ----------------------------------------------------------------------
00374372   2/2  ----------------------------------------------------------------------
00454812   2/2  ----------------------------------------------------------------------
00445592   2/2  ----------------------------------------------------------------------
00455182   2/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           REEQLGGQMRIAARAAENAAYHDFVTWQEGRLRRAGVTVELGRTATVDNVLSFDADVVAVATGAVPRRLP
00383081   1/1  ----------------------------------------------------------------------
00426111   1/1  ----------------------------------------------------------------------
00448031   1/1  ----------------------------------------------------------------------
00384291   1/1  ----------------------------------------------------------------------
00486611   1/1  ----------------------------------------------------------------------
00389721   1/1  ----------------------------------------------------------------------
00424451   1/1  ----------------------------------------------------------------------
00364571   1/1  ----------------------------------------------------------------------
00514891   1/1  ----------------------------------------------------------------------
00467211   1/1  ----------------------------------------------------------------------
00447601   1/1  ----------------------------------------------------------------------
00488071   1/2  ardrlggrlllsggipgkvdpaellealaelaeelgveirlgtrv..DdgetiradavvlAtGarprllp
00364591   1/2  vtllekgdrlggrlllvggipggvlpeelvealaelleklgveirlgtrvtdgvgvttedgetieadavi
00491501   1/1  EardrlGGrsrtaglippgflldlgahvfpg.laplllelleelglelelltlagaavlalldgklidlp
00497081   1/1  ----------------------------------------------------------------------
00529631   1/1  fErrdrpGGlwrttgrigsgldlgpsllrlleelglldelleeglsplypglrldvpkelygfpdfplpg
00374411   1/1  ardrlGGrlrtaripglgasldlggilfpglsprllellaelgleaelarllglrvlilldgtvvsldgd
00471411   1/1  EkndrlgGrll..ggipgfalpaelldalaelaeklgveirlgtevdgvtvttedgetieadavvlAtGa
00458701   1/1  EagdrvGGrartvrypgfrfdlgahvflgpgg.elleylldlleelgleddlrlntevggarlllpdgkl
00470221   1/1  lEagdrlGGrlrtvrlgggtsldlggivfpglypallelleelglelallaldgellayldglvlelgid
00461561   1/1  fEkgpvpggllr.ygiapdfrlpkelldrlielleelgveirlntevgkdvtledll.leydavvlAtGa
00499901   1/1  ardriGGrsrtnggllipglrldlgahlfpgsyellldlleelgvelrlntrvvvdrdgklvtvpldldg
00435771   1/1  ardrlGGrsrtvgy..pgfrldlgaglipgsypyllelleelglelairlntevggavllpdgglltvpr
00492221   1/1  lEkgdrlGGtsrnggvipdgglldpelldlleelGlpfdlllpgggvvdpaellralaealaeelgveir
00503631   1/1  tvlEkgprlGgtwrtgrypglllllpallyllldlpllfglpppggggvdraelldylleaaerlgvedv
00480161   1/1  hdvtvferlprpgg.llrygiapdfrlpkevvdrlvdlledlgvefvlnvevgvdvtldel.lleydavv
00471401   1/1  ----------------------------------------------------------------------
00485831   1/1  lllEkgpelggtclaaggipskallllalgllllelaallgillllllldlllllrrllllllllaagve
00460571   1/1  rgdrpggtsgtnggllaaglvapllllpggipllalalealdllrelglelgidfrvgalvlatglaela
00462701   1/1  llEkgdrlGGtslrsggilldgglrlleglglldrleelleelgieldllvdgrlvvaladealeadall
00475641   1/1  llEkgdrlgGtclnsgcipskalllaalglllllgaalfglllllllllldlvllgaakralgaellrll
00360921   1/1  r....gGrlasgripgklldggahllpglleellaglgdlaellalkpelvalledgaailllprgvrll
00463442   2/2  ---------------------------------------------------------vviatgsapvvit
00464461   1/1  VlllEkgdrlGGtsltaggilldlgarlleglglldlleelleelgielrllrdgklvvaltgegleada
00490031   1/1  araGlkVlllEkgprlggtsclnggglppgglrylaglglldlleelaeelgidldflrdgllvlaldge
00397811   1/1  ----------------------------------------------------------------------
00455191   1/2  rrdrllgtl...........dpelskallelleklgvevllgtevteidgdgetleadavliAtGarpnt
00457971   1/1  ekg.rlgglllllayggillrvgfiplkrlaelleallelaeklgveillgtevtdidldddvvvvltdg
00479091   1/2  vtlverdprpelallllelleklgvevllgtrvteiakeylpelllgveveagdgvvtvvlgdgetiead
00503641   1/1  krVaviGaGpaGlaaaaelakaglevtvfertprigglwrgipypp...lgkelldyleeyarklglrir
00488651   1/2  liergdrlggtllplgpgpllglldaeelaeylrelleklgvevllgtevtsidgdgkgvtledgetlea
00484941   1/1  kgdrlGGrsrtggypgfpiidsgallf...pellpyllellkelglelrl..........pdlggrvvvl
00462741   1/1  VlvlEkgdrlGGtwasngipgipsdggaavilgpellellrelgielgpkvpeildyllklldkfdllkl
00509601   1/2  rgdrlggtrpllsgvipgklldeelaeylrelleklgvevllgtevtsidgdgkgvtlddge.leadavv
00463441   1/2  vealdrlggllrlgipdpller...........leelgveillgvavteilgdgve--------------
00467501   1/1  iekgdrlggtpllpgvlggkllae.lllrllelllklgvevllgevtsidpdgktvtledgetleydllv
00480451   1/2  rrdrlgglld...........pelaaallelleklgvelllgtrvtaidldgggvtvtledge-------
00486071   1/1  lEk.drlGGtclnvgcipskallyagllpdelelleelglpllpgldipvlpgrkgggreellrylaeal
00400351   1/1  rgdrpGGtsltnggpgfkldlgaalllgpelleelgteaaellaergvrvlrgkg..lgggstinadavv
00533221   1/2  rgdrlgglld...........eelslallelleklgvelllgtrvtaidvdgdgvtvtledgg-------
00518991   1/1  ----------------------------------------------------------------------
00470681   1/1  iekepglgynrgclpkklllaaaelldlllelaglgllllvaagdldaeelvlalaelleelgvevllgt
00480091   1/2  rgdrlgglld...........eelsllllelleklgvelllgtrvtaidvdgdgvtvtledgg-------
00529261   1/1  vvIiGaGpaGlaaAlrLlqlAaraGpdlkVtvlEkgdrlGGtsrtnggliprgl........eelldelg
00413411   1/1  aGlkVlllEkgpvlgGtssrnqggirldlgaipl.....dlleelgldl.....vkggdgltleagalvl
00406021   1/1  kgdrlggtsllgggllnagdildklgllaallvrl...................adalvlatgarprrlg
00384491   1/2  r.drlggtldcilskall...........elleelgvevllgtevteveldgggvvvvlgltv-------
00368891   1/2  rgdrlgglld...........pelaaallelleklgvevllgtevtaidvdgdgvtvtlll---------
00362581   1/1  ----------------------------------------------------------------------
00482001   1/2  rgdrlggtl...........dpelsklllelleklgvevllgtevtaiegdgdgvvvvvklvt-------
00533211   1/1  kgprpgglsrlnggggaaldlpsklllrlldll.....................................
00468341   1/1  lpGlkVtvlEkgprpggrsrggglypgglellrelgl....edeleelgvdflkalvvlldldlv.....
00440981   1/1  ekgprlggllntgcgpsklllpgallgaelveallelleelgveillgtevtsidldgggvvltdge.ti
00488661   1/2  paGleaAaalarlgakvtlvergdrlggtlld...........eelaaallelleklgvevll-------
00523131   1/1  rgdvlggascrnsggglakgllleelpalggvdrarlaaalaeaaealgveirlgtevtdllleggrvtg
00424461   1/2  aGpaGlaaAlyLarlGaevtvierrprlggtllalgripakllglealllrllllllglglllp------
00487711   1/1  Ergplpggggasgrnagllhaglaylelarlaresldllrelveelgid...frrygklvlatgeaelel
00366541   1/2  rgdrlggtld...........pelskallelleklgvevllgtevtaidvdgdgvtvtvldv--------
00399921   1/1  ----------------------------------------------------------------------
00483651   1/2  Vtviergdrlggrlld...........eelalallelleklgvelllgtevteidgdgggvv--------
00501481   1/1  kgplllyalgglllyvgcilskallllgilgeellarlreqleklgveillgtrvtsidldggtvvltdg
00472701   1/2  rg..lGgtllnggpglskplllrvlgpelaeylrelleklgveillgtrvtsidrdgdtgrvtgvtledg
00447051   1/2  dvvviGgGpaGleaAlylarlgakvtlierrdrlggtl................dlllelle--------
00406191   1/2  ArellkdldlllktdisdnaleallarlgaevtvvgRrgpliaaftlkelerlpelggllry..------
00363001   1/2  rgprlggcllllsvpggrldpeelvlalaelleelgvevrlgtevtsidrdgdgvtledgetleadavvl
00465141   1/1  kgprlggclnvgcipgkaldaaalllrllelleelgvelr..............................
00477121   1/1  rrdrpggtalgrggalsprglelleelglldallargvpldglvvvdgggrlaldfaelalgapg.yvvd
00472711   1/2  kvtllerrprlggtl................dlllelleklgveillgtevteidgdgggvtg-------
00520321   1/1  lEkgpllggtsglngggihaglskllldlr.dlleelgvelllggaglvdprgvellgelgleadallla
00475651   1/2  reprlggtld...........pelskallelleklgvelllgtevtaidgdgdgvvvvlll---------
00509611   1/2  lkVtliergdrlgg.ld...........pelskallelleklgvelllgtevteidgdvvlgdg------
00526001   1/1  kVlllEagdrvgGtslrngglphkg.lreladrlielleelgvelllntvvgalltlaellaeydavvla
00485841   1/2  rgdrllgtld...........pelsklllelleklgvdlllgtkvtaidrdgdgvtvvlllkdg------
00529111   1/1  rPglkVlvlEkgdrpGGasgrnggilpsglltdellelleelgipfdpegpgggtvdgaalvralaeaal
00376431   1/2  kgprlggllvglipskllllrvlgaelaaalaealeelgvevllgtevtsidrdgggvtgvllvttgdge
00483561   1/1  EkgdrlGGtsgrnaglipgglrldaall.................lvrlalesldalreliatgarplgl
00467611   1/2  lvergdrllpcld...........pelsklllelleklgvdvllgtevtaidvddktvtvvtle------
00529171   1/1  ----------------------------------------------------------------------
00496791   1/2  rrdrlggd.............pelleyllelleklgveillgtevteiegdgdgvtgvtledg-------
00469721   1/2  rgdrllglldpelskall...........elleklgvelllgtevtaidldgdgvtvvtledg-------
00384681   1/2  errdrlg...............fpafpelvellkeegveillgtavleilgddgkvtgvrvvr-------
00481991   1/2  paGlaaAaylarlGlkvlliekgprlggtclnvgcipskallkaaelaeliellpglgvelllgglgldl
00524811   1/1  ----------------------------------------------------------------------
00406601   1/1  aGlrVlvlEkrdrlGGtsatsrypGfrfdvggsllpgtipgllrllrelgledlellplglagvirgggs
00359891   1/1  kgpvlggtsglngggipgglllddllerlgedlliglallvdgdlvvvltgegleadalllatGapprll
00509271   1/1  lllek.drlggtilllggvpsglllgaalllallelleklgveillgtevtsidldggtvvgvttgdget
00411521   1/1  ----------------------------------------------------------------------
00501351   1/1  ----------------------------------------------------------------------
00457951   1/1  kVtvlEkgdrlGGtsglnaglipp.......glggplddrglalaeetlellrelgaelglldglvrpng
00481081   1/2  yiGlelAaalarllpelgaeVtlvergdrl..........lpglldeelaelllelleklgvell-----
00464161   1/1  liekgdrlGGtllntgcipgkalllgalllellrellelgglflllpdldlelllelldalv........
00380741   1/2  kgdlgggclnvgcipgkrllaaaelydelrelleelgipfdevllglllllgrggadgaelaaalaelle
00465791   1/1  kgdrpGgrgasgrnaggiapglgyddrllalakeslellkelgaelgidlfrppgklvvagggdigllle
00454811   1/2  rrdrpggl......................lllelgvefvlgs...lllellleadlvvlspgvpldhpl
00469731   1/2  rgdrllpyldcelskall...........elleklgvdlllgtkvtaidrdddgvlvvvledg-------
00471331   1/1  EkgprlgyktllalGgllltvglipgkallgaall...................................
00406881   1/1  kgdrlgglllagcipgkallaaalllrllellaelgiellllpypgvdlslv..................
00483641   1/1  iekggtclyvgcllskalgllglldeelalrllelleklgvelllgtevtsidlegktvtllllvlgdge
00363011   1/2  vvvvGgGlaGleaAaalrrlglevtlvergdrlllpyl..........rpelskallelleel-------
00480291   1/1  ----------------------------------------------------------------------
00419401   1/2  rgdrllpll...........deelsllleelleelgidvllgtevteiekdgdgvlvvvvl---------
00473271   1/1  lEkgdrlGGraatfrldgfrvdnvgahpfkglnpelldllkelgledkldlrrlvllrgkvlggpsdlng
00457981   1/2  lvergdrllpyldpelsklll...........elleklgvevllgtkvtsidrgedgvvvvt--------
00382851   1/2  liGlelAaalrellpklglevtlveagdrllpryldpelsklll...........elleelg--------
00400491   1/1  iekgplgggasclngggipakllledllerlvvdllkggailvdedlvelldgealeadalllatGarpr
00498481   1/1  ----------------------------------------------------------------------
00476511   1/1  ----------------------------------------------------------------------
00360161   1/2  indlalealkrlggkeVtvveRrgpleapftlkelrelggllrygippdpldlallelelell-------
00458811   1/1  lvlEkGplvnrdrlGGtsnggdgrldlgahvfflllppgllellaelglplglelldlleelleelgidf
00461281   1/1  GlvaAlrLaedaGlkVlvlEagdrlgGascipsgaglgadlgltllpglfdtllagldgrdllarrgkvl
00396641   1/1  alvEkgdlgggasgrsgggiaaglrllienylgldlaellvedlvkggaglvdedlve............
00445591   1/2  Didpekleglaadlldilelllve.................rlitttdleealadaDvviiav-------
00463571   1/1  inpeklea...........lnegllpilelgldelveellgnltattdleealkdaDlviiavgtpl---
00470291   1/1  iiGaGpaGlvaAlrLaelaGlkVlvlEa....GGtarnggyi.gskpdlgaalfgelldelyelgle...
00514421   1/1  ----------------------------------------------------------------------
00472761   1/1  vDideekleglardlldilellgv.................glvvttdleeal.kgaDvviia-------
00374371   1/2  leaAaalarlGakVtvvdrrpe........llerleelgakfvlltldeelvevvlaltvdvsdeegrlk
00455181   1/2  kgdrlgglsnrngipglrlllgalllrllelleelgipfdlpglgglflprggrvdgaelaaalaeaaee
00444131   1/1  lkVlvlEkgdrlGGtaatlgldglkfdlggsvihgllypallrllrklgldlgpkilhalgelvdlllrt
00529641   1/2  aGaSgldialelakvaksvtllersdelggpw.........lgvvillnteveevtgdg..---------
00465991   1/1  ----------------------------------------------------------------------
00500031   1/1  ----------------------------------------------------------------------
00423421   1/1  eagakvtvve.....................rrllprlaalaeelgvevvlgd..fleedl.gdadlvia
00479921   1/1  vdrdeerlealaadledllellgvdlra.................ttdleealk.daDlviia-------
00504431   1/1  inpealeraldeiaklllklvlkgllvelllgaalaritgttdleal......adadlVieavpenldvk
00425341   1/1  Dinpekleglaadladilelllvk................grirattdlyealk.gaDvviiavg.vprk
00511641   1/1  ----------------------------------------------------------------------
00423401   1/1  lviGaGgvGlaaarllaalGakVtvldrn........pekleqleelgadav............evdvsd
00515981   1/1  ----------------------------------------------------------------------
00476821   1/1  vGaGpaGltaAlrLae.GlkVlvlEaggrlggrgat..psgggflvdtgadwlfgtep............
00472781   1/1  vdideekle..glalelidillpklv.........dvvvtte.......lkevlkgaDvvila-------
00470261   1/1  ----------------------------------------------------------------------
00496291   1/1  ----------------------------------------------------------------------
00486871   1/1  Dlnd......................pallelleelgievvlg..hdaella..dadlvvvslaipldnp
00482271   1/1  ideekvealn------------------------------------------------------------
00533831   1/1  vDiddelle.....glalelgdiisllgk.........................................
00517371   1/1  ----------------------------------------------------------------------
00481021   1/1  heVtlwdrneek...vellnekgenpiylpglelp............enltattdleeavkdad------
00424462   2/2  ----------------------------------------------------------------vPrvlp
00531721   1/1  vDidevklsnlardllhiladlgvpkvvva..................nleealadaDvviia-------
00450461   1/1  ----------------------------------------------------------------------
00480351   1/1  drnee.....klealaaelgalg..........ralavaadvtdpesvealv.ggldilvnnagilgall
00475101   1/1  idesrleel.dgrvvd.............................sledllk.daDvviiatp-------
00367851   1/1  rsl.........ekaealaael.......g..gveavelDvtdeasldaal.gdaDvvinaapv------
00355351   1/1  drdpe.........kveelaelgapvakylpglell...grlrattdleeala.daDvvilavpt.pavr
00526101   1/1  ----------------------------------------------------------------------
00470321   1/1  GaGgiGravaralaaaGakrvvvanrtpekaeelaeelggeavsldelaealaeaDivinatp-------
00467601   1/1  vlviekgpllggqtllllggtclnvgcipskllllaallpellelleglgvefdleekgvdldglrlayd
00503221   1/1  ----------------------------------------------------------------------
00466731   1/1  idpe------------------------------------------------------------------
00382852   2/2  ---------------------------------------------------------------srPrvlp
00360162   2/2  -----------------------------------------------------------------prklg
00354771   1/1  llvevvlldrsealealegvaldlsd......galavlldltdtddlaealk..........gadvvv--
00481861   1/1  drs-------------------------------------------------------------------
00497391   1/1  ----------------------------------------------------------------------
00509101   1/1  nrtp------------------------------------------------------------------
00502691   1/1  rspeklealaalgaevaaslaeala---------------------------------------------
00489981   1/1  ----------------------------------------------------------------------
00456211   1/1  evelvlldivealdalkgvaldlsdaalpllldvidtddlyealkgadvvvhtAgvprkpgmtrl-----
00394821   1/1  ----------------------------------------------------------------------
00509612   2/2  ----------------------------------------------------------------lPrllp
00488662   2/2  ---------------------------------------------------------------srprvlp
00487551   1/1  drnp------------------------------------------------------------------
00471251   1/1  ----------------------------------------------------------------------
00352901   1/1  drn.........tenleeavkeaDivivavg---------------------------------------
00363002   2/2  ----------------------------------------------------------------------
00472421   1/1  ----------------------------------------------------------------------
00366641   1/1  kwlllggllgrelagktvgviGlGniGlavarrlaalGakVivydrspralee...........lgadvv
00495871   1/1  ----------------------------------------------------------------------
00421801   1/1  ralalalaaagaevvvvnrt.........lekaeelaeelga.............qgdvsdleeleeal.
00485851   1/1  vDideeklegvaldlsdalapllvdgvivttdlyealkdadvvvitagvprkpgmsrldllvrna-----
00478891   1/1  ----------------------------------------------------------------------
00497301   1/1  rr--------------------------------------------------------------------
00512131   1/1  vDise-----------------------------------------------------------------
00513051   1/1  iwrllpllglelagktvgviGlGriGravarrlaafGaeVivydrspeaaealelga.............
00455192   2/2  ----------------------------------------------------------------------
00484451   1/1  ----------------------------------------------------------------------
00406511   1/1  ideer-----------------------------------------------------------------
00452431   1/1  wrasdllglelkgktvgviGlGriGlalarllaalGakVivydrspekleeldglgvdsleellke....
00523291   1/1  r---------------------------------------------------------------------
00387841   1/1  drd-------------------------------------------------------------------
00502011   1/1  ----------------------------------------------------------------------
00457121   1/1  ----------------------------------------------------------------------
00517971   1/1  rspe------------------------------------------------------------------
00480271   1/1  ldpervellaellgvlvvvgdatdpevLeeagiedadav-------------------------------
00502281   1/1  aldrrtsagklln...........epgvevvegdltdpd.........dlekalk.gvDvvihaagtsrv
00480092   2/2  ----------------------------------------------------------------------
00480452   2/2  ----------------------------------------------------------------------
00533222   2/2  ----------------------------------------------------------------------
00406192   2/2  -----------------------------------------------------------------prvlp
00384492   2/2  ----------------------------------------------------------------------
00483652   2/2  ----------------------------------------------------------------------
00472702   2/2  ----------------------------------------------------------------------
00481082   2/2  ----------------------------------------------------------------------
00368892   2/2  ----------------------------------------------------------------------
00384682   2/2  ---------------------------------------------------------------ftprvlp
00485842   2/2  ----------------------------------------------------------------rPrvpp
00488652   2/2  ----------------------------------------------------------------------
00447052   2/2  ---------------------------------------------------------------arprllp
00363012   2/2  ----------------------------------------------------------------------
00475652   2/2  ----------------------------------------------------------------------
00479092   2/2  ----------------------------------------------------------------------
00469722   2/2  ----------------------------------------------------------------------
00482002   2/2  ----------------------------------------------------------------------
00496792   2/2  ----------------------------------------------------------------------
00481992   2/2  ----------------------------------------------------------------------
00366542   2/2  ----------------------------------------------------------------------
00472712   2/2  -----------------------------------------------------------------Prlpd
00529642   2/2  ----------------------------------------------------------------ePripd
00364592   2/2  ----------------------------------------------------------------------
00457982   2/2  ----------------------------------------------------------------------
00380742   2/2  ----------------------------------------------------------------------
00469732   2/2  ----------------------------------------------------------------------
00509602   2/2  ----------------------------------------------------------------------
00376432   2/2  ----------------------------------------------------------------------
00419402   2/2  ----------------------------------------------------------------------
00467612   2/2  ----------------------------------------------------------------------
00488072   2/2  ----------------------------------------------------------------------
00374372   2/2  ----------------------------------------------------------------------
00454812   2/2  ----------------------------------------------------------------------
00445592   2/2  ----------------------------------------------------------------------
00455182   2/2  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           IPGADAPFVVDGHAVLAGTAQIGERVLLTAAEDHMQPLTIAGYLADHGHHVHLVYQTPGPAPLVGKYTIG
00383081   1/1  ----------------------------------------------------------------------
00426111   1/1  ----------------------------------------------------------------------
00448031   1/1  ----------------------------------------------------------------------
00384291   1/1  ----------------------------------------------------------------------
00486611   1/1  ----------------------------------------------------------------------
00389721   1/1  ----------------------------------------------------------------------
00424451   1/1  ----------------------------------------------------------------------
00364571   1/1  ----------------------------------------------------------------------
00514891   1/1  ----------------------------------------------------------------------
00467211   1/1  ----------------------------------------------------------------------
00447601   1/1  ----------------------------------------------------------------------
00488071   1/2  lpgld...lpgkrvvviGggdiglelalalar--------------------------------------
00364591   1/2  lAtGarpntllllrggivvdeylrtsv-------------------------------------------
00491501   1/1  advarllaarlvrlldgleleadalilatGarprlllpipgldlfgvlgrvllssdlllgllllgkrvvv
00497081   1/1  ----------------------------------------------------------------------
00529631   1/1  wfpvfpgrkelldyladlaeklgveirlnteVtsverdgdgvtvttedgepdgeeetleadaVvlAtGal
00374411   1/1  ld..fevlladgeeleadalilatGarprllpipgfdgkgvltardlldll.flgkrvvviGg..gvsgl
00471411   1/1  lrprllpipgldlpgvlgvhsllsavllgllllgkrvvvigggdigllaelalalarlga----------
00458701   1/1  lvltsdlnalllelradalilatgalprlppipgldlgevlhsagyeellrrlgldllgkrvvvigg..g
00470221   1/1  lntlvvaldpdalevlledleelradavvlAtGsrprlppipgedlggvlhsallldll...gkrvvvig
00461561   1/1  lsprllgipgedlpgvvlaldflllgnllpgkrvvviGgalrlldgvign..taldvartlarlgakvtl
00499901   1/1  leleadavvlatGalsllprlpdipgldlfsleellsalglldllgkrvvvigg..gasgvdlaellarl
00435771   1/1  dladllaellaladgllleadavilAtGarprlppipgldlkgvltsrdll...dllgkrvvviGgGas.
00492221   1/1  lgtevtdilrdggrvtgvttedllvdkngvevtdgdggtiradavvlAtGarprllel------------
00503631   1/1  irlgtevtsidfdedgvvvgvttedGetieadavvlAtGalsrprlppsipgldltfkggvtlsavw...
00480161   1/1  lAtGatkprllgipgldldgvysaldflfgynllldglyllgllargkrvvviGggntaldvartllrlg
00471401   1/1  ----------------------------------------------------------------------
00485831   1/1  gllillgvevvvgvadgggvtvvtgdgetiradavilAtGarsrvppipgldlpgvltsrtaldllfl.g
00460571   1/1  .dalllalgapprlldapelrellp....vvvpgggvvdpaalleal.......................
00462701   1/1  latGarprllpipgld...llgglvvvigggviglelaral.............................
00475641   1/1  aelaeklgveillgtavtellkddggvvvtgdgetiradavilAtGarsrvppipgldgpgvltsdtale
00360921   1/1  aglglggssainagvylrvspadfdelgawgvtlddlepyfelaadalvlatGsrprlpplpglelggvl
00463442   2/2  qlpipgadlarvltleevllgkaktgkrVlVvdgGgGpaGleaAealarrGheVtlvealdrlggllrlg
00464461   1/1  vllatGarprllpipgld...llggrvvvigggviglelaral...........................
00490031   1/1  gleadalllatGapprlldipgld...llggrvvvigggvdglelaralae...................
00397811   1/1  ----------------------------------------------------------------------
00455191   1/2  lllglenggivv----------------------------------------------------------
00457971   1/1  etitltadavvlAtGsrprllpipgldlegvltsptsildalalllellpgklv.viggGai........
00479091   1/2  lvilAtGa--------------------------------------------------------------
00503641   1/1  fgtevtsvdrdgwtvtgeeltleadavvlatGasvprlpdipgldlfggllahsflrrkirelvkdpela
00488651   1/2  dlvvlatGarpntppipgldllgvldv-------------------------------------------
00484941   1/1  pdgkvlgyd....lglgalpdspealgleefpgrvvvigggyi..glelagkrvrvgg..akvtllqrrp
00462741   1/1  leflskvngveyiegrasfldagkwevltedgwgifeeeltadaviiatGarpripdlipgl.gggvlts
00509601   1/2  latGsrpntpllpglelderggilvdetlrtsvpgvf---------------------------------
00463441   1/2  ----------------------------------------------------------------------
00467501   1/1  lAtGarprllpipgldlegvltlrtlldalalrealldlllllkgkrvvvvGgGliGlelaaalae----
00480451   1/2  ----------------------------------------------------------------------
00486071   1/1  eklgveirlgtal---------------------------------------------------------
00400351   1/1  latgadprllgipgldydfllpgvhsaedalg.............ldllgkrvvviGggysgvelaeala
00533221   1/2  ----------------------------------------------------------------------
00518991   1/1  ----------------------------------------------------------------------
00470681   1/1  rvtgidpdgvtvtladgetitadklvlAtGarprllpipgldlpgvlvlrtlddalalrellaallpkrv
00480091   1/2  ----------------------------------------------------------------------
00529261   1/1  ipgalldagfpydgllfvfgg...............................................gf
00413411   1/1  atgarpripplpglgvpgvltsdgalalrepgkrvvviggglsglel.....................lv
00406021   1/1  ipglelp.................................ggrvvvigggviale...............
00384491   1/2  ----------------------------------------------------------------------
00368891   1/2  ----------------------------------------------------------------------
00362581   1/1  ----------------------------------------------------------------------
00482001   1/2  ----------------------------------------------------------------------
00533211   1/1  .....................................lelaellarlgaevlrlllglltllergdrllp
00468341   1/1  ......................................................lalrllgpdvtggerr
00440981   1/1  eadavvlAtGarprllglpgldlpggl...........................................
00488661   1/2  ----------------------------------------------------------------------
00523131   1/1  VrtadGetlradavvlAtGafsrlllllglelpvgptlgyalvtdllellgkrvvvvgggktgtelaldl
00424461   1/2  ----------------------------------------------------------------------
00487711   1/1  lr.....................................elaealralgvdvelldaaelraleplldlp
00366541   1/2  ----------------------------------------------------------------------
00399921   1/1  ----------------------------------------------------------------------
00483651   1/2  ----------------------------------------------------------------------
00501481   1/1  etieadavilAtG...........................................vlvaigrrpntell
00472701   1/2  etleadavvlA-----------------------------------------------------------
00447051   1/2  ----------------------------------------------------------------------
00406191   1/2  ----------------------------------------------------------------------
00363001   1/2  AtGarprvlllpglellegagleldggivvdey-------------------------------------
00465141   1/1  lppldglllpgvgdvl................................................gaelaa
00477121   1/1  raellralleaaeelgveirlgtrvtsileedgdgvtvtledggeeetieadlvvgAdGarsrvrrllgi
00472711   1/2  ----------------------------------------------------------------------
00520321   1/1  tG.rpfdlpipglelfgvrglltlldalkleplllssdlaggllypgkrvvvigggaille.........
00475651   1/2  ----------------------------------------------------------------------
00509611   1/2  ----------------------------------------------------------------------
00526001   1/1  lglglatglagrglavprgrvlggssvingavylradaidfatgargipgwdldgvlpyfdrledslgvl
00485841   1/2  ----------------------------------------------------------------------
00529111   1/1  eelgveirlgteVtdilvdgggvlwtvrvtGVvvndtgvaldgllkllvdpllllkllldle--------
00376431   1/2  tiradavvlAtGarpntplle-------------------------------------------------
00483561   1/1  pipgrdlgglllardaldldalpkrlavl...gggllgvdelaellpllgsevtgglrsprggtvdparl
00467611   1/2  ----------------------------------------------------------------------
00529171   1/1  ----------------------------------------------------------------------
00496791   1/2  ----------------------------------------------------------------------
00469721   1/2  ----------------------------------------------------------------------
00384681   1/2  ----------------------------------------------------------------------
00481991   1/2  ael-------------------------------------------------------------------
00524811   1/1  ----------------------------------------------------------------------
00406601   1/1  vvnalpdeaeallaelgvlfpigyaellpfyerleklygvlgegylpdlpgasifkglpvhssfddreld
00359891   1/1  dipgldelggllsldal........ggrvvvigggviglelaral.........................
00509271   1/1  ltad..vlAtGarprllllllvpgipgfdgkgvhtartlldldllgkrvvviGggaiglelal.......
00411521   1/1  ----------------------------------------------------------------------
00501351   1/1  ----------------------------------------------------------------------
00457951   1/1  alvlaigledadelarlgkrvavlgggel.......................lladgvtgglr.pdggrv
00481081   1/2  ----------------------------------------------------------------------
00464161   1/1  .....................................................................e
00380741   1/2  elgvevllgtavtiddgrVt--------------------------------------------------
00465791   1/1  laealrrlgvpvellspeelkellplldfpeflgglytprggtvdpael---------------------
00454811   1/2  lel-------------------------------------------------------------------
00469731   1/2  ----------------------------------------------------------------------
00471331   1/1  ..............................................lelaelleelgvevtllellggdr
00406881   1/1  .........................................................plllrvlgaelaa
00483641   1/1  tleydklvlAtGarp.......................................................
00363011   1/2  ----------------------------------------------------------------------
00480291   1/1  ----------------------------------------------------------------------
00419401   1/2  ----------------------------------------------------------------------
00473271   1/1  llavrgde.dlleakalllatg..pylpllpglsleevldsl...lgldllpklvlvigg..gviglela
00457981   1/2  ----------------------------------------------------------------------
00382851   1/2  ----------------------------------------------------------------------
00400491   1/1  .lgipgsdlpgvllalgkrvvvvgggviglelaaal..................................
00498481   1/1  ----------------------------------------------------------------------
00476511   1/1  ----------------------------------------------------------------------
00360161   1/2  ----------------------------------------------------------------------
00458811   1/1  llgkgvgglsaingvvlergsaedydalipatgaedflgglflpaegilgatgsepfllp..gvsllrvl
00461281   1/1  ggsslingmvylrglpedldelakllgvegwgydellpyfkvae........dglgltadaiiiatgsrp
00396641   1/1  ilatgappavleleglgvpflrtsdgaldlk...gglvavigg..gsiarela.................
00445591   1/2  ----------------------------------------------------------------------
00463571   1/1  ----------------------------------------------------------------------
00470291   1/1  ..ldgrrllfprgkvlGGsssinggvylrgskndfdlwaglaglegwsydellpyfkkaekliiatgsrp
00514421   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00374371   1/2  avetleellgeaDvvivaagippat---------------------------------------------
00455181   1/2  lgveillgtrvtidggvvgvtt.dge.tiradavil----------------------------------
00444131   1/1  dvsdylefrlldgrvvfpdgkvlkvptnlaellksfllglsekrrllaflgviatgdrpralgipgldld
00529641   1/2  ----------------------------------------------------------------------
00465991   1/1  ----------------------------------------------------------------------
00500031   1/1  ----------------------------------------------------------------------
00423421   1/1  atgdpevnelvada--------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00504431   1/1  lavlaeleallkpgail-----------------------------------------------------
00425341   1/1  p---------------------------------------------------------------------
00511641   1/1  ----------------------------------------------------------------------
00423401   1/1  tadleelva.eaDvvinaagipgatapllvtrellelmkpgsvivdvaidqgglvealrp----------
00515981   1/1  ----------------------------------------------------------------------
00476821   1/1  ....elglegrgillprgkvlGGsslinggvlvrglpedfdalglgwsyeellpyfkkaekllgvlgalr
00472781   1/1  ----------------------------------------------------------------------
00470261   1/1  ----------------------------------------------------------------------
00496291   1/1  ----------------------------------------------------------------------
00486871   1/1  ell-------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00533831   1/1  ......................................................................
00517371   1/1  ----------------------------------------------------------------------
00481021   1/1  ----------------------------------------------------------------------
00424462   2/2  ipgidlggvlhaldfldpkalkgkkVaviGaGpaG.......laaAlyLarlGaevtvierrprlggtll
00531721   1/1  ----------------------------------------------------------------------
00450461   1/1  ----------------------------------------------------------------------
00480351   1/1  gplldlt....ledwervldvnllgtflltraalplm---------------------------------
00475101   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00355351   1/1  svlaelapllkpgaivvdlstglvgtieallaallegvlalagldvldaplsgpe---------------
00526101   1/1  ----------------------------------------------------------------------
00470321   1/1  ----------------------------------------------------------------------
00467601   1/1  klv...................................................................
00503221   1/1  ----------------------------------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00382852   2/2  ipgldlegvlllrtledalellellelpkrvvviGgGliGlelAaalre..........llpklglevtl
00360162   2/2  iPGedlpgvfsardfvawynglpdaallepdltgkrVvviGgGpaGldaArlllksldellktdindlal
00354771   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00497391   1/1  ----------------------------------------------------------------------
00509101   1/1  ----------------------------------------------------------------------
00502691   1/1  ----------------------------------------------------------------------
00489981   1/1  ----------------------------------------------------------------------
00456211   1/1  ----------------------------------------------------------------------
00394821   1/1  ----------------------------------------------------------------------
00509612   2/2  ipglegvlllrtlldsdlllellelpkdvvviGgGpaG..............leaAlalarlglkVtlie
00488662   2/2  ipgldlegvlllrtlldsdallellalpkdvvviGgGpaG..............leaAaalarlgakvtl
00487551   1/1  ----------------------------------------------------------------------
00471251   1/1  ----------------------------------------------------------------------
00352901   1/1  ----------------------------------------------------------------------
00363002   2/2  -------------------------------------lsaAlelaragldvtvlergprlggcllllsvp
00472421   1/1  ----------------------------------------------------------------------
00366641   1/1  sleellae............--------------------------------------------------
00495871   1/1  ----------------------------------------------------------------------
00421801   1/1  ggaDivvnatgaglpglllelllellkpggvvvdvaypplltt---------------------------
00485851   1/1  ----------------------------------------------------------------------
00478891   1/1  ----------------------------------------------------------------------
00497301   1/1  ----------------------------------------------------------------------
00512131   1/1  ----------------------------------------------------------------------
00513051   1/1  ................tvvsleella.eaDvvilavpltpetkglinael--------------------
00455192   2/2  -------------------------------------leaAlalarlgakvtlierrdrllgtldpelsk
00484451   1/1  ----------------------------------------------------------------------
00406511   1/1  ----------------------------------------------------------------------
00452431   1/1  ...........................aDvvilavpltpetkglinaellallkpga-------------
00523291   1/1  ----------------------------------------------------------------------
00387841   1/1  ----------------------------------------------------------------------
00502011   1/1  ----------------------------------------------------------------------
00457121   1/1  ----------------------------------------------------------------------
00517971   1/1  ----------------------------------------------------------------------
00480271   1/1  ----------------------------------------------------------------------
00502281   1/1  deslkdalgtnvigtssalrllnlleaa------------------------------------------
00480092   2/2  -------------------------------------leaAlalarlgaevtvvergdrlgglldeelsl
00480452   2/2  -------------------------------------leaAlalarlgakvtlverrdrlgglldpelaa
00533222   2/2  -------------------------------------leaAlalarlgaevtvvergdrlgglldeelsl
00406192   2/2  ipGedlcgvlslrdfvgdynlhpaawllppdltgkrVvviGaGpaGldaArellkdldlllktdisdnal
00384492   2/2  -------------------------------------leaAlalarlglkvtvver.drlggtldcilsk
00483652   2/2  -------------------------------------leaAlalarlGakVtviergdrlggrlldeela
00472702   2/2  -------------------------------------leaAlalarlglkvtlierglGgtllnggpgls
00481082   2/2  -------------------------------------lelAaalarllpelgaeVtlvergdrllpglld
00368892   2/2  -------------------------------------leaAlalarlglkvtliergdrlgglldpelaa
00384682   2/2  ipgeeacglltade.pvailflerlihsyavkdgppftgkdVaViGaGpaGldaAlylarlgakkvtlve
00485842   2/2  ipgldlvltsddlldleelpkdvvviGgGviG..............leaAlalarlgakvtvvergdrll
00488652   2/2  ----------------------------------mlpkdvviiGgGpaGleaalalarlglklevtlier
00447052   2/2  ipgedlflgkgvltsatilgalllfkgkdvvviGgGpaG..............leaAlylarlgakvtli
00363012   2/2  -------------------------------------leaAaalrrlglevtlvergdrlllpylrpels
00475652   2/2  -------------------------------------leaAlalarlgakvtvvereprlggtldpelsk
00479092   2/2  -------------------------------------ltaAlelakaGakvtlverdpr......pelal
00469722   2/2  -------------------------------------leaAlalarlgakvtliergdrllglldpelsk
00482002   2/2  -------------------------------------leaAlalarlglkvtlvergdrlggtldpelsk
00496792   2/2  -------------------------------------leaAlylarlglkvtlierrdrlg..gdpelle
00481992   2/2  -------------------------------------laaAaylarlGlkvlliekgprlggtclnvgci
00366542   2/2  -------------------------------------leaAaalarlgakvtvvergdrlggtldpelsk
00472712   2/2  ipglelflgkgvhtsatldgllfkgkdvvviGgGpaG..............leaAlalarlglkvtller
00529642   2/2  ipglleefkgkvlhsaayrdpedfkgkrVvViGaGaSg..............ldialelakvaksvtlle
00364592   2/2  -------------------------------------laaAlalaraGlkvtllekgdrlggrlllvggi
00457982   2/2  -------------------------------------lelAsalrrlgpdaaevtlvergdrllpyldpe
00380742   2/2  -------------------------------------laaAlrlaraGlkvlllekgdlgggclnvgcip
00469732   2/2  -------------------------------------leaAaalarlgaevtlvergdrllpyldcelsk
00509602   2/2  -------------------------------------kdvvviGgGpaGleaAlalar.glkvtliergd
00376432   2/2  -------------------------------------laaAlalaraglkvlllekgprlggllvglips
00419402   2/2  -------------------------------------leaAsalrrlgaevtliergdrllplldeelsl
00467612   2/2  -------------------------------------leaAlalarllpegakvtlvergdrllpcldpe
00488072   2/2  -------------------------------------laaAlalaraGlkVtllEardrlggrlllsggi
00374372   2/2  -------------------------------------leaAaalarlGakVtvvdrrpe...........
00454812   2/2  -------------------------------------laaarlllrlGaevtvldrrdrpggl.......
00445592   2/2  -------------------------------------lalAlllaaagggdVtlvDidpekleglaadll
00455182   2/2  -------------------------------------laaAlrlaeaGlkvlvlEkgdrlgglsnrngip


                         -         -         -         *         -         -         -:630
query           APLAKLTAAGAAFTFMQRVVQIEEGRVATRNIYSDIPGEITGFDSVVVAAGGVPDDSLYHELKRHGKANV
00383081   1/1  ----------------------------------------------------------------------
00426111   1/1  ----------------------------------------------------------------------
00448031   1/1  ----------------------------------------------------------------------
00384291   1/1  ----------------------------------------------------------------------
00486611   1/1  ----------------------------------------------------------------------
00389721   1/1  ----------------------------------------------------------------------
00424451   1/1  ----------------------------------------------------------------------
00364571   1/1  ----------------------------------------------------------------------
00514891   1/1  ----------------------------------------------------------------------
00467211   1/1  ----------------------------------------------------------------------
00447601   1/1  ----------------------------------------------------------------------
00488071   1/2  ----------------------------------------------------------------------
00364591   1/2  ----------------------------------------------------------------------
00491501   1/1  iG..ggaiglelalalarlgaevtlversprlgpvlpaglsealaealeallGveirlgtrvteierdgg
00497081   1/1  ----------------------------------------------------------------------
00529631   1/1  srprllgllpdipgldlfggrvlhsalyldnldllplykhlfppkgkrvvviGggas..gldpplaelda
00374411   1/1  elaealarllkilgaevtllersdrllallddegqvdprglldalaealeellgveirlgtrvteierdg
00471411   1/1  ----------------------------------------------------------------------
00458701   1/1  asavela.alaragasvtlllrsprlglltprggygalvealakalendylealarlgveirlgtrvtei
00470221   1/1  g..gasgldlaellarlgaevtvvlerrdrlllffppdgqvdpaglvralaealeallgveirlgtrvte
00461561   1/1  verrglllpatpeelra.....lleegvelllltspveilgdgrvvgvvlv-------------------
00499901   1/1  garvtllerldgll.lpgdgvldpkgglgallealleelgveillgtpvtei...............Ge.
00435771   1/1  .gldiaealarlgaevtvverrprllalldalalllgllsldalaalepllalellggllypdggpaalv
00492221   1/1  ----------------------------------------------------------------------
00503631   1/1  ...........sdgalallgllvdllpkrvvviGgGsglelasalarlgakvtlverrprllprldpelv
00480161   1/1  asvtlverrgrllapaspkelre....lleegveflfladpveidgdgrvvg------------------
00471401   1/1  ----------------------------------------------------------------------
00485831   1/1  krvvviGgG..yi---------------------------------------------------------
00460571   1/1  ..................aeaaeelGveirlg.rvtsi..............dGetleadlvvlatGags
00462701   1/1  .............aeaaeelgveillgtrvteilvdeggrvtgvtlrd.adGeevtira.davvlatGgl
00475641   1/1  ll.llpkrvvvi----------------------------------------------------------
00360921   1/1  ltaaealgldflgkrvvvigg..gasgvelasalarlgagvtvvyrpdgg....rgalaralaraaeaag
00463442   2/2  ipdpllerleelgveillgvavteilgdgvel......geeleleaDlvvlatgftpndeldealrtsvp
00464461   1/1  ...............aeaaeelgveillgtrvteilvdeggrvtgvtted.adGeeltira.davvlatG
00490031   1/1  .......................aaeelgveillgtrvtellvdeggrvtgvvledadGeevtiradavv
00397811   1/1  ----------------------------------------------------------------------
00455191   1/2  ----------------------------------------------------------------------
00457971   1/1  ......................................................................
00479091   1/2  ----------------------------------------------------------------------
00503641   1/1  elltplllflgkrvvvigggysgv...........................-------------------
00488651   1/2  ----------------------------------------------------------------------
00484941   1/1  pfvlpllllglllllllllglspdhligagplrggcdyrgggvfgcpggaglvlggrgslaeallealee
00462741   1/1  ddyldledlpgklvdfvllalalaiaviGgg..asglelasalarlgakvtllersgrllppgglgelvk
00509601   1/2  ----------------------------------------------------------------------
00463441   1/2  ----------------------------------------------------------------------
00467501   1/1  ----------------------------------------------------------------------
00480451   1/2  ----------------------------------------------------------------------
00486071   1/1  ----------------------------------------------------------------------
00400351   1/1  rlgapvtlldrsplarlppgllspgdglldggdgalvaalaealerlgveillgtrvteilrdgggvtgV
00533221   1/2  ----------------------------------------------------------------------
00518991   1/1  ----------------------------------------------------------------------
00470681   1/1  vvv-------------------------------------------------------------------
00480091   1/2  ----------------------------------------------------------------------
00529261   1/1  igledargllrlgagvtvvdrgd.........llralaeaaeelGveirlgteVtsierdedgrvtgVtt
00413411   1/1  grgdgaalaralaeaaealgveiltgtevteilrdeggrvtgVvtadt...kdGeevtiradavvlatGa
00406021   1/1  ...eaaeelgveiltgtevtei.dg..vvgvvled..GeeltieadlvvlatGarsnlrlllgldlpkel
00384491   1/2  ----------------------------------------------------------------------
00368891   1/2  ----------------------------------------------------------------------
00362581   1/1  ----------------------------------------------------------------------
00482001   1/2  ----------------------------------------------------------------------
00533211   1/1  ....ellrallealeelgveirlgt.vtei.dggvvgvtled...GeeetleadlvvlatGsvvrlllgv
00468341   1/1  pragvvdraellralleaaeelGngrveirlgtrvtsierdgelledleeypvtvtlenlseeeakpeel
00440981   1/1  .........................................................ealglelderggi
00488661   1/2  ----------------------------------------------------------------------
00523131   1/1  rsigasvtlfqpgdrllppfspelaaallr----------------------------------------
00424461   1/2  ----------------------------------------------------------------------
00487711   1/1  dllgglyvpdggvvdpaalaaalaraaealGveirlgtevtgierdggrvtgVrtad......Ge.iead
00366541   1/2  ----------------------------------------------------------------------
00399921   1/1  ----------------------------------------------------------------------
00483651   1/2  ----------------------------------------------------------------------
00501481   1/1  klglelderggivvdelllrtsvpgvfaaGdvaggplrl-------------------------------
00472701   1/2  ----------------------------------------------------------------------
00447051   1/2  ----------------------------------------------------------------------
00406191   1/2  ----------------------------------------------------------------------
00363001   1/2  ----------------------------------------------------------------------
00465141   1/1  alaealeelgveillgtrvtei.dggvvgvttedg...etieadavvlAtGarslllllgrrpntellgl
00477121   1/1  p.....................................................................
00472711   1/2  ----------------------------------------------------------------------
00520321   1/1  ....................................alaeaaeelGveiltgtevteierdggrvtgVtv
00475651   1/2  ----------------------------------------------------------------------
00509611   1/2  ----------------------------------------------------------------------
00526001   1/1  glpflgkrvvviGggpigve..............faealarlgakvtlvergglllpgdgvgdraslara
00485841   1/2  ----------------------------------------------------------------------
00529111   1/1  ----------------------------------------------------------------------
00376431   1/2  ----------------------------------------------------------------------
00483561   1/1  vralaeaaeelGveillgtevtsierdggvvgVttedG......e.iradlvvlAtGawsp.ell-----
00467611   1/2  ----------------------------------------------------------------------
00529171   1/1  ----------------------------------------------------------------------
00496791   1/2  ----------------------------------------------------------------------
00469721   1/2  ----------------------------------------------------------------------
00384681   1/2  ----------------------------------------------------------------------
00481991   1/2  ----------------------------------------------------------------------
00524811   1/1  ----------------------------------------------------------------------
00406601   1/1  ldgkrvvv....igsgasavrakavviatGareralpapgldllgrspagalpllsrrflvdllpkllla
00359891   1/1  ...leaaeelpgveillgtevteilgdgdgvtvttgrvtgvvlrdladGeevtiradlvvlatGarsnll
00509271   1/1  ......................................................................
00411521   1/1  ----------------------------------------------------------------------
00501351   1/1  ----------------------------------------------------------------------
00457951   1/1  dparlvrallealeelGveillg.evteierdg..........dGe...adlvv----------------
00481081   1/2  ----------------------------------------------------------------------
00464161   1/1  elaaalaealeelgveillgtevt.iedgrv..gvtled..geeltleadlvilatGrrslPlllpntel
00380741   1/2  ----------------------------------------------------------------------
00465791   1/1  ----------------------------------------------------------------------
00454811   1/2  ----------------------------------------------------------------------
00469731   1/2  ----------------------------------------------------------------------
00471331   1/1  vlprldldgpellkallealeklgv.illgtveilgddggv..gvtled..GeeetieadlvvlAtGgls
00406881   1/1  alaealeelgveillgtavve.dggrvtl.......dgetieadlvvlAtGarsllllgrrpntelllle
00483641   1/1  ................................................................vvvaig
00363011   1/2  ----------------------------------------------------------------------
00480291   1/1  ----------------------------------------------------------------------
00419401   1/2  ----------------------------------------------------------------------
00473271   1/1  ellarlgaevtvlergdgllgggdgqiyprggagallealak.gveirlntev-----------------
00457981   1/2  ----------------------------------------------------------------------
00382851   1/2  ----------------------------------------------------------------------
00400491   1/1  ........aealealpgveillgtevtellgdggrvtgvvledgetgeevtira.davvlatGgrpnlel
00498481   1/1  ----------------------------------------------------------------------
00476511   1/1  ----------------------------------------------------------------------
00360161   1/2  ----------------------------------------------------------------------
00458811   1/1  dsagals.lafrgkrvvvrltyddnyfndeyqglpereklltlviiGgGn....dpgklaralaealekr
00461281   1/1  rypgipg...plsvswaldl...delpkrlv..vigggaiglelapflarlgak----------------
00396641   1/1  .............laeaalklgveilegtevtellgdgdgkgrvtgvvtkdlktgevgtira.davvlat
00445591   1/2  ----------------------------------------------------------------------
00463571   1/1  ----------------------------------------------------------------------
00470291   1/1  llpdlpg.glllggdgiltselalsldllpklvvvigggaig..lelapvlarlgakvtgvgrlprglpv
00514421   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00374371   1/2  ----------------------------------------------------------------------
00455181   1/2  ----------------------------------------------------------------------
00444131   1/1  d.lslfellerfllldllpklllilgggligle..............paelsar----------------
00529641   1/2  ----------------------------------------------------------------------
00465991   1/1  ----------------------------------------------------------------------
00500031   1/1  ----------------------------------------------------------------------
00423421   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00511641   1/1  ----------------------------------------------------------------------
00423401   1/1  ----------------------------------------------------------------------
00515981   1/1  ----------------------------------------------------------------------
00476821   1/1  ...................kllvvigggaiglglalvldrlgakvtgvgrldrglptggrgslakallra
00472781   1/1  ----------------------------------------------------------------------
00470261   1/1  ----------------------------------------------------------------------
00496291   1/1  ----------------------------------------------------------------------
00486871   1/1  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00533831   1/1  ..............................alkvdtddeealldaDlvila-------------------
00517371   1/1  ----------------------------------------------------------------------
00481021   1/1  ----------------------------------------------------------------------
00424462   2/2  algripakllglealllrllllllglglllpipgrvlpkellealaealek-------------------
00531721   1/1  ----------------------------------------------------------------------
00450461   1/1  ----------------------------------------------------------------------
00480351   1/1  ----------------------------------------------------------------------
00475101   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00526101   1/1  ----------------------------------------------------------------------
00470321   1/1  ----------------------------------------------------------------------
00467601   1/1  ......................daelaaalaelleklgvevllgt.vteiegddgrvtgvvvvrle....
00503221   1/1  ----------------------------------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00382852   2/2  veagdrllpryldpelsklllelleelgvelllgtkvtsiegdgdgvvvt--------------------
00360162   2/2  ealkrlggkeVtvveRrgpleapftlkelrelggllrygippdpldlalle-------------------
00354771   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00497391   1/1  ----------------------------------------------------------------------
00509101   1/1  ----------------------------------------------------------------------
00502691   1/1  ----------------------------------------------------------------------
00489981   1/1  ----------------------------------------------------------------------
00456211   1/1  ----------------------------------------------------------------------
00394821   1/1  ----------------------------------------------------------------------
00509612   2/2  rgdrlgg.ldpelskallelleklgvelllgtevteidgd.......vvlg-------------------
00488662   2/2  vergdrlggtlldeelaaallelleklgvevllgtrvtaidvdgdgvtvtl-------------------
00487551   1/1  ----------------------------------------------------------------------
00471251   1/1  ----------------------------------------------------------------------
00352901   1/1  ----------------------------------------------------------------------
00363002   2/2  ggrldpeelvlalaelleelgvevrlgtevtsidrdgdgvtle......dgetleadavvlAtGarprvl
00472421   1/1  ----------------------------------------------------------------------
00366641   1/1  ----------------------------------------------------------------------
00495871   1/1  ----------------------------------------------------------------------
00421801   1/1  ----------------------------------------------------------------------
00485851   1/1  ----------------------------------------------------------------------
00478891   1/1  ----------------------------------------------------------------------
00497301   1/1  ----------------------------------------------------------------------
00512131   1/1  ----------------------------------------------------------------------
00513051   1/1  ----------------------------------------------------------------------
00455192   2/2  allelleklgvevllgtevteidg............dgetleadavliAtGarp----------------
00484451   1/1  ----------------------------------------------------------------------
00406511   1/1  ----------------------------------------------------------------------
00452431   1/1  ----------------------------------------------------------------------
00523291   1/1  ----------------------------------------------------------------------
00387841   1/1  ----------------------------------------------------------------------
00502011   1/1  ----------------------------------------------------------------------
00457121   1/1  ----------------------------------------------------------------------
00517971   1/1  ----------------------------------------------------------------------
00480271   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00480092   2/2  lllelleklgvelllgtrvtaidvdgdgvtvtled..ggeeetleadlvvl-------------------
00480452   2/2  allelleklgvelllgtrvtaidldgggvtvtledg..etleadlvvlAtG-------------------
00533222   2/2  allelleklgvelllgtrvtaidvdgdgvt..vtledggeeetleadlvvl-------------------
00406192   2/2  eallarlgaevtvvgRrgpliaaftlkelerlpelggllrygipedkllke-------------------
00384492   2/2  allelleelgvevllgtevteveldgggvvvvlgltvevvvlgdgetlead-------------------
00483652   2/2  lallelleklgvelllgtevteidgdgggv...vvltdgetleadlvvlA--------------------
00472702   2/2  kplllrvlgpelaeylrelleklgveillgtrvtsidrdgdtgrvtgvtledg......etleadavvlA
00481082   2/2  eelaelllelleklgvelllgtkvteidgdgkgvtvtled..getleadlvll-----------------
00368892   2/2  allelleklgvevllgtevtaidvdgdgvtvtll.ldgdgetleadlvv---------------------
00384682   2/2  rrdrlgfpafp.....elvellkeegveillgtavleilgddgkvtgvrvv-------------------
00485842   2/2  gtldpelsklllelleklgvdlllgtkvtaidrdgdgvtvvlllkdgdgetl------------------
00488652   2/2  gdrlggtllplgpgpllglldaeelaeylrelleklgvevllgtevtsidgdgkgvtled......getl
00447052   2/2  errdrlggtld.....lllelleklgveillgtevteiegdgdgftvtlv--------------------
00363012   2/2  kallelleelgvelrlgtevtsidrdgvvldd......gttleadllvlAt-------------------
00475652   2/2  allelleklgvelllgtevtaidgdgdgvvvvlllvdvvlgdgetlead---------------------
00479092   2/2  lllelleklgvevllgtrvteiakeylpelllgveveagdgvvtvvlgdgetieadlvilAtGar-----
00469722   2/2  allelleklgvelllgtevtaidldgdgvtvvtledg......etleadlv-------------------
00482002   2/2  lllelleklgvevllgtevtaiegdgdgvvvvvklvtlgdgetleadlvli-------------------
00496792   2/2  yllelleklgveillgtevteiegdgdgvtgvtledgeltgeeetleadav-------------------
00481992   2/2  pskallkaaelaeliellpglgvelllgglgldlaellerkdavvdgeelaaalaelleelgvevllgta
00366542   2/2  allelleklgvevllgtevtaidvdgdgvtvtvldvvlgdgetleadlvl--------------------
00472712   2/2  rprlggtl.....dlllelleklgveillgtevteidgdgggvtgvtledg-------------------
00529642   2/2  rsdelggpw..............lgvvillnteveevtgdg......vv---------------------
00364592   2/2  pggvlpeelvealaelleklgveirlgtrvt..dgvgvttedg......etieadav-------------
00457982   2/2  lsklllelleklgvevllgtkvtsidrgedgvvvvtle.dgetleadlvl--------------------
00380742   2/2  gkrllaaaelydelrelleelgipfdevllglllllgrggadgaelaaalaelleelgvevllgtavt.i
00469732   2/2  allelleklgvdlllgtkvtaidrdddg.vlvvvledgetleadlvllAtG-------------------
00509602   2/2  rlggtrpllsgvipgklldeelaeylrelleklgvevllgtevtsidgdgkgvtlddg......e.lead
00376432   2/2  kllllrvlgaelaaalaealeelgvevllgtevtsidrdgggvtgvllvttgd......getiradavvl
00419402   2/2  lleelleelgidvllgtevteiekdgdgvlvvvvlgdgetleadlvllA---------------------
00467612   2/2  lsklllelleklgvdvllgtevtaidvddktvtvvtle.dgetleadlvliA------------------
00488072   2/2  pgkvdpaellealaelaeelgveirlgtrv......D.dgetiradavvlAtGarprllplpgldlpgkr
00374372   2/2  .llerleelgakfvlltld...eelvevvlaltvdvsdeegrlkavetleellge---------------
00454812   2/2  ...................lllelgvefvlg..slllellleadlvvlspgvpldhpllelarelgievi
00445592   2/2  dilelllve....................rlitttdleealadaDvviiav-------------------
00455182   2/2  glrlllgalllrllelleelgipfdlpglgglflprggrvdgaelaaalaeaaeelgveillgtrvt.i.


                         -         +         -         -         -         -         *:700
query           HLLGDAYAPRRITFATQQAYALAALV--------------------------------------------
00383081   1/1  ----------------------------------------------------------------------
00426111   1/1  ----------------------------------------------------------------------
00448031   1/1  ----------------------------------------------------------------------
00384291   1/1  ----------------------------------------------------------------------
00486611   1/1  ----------------------------------------------------------------------
00389721   1/1  ----------------------------------------------------------------------
00424451   1/1  ----------------------------------------------------------------------
00364571   1/1  ----------------------------------------------------------------------
00514891   1/1  ----------------------------------------------------------------------
00467211   1/1  ----------------------------------------------------------------------
00447601   1/1  ----------------------------------------------------------------------
00488071   1/2  ----------------------------------------------------------------------
00364591   1/2  ----------------------------------------------------------------------
00491501   1/1  gvtvtte......dGdgeeetieada--------------------------------------------
00497081   1/1  ----------------------------------------------------------------------
00529631   1/1  ralarlgakvt-----------------------------------------------------------
00374411   1/1  ggvtvtledg.dgeeetiea.dlvvl--------------------------------------------
00471411   1/1  ----------------------------------------------------------------------
00458701   1/1  lrdgggvtvttad......Getiead--------------------------------------------
00470221   1/1  ierdgggvtVttad......Getieadl------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00499901   1/1  leadavvlatgldplaellglelper--------------------------------------------
00435771   1/1  ealaeal.e.gveillgtrvteierd--------------------------------------------
00492221   1/1  ----------------------------------------------------------------------
00503631   1/1  epl-------------------------------------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00471401   1/1  ----------------------------------------------------------------------
00485831   1/1  ----------------------------------------------------------------------
00460571   1/1  .rellgdlglepvrggfivvdppdpe--------------------------------------------
00462701   1/1  snlrlllglglPifPdgrlllgprpd--------------------------------------------
00475641   1/1  ----------------------------------------------------------------------
00360921   1/1  vtvltgtrvteierdggggrvtgVtl--------------------------------------------
00463442   2/2  .gvfaiG---------------------------------------------------------------
00464461   1/1  gfpnlalllglglpphPdgrllfgpr--------------------------------------------
00490031   1/1  latGgfpn..lrrllgldlpllpvrg--------------------------------------------
00397811   1/1  ----------------------------------------------------------------------
00455191   1/2  ----------------------------------------------------------------------
00457971   1/1  ...vllaigrrpntellglegaglel--------------------------------------------
00479091   1/2  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------
00488651   1/2  ----------------------------------------------------------------------
00484941   1/1  lpGve-----------------------------------------------------------------
00462741   1/1  allelleklGveir--------------------------------------------------------
00509601   1/2  ----------------------------------------------------------------------
00463441   1/2  ----------------------------------------------------------------------
00467501   1/1  ----------------------------------------------------------------------
00480451   1/2  ----------------------------------------------------------------------
00486071   1/1  ----------------------------------------------------------------------
00400351   1/1  ttedgeleldgeevtir.adavvlat--------------------------------------------
00533221   1/2  ----------------------------------------------------------------------
00518991   1/1  ----------------------------------------------------------------------
00470681   1/1  ----------------------------------------------------------------------
00480091   1/2  ----------------------------------------------------------------------
00529261   1/1  edmeplkdGeekpvpveGetira.dl--------------------------------------------
00413411   1/1  fsnlrlllglglgltgdglalalrlg--------------------------------------------
00406021   1/1  leglgleldtrggivvdetlrtsvpgly------------------------------------------
00384491   1/2  ----------------------------------------------------------------------
00368891   1/2  ----------------------------------------------------------------------
00362581   1/1  ----------------------------------------------------------------------
00482001   1/2  ----------------------------------------------------------------------
00533211   1/1  rpnlegllleglglelderggivvdetl------------------------------------------
00468341   1/1  ggkvagvllrklledgddgrvtvttedl------------------------------------------
00440981   1/1  vvde....tlrtsvpglyaaGdvaggpg------------------------------------------
00488661   1/2  ----------------------------------------------------------------------
00523131   1/1  ----------------------------------------------------------------------
00424461   1/2  ----------------------------------------------------------------------
00487711   1/1  lvvlAaGawsnellellglelpppdg--------------------------------------------
00366541   1/2  ----------------------------------------------------------------------
00399921   1/1  ----------------------------------------------------------------------
00483651   1/2  ----------------------------------------------------------------------
00501481   1/1  ----------------------------------------------------------------------
00472701   1/2  ----------------------------------------------------------------------
00447051   1/2  ----------------------------------------------------------------------
00406191   1/2  ----------------------------------------------------------------------
00363001   1/2  ----------------------------------------------------------------------
00465141   1/1  egaglelderggivvdetlrtsvpgl--------------------------------------------
00477121   1/1  ............................------------------------------------------
00472711   1/2  ----------------------------------------------------------------------
00520321   1/1  rd...tadGeeetiradlvvlatGar--------------------------------------------
00475651   1/2  ----------------------------------------------------------------------
00509611   1/2  ----------------------------------------------------------------------
00526001   1/1  lleaaealgveiltgtrvteilrded--------------------------------------------
00485841   1/2  ----------------------------------------------------------------------
00529111   1/1  ----------------------------------------------------------------------
00376431   1/2  ----------------------------------------------------------------------
00483561   1/1  ----------------------------------------------------------------------
00467611   1/2  ----------------------------------------------------------------------
00529171   1/1  ----------------------------------------------------------------------
00496791   1/2  ----------------------------------------------------------------------
00469721   1/2  ----------------------------------------------------------------------
00384681   1/2  ----------------------------------------------------------------------
00481991   1/2  ----------------------------------------------------------------------
00524811   1/1  ----------------------------------------------------------------------
00406601   1/1  ggglv-----------------------------------------------------------------
00359891   1/1  llllsgigptgdglalleraglelvd--------------------------------------------
00509271   1/1  ..............igvrpnteglll--------------------------------------------
00411521   1/1  ----------------------------------------------------------------------
00501351   1/1  ----------------------------------------------------------------------
00457951   1/1  ----------------------------------------------------------------------
00481081   1/2  ----------------------------------------------------------------------
00464161   1/1  lgleklgvelderggilvdetlrtsvp-------------------------------------------
00380741   1/2  ----------------------------------------------------------------------
00465791   1/1  ----------------------------------------------------------------------
00454811   1/2  ----------------------------------------------------------------------
00469731   1/2  ----------------------------------------------------------------------
00471331   1/1  rvrlllvrpntellglealgleldie--------------------------------------------
00406881   1/1  lagleldrggivvdetlrtsvpgvyaaG------------------------------------------
00483641   1/1  vtpntgllkaglelderggivvdetlr-------------------------------------------
00363011   1/2  ----------------------------------------------------------------------
00480291   1/1  ----------------------------------------------------------------------
00419401   1/2  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00457981   1/2  ----------------------------------------------------------------------
00382851   1/2  ----------------------------------------------------------------------
00400491   1/1  lltnppgntgdglalleraglelhdt--------------------------------------------
00498481   1/1  ----------------------------------------------------------------------
00476511   1/1  ----------------------------------------------------------------------
00360161   1/2  ----------------------------------------------------------------------
00458811   1/1  lGveirlgtevteierdeggrvtvt---------------------------------------------
00461281   1/1  ----------------------------------------------------------------------
00396641   1/1  Ggagnlllllsvlepdlrttnpptntgd------------------------------------------
00445591   1/2  ----------------------------------------------------------------------
00463571   1/1  ----------------------------------------------------------------------
00470291   1/1  gdgglsalvaalak--------------------------------------------------------
00514421   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00374371   1/2  ----------------------------------------------------------------------
00455181   1/2  ----------------------------------------------------------------------
00444131   1/1  ----------------------------------------------------------------------
00529641   1/2  ----------------------------------------------------------------------
00465991   1/1  ----------------------------------------------------------------------
00500031   1/1  ----------------------------------------------------------------------
00423421   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00511641   1/1  ----------------------------------------------------------------------
00423401   1/1  ----------------------------------------------------------------------
00515981   1/1  ----------------------------------------------------------------------
00476821   1/1  aerl------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00470261   1/1  ----------------------------------------------------------------------
00496291   1/1  ----------------------------------------------------------------------
00486871   1/1  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00517371   1/1  ----------------------------------------------------------------------
00481021   1/1  ----------------------------------------------------------------------
00424462   2/2  ----------------------------------------------------------------------
00531721   1/1  ----------------------------------------------------------------------
00450461   1/1  ----------------------------------------------------------------------
00480351   1/1  ----------------------------------------------------------------------
00475101   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00526101   1/1  ----------------------------------------------------------------------
00470321   1/1  ----------------------------------------------------------------------
00467601   1/1  ..dgetleadlvilatGglslllllg--------------------------------------------
00503221   1/1  ----------------------------------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00382852   2/2  ----------------------------------------------------------------------
00360162   2/2  ----------------------------------------------------------------------
00354771   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00497391   1/1  ----------------------------------------------------------------------
00509101   1/1  ----------------------------------------------------------------------
00502691   1/1  ----------------------------------------------------------------------
00489981   1/1  ----------------------------------------------------------------------
00456211   1/1  ----------------------------------------------------------------------
00394821   1/1  ----------------------------------------------------------------------
00509612   2/2  ----------------------------------------------------------------------
00488662   2/2  ----------------------------------------------------------------------
00487551   1/1  ----------------------------------------------------------------------
00471251   1/1  ----------------------------------------------------------------------
00352901   1/1  ----------------------------------------------------------------------
00363002   2/2  llpglellegagleldggivvdeylr--------------------------------------------
00472421   1/1  ----------------------------------------------------------------------
00366641   1/1  ----------------------------------------------------------------------
00495871   1/1  ----------------------------------------------------------------------
00421801   1/1  ----------------------------------------------------------------------
00485851   1/1  ----------------------------------------------------------------------
00478891   1/1  ----------------------------------------------------------------------
00497301   1/1  ----------------------------------------------------------------------
00512131   1/1  ----------------------------------------------------------------------
00513051   1/1  ----------------------------------------------------------------------
00455192   2/2  ----------------------------------------------------------------------
00484451   1/1  ----------------------------------------------------------------------
00406511   1/1  ----------------------------------------------------------------------
00452431   1/1  ----------------------------------------------------------------------
00523291   1/1  ----------------------------------------------------------------------
00387841   1/1  ----------------------------------------------------------------------
00502011   1/1  ----------------------------------------------------------------------
00457121   1/1  ----------------------------------------------------------------------
00517971   1/1  ----------------------------------------------------------------------
00480271   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00480092   2/2  ----------------------------------------------------------------------
00480452   2/2  ----------------------------------------------------------------------
00533222   2/2  ----------------------------------------------------------------------
00406192   2/2  ----------------------------------------------------------------------
00384492   2/2  ----------------------------------------------------------------------
00483652   2/2  ----------------------------------------------------------------------
00472702   2/2  tGarsnpnilglegagllderggivv--------------------------------------------
00481082   2/2  ----------------------------------------------------------------------
00368892   2/2  ----------------------------------------------------------------------
00384682   2/2  ----------------------------------------------------------------------
00485842   2/2  ----------------------------------------------------------------------
00488652   2/2  eadlvvlatGarpntppipgldllgvl-------------------------------------------
00447052   2/2  ----------------------------------------------------------------------
00363012   2/2  ----------------------------------------------------------------------
00475652   2/2  ----------------------------------------------------------------------
00479092   2/2  ----------------------------------------------------------------------
00469722   2/2  ----------------------------------------------------------------------
00482002   2/2  ----------------------------------------------------------------------
00496792   2/2  ----------------------------------------------------------------------
00481992   2/2  v.iiddgtvtv.......dgetiead--------------------------------------------
00366542   2/2  ----------------------------------------------------------------------
00472712   2/2  ----------------------------------------------------------------------
00529642   2/2  ----------------------------------------------------------------------
00364592   2/2  ----------------------------------------------------------------------
00457982   2/2  ----------------------------------------------------------------------
00380742   2/2  ddgrVtl.......dgetitadavil--------------------------------------------
00469732   2/2  ----------------------------------------------------------------------
00509602   2/2  avvlatGsrpntpllpglelderggilv------------------------------------------
00376432   2/2  AtGarpntplleglglelderggivvde------------------------------------------
00419402   2/2  ----------------------------------------------------------------------
00467612   2/2  ----------------------------------------------------------------------
00488072   2/2  vvviGggdiglelalalarlgakVtlv-------------------------------------------
00374372   2/2  ----------------------------------------------------------------------
00454812   2/2  g---------------------------------------------------------------------
00445592   2/2  ----------------------------------------------------------------------
00455182   2/2  dggvvgvtt....dgetiradavilA--------------------------------------------