[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ55595.1


[Show Plain Result]

## Summary of Sequence Search
   1::253
  85::224  4.3e-30 37.5% 0039041 00390411 1/1   p containing nucleoside triphosphate hy 
  94::248  3.2e-29 38.0% 0050943 00509431 1/1   p containing nucleoside triphosphate hy 
  47::226    1e-28 27.8% 0046693 00466931 1/1   p containing nucleoside triphosphate hy 
  48::245  1.5e-28 35.8% 0044086 00440861 1/1   p containing nucleoside triphosphate hy 
 127::234  3.6e-26 47.5% 0036790 00367901 1/1   p containing nucleoside triphosphate hy 
 119::252  4.7e-24 34.4% 0049080 00490801 1/1   p containing nucleoside triphosphate hy 
 119::255  7.6e-24 32.8% 0051025 00510251 1/1   p containing nucleoside triphosphate hy 
  92::252  2.2e-23 30.5% 0037958 00379581 1/1   p containing nucleoside triphosphate hy 
 101::234  2.5e-23 35.7% 0042280 00422801 1/1   p containing nucleoside triphosphate hy 
 119::252  6.4e-23 32.3% 0048220 00482201 1/1   p containing nucleoside triphosphate hy 
 119::238    7e-23 35.1% 0045860 00458601 1/1   p containing nucleoside triphosphate hy 
  98::253  1.1e-22 28.9% 0048226 00482261 1/1   p containing nucleoside triphosphate hy 
 100::251    2e-22 31.0% 0053059 00530591 1/1   p containing nucleoside triphosphate hy 
 101::247  5.2e-22 34.3% 0040410 00404101 1/1   p containing nucleoside triphosphate hy 
 119::239    9e-22 33.9% 0047589 00475891 1/1   p containing nucleoside triphosphate hy 
 119::253  1.4e-21 32.6% 0050274 00502741 1/1   p containing nucleoside triphosphate hy 
 101::249  1.5e-21 33.1% 0042070 00420701 1/1   p containing nucleoside triphosphate hy 
 113::248  1.6e-21 34.9% 0037898 00378981 1/1   p containing nucleoside triphosphate hy 
 127::246  4.3e-21 41.1% 0036748 00367481 1/1   p containing nucleoside triphosphate hy 
 116::235  7.1e-21 35.1% 0046697 00466971 1/1   p containing nucleoside triphosphate hy 
  92::249  1.5e-20 33.8% 0042557 00425571 1/1   p containing nucleoside triphosphate hy 
  98::239  2.3e-20 30.9% 0047599 00475991 1/1   p containing nucleoside triphosphate hy 
  98::236  3.1e-20 35.8% 0036121 00361211 1/1   p containing nucleoside triphosphate hy 
 101::215  1.6e-18 31.0% 0043607 00436071 1/1   p containing nucleoside triphosphate hy 
 127::251  4.8e-18 35.9% 0037230 00372301 1/1   p containing nucleoside triphosphate hy 
 143::252  1.4e-17 34.0% 0042214 00422141 1/1   p containing nucleoside triphosphate hy 
 125::237  3.9e-17 39.3% 0050337 00503371 1/1   p containing nucleoside triphosphate hy 
 113::250  7.4e-17 35.1% 0050044 00500441 1/1   p containing nucleoside triphosphate hy 
 137::241  8.7e-16 32.3% 0049825 00498251 1/1   p containing nucleoside triphosphate hy 
  98::235  5.5e-15 33.6% 0042496 00424961 1/1   p containing nucleoside triphosphate hy 
  92::211  6.9e-15 30.7% 0043651 00436511 1/1   p containing nucleoside triphosphate hy 
 101::244  1.7e-13 33.6% 0048593 00485931 1/1   p containing nucleoside triphosphate hy 
 101::245  8.5e-13 33.6% 0046860 00468601 1/1   p containing nucleoside triphosphate hy 
 127::240  1.5e-12 34.9% 0048852 00488521 1/1   p containing nucleoside triphosphate hy 
  70::189  2.1e-11 28.1% 0038144 00381441 1/1   p containing nucleoside triphosphate hy 
 100::252  2.6e-11 32.0% 0046869 00468691 1/1   p containing nucleoside triphosphate hy 
 101::219  2.8e-11 31.6% 0048545 00485451 1/1   p containing nucleoside triphosphate hy 
 137::245  3.4e-11 37.8% 0044893 00448931 1/1   p containing nucleoside triphosphate hy 
 127::236  3.9e-10 39.8% 0046945 00469451 1/1   p containing nucleoside triphosphate hy 
 101::239  5.7e-10 31.3% 0049537 00495371 1/1   p containing nucleoside triphosphate hy 
 100::234  6.2e-10 36.5% 0049611 00496111 1/1   p containing nucleoside triphosphate hy 
 123::231  6.2e-10 34.7% 0046479 00464791 1/1   p containing nucleoside triphosphate hy 
 144::238  7.3e-10 35.6% 0043798 00437981 1/1   p containing nucleoside triphosphate hy 
 137::218  1.2e-09 35.8% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
 164::238  2.8e-09 47.5% 0037960 00379601 1/1   p containing nucleoside triphosphate hy 
  87::239  4.4e-09 29.7% 0050061 00500611 1/1   p containing nucleoside triphosphate hy 
 101::218  5.1e-09 28.3% 0036857 00368571 1/1   p containing nucleoside triphosphate hy 
 145::224    2e-08 36.2% 0041412 00414121 1/1   p containing nucleoside triphosphate hy 
 144::251  2.1e-08 35.5% 0037996 00379961 1/1   p containing nucleoside triphosphate hy 
  97::218  3.6e-08 27.8% 0042605 00426051 1/1   p containing nucleoside triphosphate hy 
 143::226  1.1e-07 30.1% 0037163 00371631 1/1   p containing nucleoside triphosphate hy 
 121::217  1.8e-07 32.0% 0037926 00379261 1/1   p containing nucleoside triphosphate hy 
 118::228  6.2e-07 33.0% 0047537 00475371 1/1   p containing nucleoside triphosphate hy 
  90::239  1.3e-06 31.9% 0049503 00495031 1/1   p containing nucleoside triphosphate hy 
 120::218  1.8e-06 33.3% 0040678 00406781 1/1   p containing nucleoside triphosphate hy 
  97::250    3e-06 21.4% 0036850 00368501 1/1   p containing nucleoside triphosphate hy 
 142::241  3.9e-06 33.7% 0043794 00437941 1/1   p containing nucleoside triphosphate hy 
 134::217    5e-06 30.9% 0040419 00404191 1/1   p containing nucleoside triphosphate hy 
 101::237  1.3e-05 35.5% 0053253 00532531 1/1   arboxykinase-like                       
 143::217  3.2e-05 38.0% 0045731 00457311 1/1   p containing nucleoside triphosphate hy 
 134::201  3.3e-05 34.8% 0045157 00451571 1/1   p containing nucleoside triphosphate hy 
 117::201  4.1e-05 29.3% 0035641 00356411 1/1   p containing nucleoside triphosphate hy 
 144::241  4.8e-05 31.6% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
 127::214  9.3e-05 37.5% 0043440 00434401 1/1   p containing nucleoside triphosphate hy 
 137::175  0.00012 43.2% 0048047 00480471 1/1   p containing nucleoside triphosphate hy 
 120::218  0.00013 35.4% 0039270 00392701 1/1   p containing nucleoside triphosphate hy 
 137::196  0.00018 29.3% 0051553 00515531 1/1   p containing nucleoside triphosphate hy 
 137::216  0.00032 31.0% 0047841 00478411 1/1   arboxykinase-like                       
 101::214  0.00044 23.9% 0048702 00487021 1/1   p containing nucleoside triphosphate hy 
 137::193  0.00057 33.3% 0051551 00515511 1/1   p containing nucleoside triphosphate hy 
 133::209  0.00084 31.1% 0051958 00519581 1/1   p containing nucleoside triphosphate hy 
 139::222  0.00089 40.3% 0040588 00405881 1/1   p containing nucleoside triphosphate hy 
   1::253


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVSIDQSAIRGSRRSNPATYTGLLDPIRKAFAKANGVKPSLFSANSEGACPACNGAGVIYTDLAMMAGVA
00390411   1/1  ----------------------------------------------------------------------
00509431   1/1  ----------------------------------------------------------------------
00466931   1/1  ----------------------------------------------lgrlelllllllllellallldll
00440861   1/1  -----------------------------------------------glkelrrgigyvfqdpnlfpglv
00367901   1/1  ----------------------------------------------------------------------
00490801   1/1  ----------------------------------------------------------------------
00510251   1/1  ----------------------------------------------------------------------
00379581   1/1  ----------------------------------------------------------------------
00422801   1/1  ----------------------------------------------------------------------
00482201   1/1  ----------------------------------------------------------------------
00458601   1/1  ----------------------------------------------------------------------
00482261   1/1  ----------------------------------------------------------------------
00530591   1/1  ----------------------------------------------------------------------
00404101   1/1  ----------------------------------------------------------------------
00475891   1/1  ----------------------------------------------------------------------
00502741   1/1  ----------------------------------------------------------------------
00420701   1/1  ----------------------------------------------------------------------
00378981   1/1  ----------------------------------------------------------------------
00367481   1/1  ----------------------------------------------------------------------
00466971   1/1  ----------------------------------------------------------------------
00425571   1/1  ----------------------------------------------------------------------
00475991   1/1  ----------------------------------------------------------------------
00361211   1/1  ----------------------------------------------------------------------
00436071   1/1  ----------------------------------------------------------------------
00372301   1/1  ----------------------------------------------------------------------
00422141   1/1  ----------------------------------------------------------------------
00503371   1/1  ----------------------------------------------------------------------
00500441   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00424961   1/1  ----------------------------------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------
00381441   1/1  ---------------------------------------------------------------------l
00468691   1/1  ----------------------------------------------------------------------
00485451   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00469451   1/1  ----------------------------------------------------------------------
00495371   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00464791   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00379601   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00368571   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00371631   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00532531   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TVCETCEGKRFQASVLKYTLGGRTISDVLEMSVREAEEFFRAGEARLPAAHAILTRLADVGLGYLSLGQP
00390411   1/1  --------------llayllqlleilllllltlleallgll....raelearalellervglpgdlldrp
00509431   1/1  -----------------------tvlenlllgpeerrelldellglellsleealaraeealeelnallk
00466931   1/1  lllllllllllllllllvlllllllllvlllllllalllllalkeaallleell....lllglgdlldrp
00440861   1/1  vlisaltgeglde.........ltvrenlalglrlrg............arerveelle.gldel.ldrl
00367901   1/1  --------------------------------------------------------lellglgg.lldrp
00490801   1/1  ------------------------------------------------eaalralllllllgletlldrr
00510251   1/1  ------------------------------------------------eaalraellllllgletlldrr
00379581   1/1  ---------------------gltvrenlalglllllllllllllllllalskaearervlellelvgld
00422801   1/1  ------------------------------ltvrenlalglllallllglskaeararalellellplgl
00482201   1/1  ------------------------------------------------eaalralllllllgletlldrl
00458601   1/1  ------------------------------------------------eaalralllllllgledlldrl
00482261   1/1  ---------------------------lpsltvlenlllgllllgellllllaakeaalralllllllgl
00530591   1/1  -----------------------------sltvlenlllgllllgllllllaakeaalralllllllgle
00404101   1/1  ------------------------------ltvrenlalgll...kaeararalellellgld.elldrl
00475891   1/1  ------------------------------------------------eaalralllllllgletlldrl
00502741   1/1  ------------------------------------------------eaaaraaellellgledlldrl
00420701   1/1  ------------------------------ltvrenlalglllaglskaeararalellellgldd.lld
00378981   1/1  ------------------------------------------glskaeaaaraaellellgldd.lldrl
00367481   1/1  --------------------------------------------------------ltrvglsdl.ldrg
00466971   1/1  ---------------------------------------------aakeaalrlellllllgletlldrl
00425571   1/1  ---------------------gltvrenlalgllll......glskaeaaaralellellgldd.lldrl
00475991   1/1  ---------------------------lpsltvlenlllglllagellllllaakeaalralllllllgl
00361211   1/1  ---------------------------fpeltvlenlalg...........rarellerlglail..drl
00436071   1/1  ------------------------------ltvlenlalgllllgllealaralellellglgdl..drl
00372301   1/1  --------------------------------------------------------lervgled.lldrl
00422141   1/1  ----------------------------------------------------------------------
00503371   1/1  ------------------------------------------------------tllklvgl.pgkalrp
00500441   1/1  ------------------------------------------glslaeaaeralelllllgl.edlldrl
00498251   1/1  ------------------------------------------------------------------ldrl
00424961   1/1  ---------------------------vaenialgaeyf...rdegadvllladsllrlagalrevlgrl
00436511   1/1  ---------------------altvaenlrfglglavlllldsatrlaqakreisalarellervglpgd
00485931   1/1  ------------------------------ltvlenlalg.....gadlaeraeellellglegfdvvli
00468601   1/1  ------------------------------ltvldnlalardlleaakaagydvvlidtaglld..ldrl
00488521   1/1  --------------------------------------------------------lerlgl..dlldrl
00381441   1/1  tvlenlylglllalllaleegkivildgdreraeellellgld......adlviilpasleellerldrr
00468691   1/1  -----------------------------eltvlenlalgallag..............lgl.aeyldel
00485451   1/1  ------------------------------ltvpenldlglll....eilervlellelvgldvvlldty
00448931   1/1  ------------------------------------------------------------------rlrl
00469451   1/1  --------------------------------------------------------lelvgle.dlldrl
00495371   1/1  ------------------------------ltvrenlealgldlrglldrerviellelvglee.lldrl
00496111   1/1  -----------------------------eltvlenlalgll.........................drl
00464791   1/1  ----------------------------------------------------aaellervglvaatadep
00437981   1/1  ----------------------------------------------------------------------
00512891   1/1  ------------------------------------------------------------------lktl
00379601   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------eillggkvlyisleeslrrrrigmvfqelgldpdltvarerviellelvgllel
00368571   1/1  ------------------------------ptldellellselg..lrdladrleklvagglagllegae
00414121   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00426051   1/1  --------------------------dnidlgllirgdeeleaalelaglprvielllegldtlag..gg
00371631   1/1  ----------------------------------------------------------------------
00379261   1/1  --------------------------------------------------tdllgrtvdfkntiiiltsn
00475371   1/1  -----------------------------------------------psarellgllgellgldvlvgar
00495031   1/1  -------------------lggkvlyigleltlsperlrlraqslgldldellerllvidllelvglle.
00406781   1/1  -------------------------------------------------akalagel.gvpfvrisasel
00368501   1/1  --------------------------dasviallgggrelrdgellkalkeaeaeellellglkdlllrk
00437941   1/1  ----------------------------------------------------------------------
00404191   1/1  ---------------------------------------------------------------yvsadel
00532531   1/1  ------------------------------ltvlenvalgldglvdeedleraenllalvgl.eeipnry
00457311   1/1  ----------------------------------------------------------------------
00451571   1/1  ---------------------------------------------------------------prllgqa
00356411   1/1  ----------------------------------------------lleekiveellellgleykgd.rd
00503741   1/1  ----------------------------------------------------------------------
00434401   1/1  --------------------------------------------------------lellglgev.vivd
00480471   1/1  ------------------------------------------------------------------lgqn
00392701   1/1  -------------------------------------------------aralagll.gapfgrvdasdl
00515531   1/1  ------------------------------------------------------------------ldkl
00478411   1/1  ------------------------------------------------------------------ldry
00487021   1/1  ------------------------------ltvlelldnvllgleirgllkaerlervevllervgl.ll
00515511   1/1  ------------------------------------------------------------------ldgl
00519581   1/1  --------------------------------------------------------------dvgglvvd
00405881   1/1  --------------------------------------------------------------------qp


                         +         -         -         -         -         *         -:210
query           LTTLSGGERQRLKLATHMGDKGGIYVLDEPTTGLHLADVAQLLALLDRIVDSGKSVIVIEHHQAVMAHAD
00390411   1/1  vstLSGGekqrlalAralalaellakdpplllLDEPtagLDpetreallelLrelakegrtvivvtHdle
00509431   1/1  eleeeleligplldglellvglngl.ldrplselSgGekqrlalaralalaelkdppllllDEptagLDp
00466931   1/1  vstLSGGerqrvalaralalallllsdpplllLDEPtagLDpetreellellkelakegktvivvtHdle
00440861   1/1  pgtlSgGerqrvalAralaldpklllllllleellekllnllrevfdlaDEptsgLDpetraellellke
00367901   1/1  vstLSgGekqrvalaralallelldpplllLDEptsgLDpetreallellrelak.grtvivvtHdlell
00490801   1/1  pseLSgGqrqRvalArallldpdlllLDEPtsgLDpetraellellrelakegktvllvtHdlseallad
00510251   1/1  pseLSgGqrqRvalArallldpdllllDEPtsgLDpetraellellrelakegktvllvtHdlseallad
00379581   1/1  t.lldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakegltvllvthdl
00422801   1/1  dt.lldrlvgeLSgGqrqrvalArallldpdllllDEptsgLDpetraellellrelak.gltvllvthd
00482201   1/1  pseLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelak.gltvllvthdlsearlad
00458601   1/1  pseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvtHdldealrla
00482261   1/1  etlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelak.gltvllvthdl
00530591   1/1  tlldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelak.gltvllvtHdls
00404101   1/1  vgeLSgGqrqrvalarallllleelsldpdllllDEPtsglDpetraellellrelakegltvllvthdl
00475891   1/1  vseLSgGqrqrvalarallldpkllllDEPtsgLDpetraellellrelakegltvllvthdldealrla
00502741   1/1  pseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvthdldealrla
00420701   1/1  rlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlseal
00378981   1/1  vgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealrl
00367481   1/1  ls.lsggerqrvalaralatdpslllLDEptsgldpedgaalaeallellaellgatvlvvtHdlelaal
00466971   1/1  vseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakegltvllvthdldealrla
00425571   1/1  vgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealal
00475991   1/1  etlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvtHdl
00361211   1/1  pgeLSgGqqqrvaiaralaldpdllllDeptsalssrssendpetvaellellkelakelgvtvilvthd
00436071   1/1  vseLSgGqrqrvalarallldpdllllDEptsglDpetralllellrelaeelgltvllvthdldlalal
00372301   1/1  pstlsgGqrqrvai.ralatepsllLlDEptsgldpelraalaeallellaelgatvlfvtHdlelaall
00422141   1/1  --qlsgGqrqrvalaralrqdPdvillDEprsaldaelllqaadt.......GhtvlvttHdlsaaraad
00503371   1/1  lstlSGGekqrlalalalalaellppplllLDEptagLDpenrerllellrelaseggqvivvtHdpela
00500441   1/1  vseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakelgltvllvthdlsealrl
00498251   1/1  prllsggqrqrvvidsalalrpkllllDEPtsgldplsarellellrrllrlakelgvtvllvthdldea
00424961   1/1  grelSgGqkqrvaiarallleragnleggGsiTalatvlveggsdpdllllDeptsalDgeivlslllal
00436511   1/1  lftllsrlderagnlSgGqrqrvaiaralasdpdllilDEptsglDpetv.....llralae.ggtvlli
00485931   1/1  DtagrgrrvgelsggqkqrvaiarallllldpelllldEptsglda..lrlllellkel...gltvlvvt
00468601   1/1  vgelsggqkqrvaiarala.apevllldeptsglda..laellelleel...gltvlvvtKlDgtakggh
00488521   1/1  phqlsggqrqrvaiaralaeelkpdllvlDeitalfraelegrptsaldvsllrellrlLkrlakelgvt
00381441   1/1  ggelsggqkqRvalarallldpdllllDEptsglDpeetreellellre---------------------
00468691   1/1  gkdLSgGqrqrvalAr.....pvlLllDEptsgldalr..eilellrellkelgytvllvthdls...la
00485451   1/1  phelSgGqrqRvaiaralaldpdvlllDEptsglDpetralelldllrtdldkelgrtiilvthdlreae
00448931   1/1  pselsggqkqrvaiaralaaplppevllldeptsglda..lrellellrel...gltvlvvthlDllakg
00469451   1/1  pgelSgGqrq..aiara.ardpdllllDeptsalrgsenDpetraeilrlLkelakelgvtvilvtH...
00495371   1/1  prelsggnqrqrvvia.alallpkllllDEptsaldvslraeilrlLkrlakelgvtvllvthdleevee
00496111   1/1  pgeldlSgglqrqrvaia...agdpdllllDeptsalrslgndpelraellrllkrlkelgvtvilvth.
00464791   1/1  pgelsggqrqrlaiAraladdqgkpvllllDEptsgldal..reillllgellseegytvllvshdlsll
00437981   1/1  ---lsgGqkqrvaiaralagdpkvlllDEpt.aldpdaqnaLlklleelak.gvtvilathdlsellpal
00512891   1/1  ikelsggekqrvalarallakpdvlllDEid.gldpdvleallelleelkrsgvtvilttndldelelad
00379601   1/1  -----------------------illlDEptsalda....ellqallt....ghtvvlvthhlntaldla
00500611   1/1  ldrlprelkrsggqrqrvviDaralllrpel..lDEptsaldvslraeilrlLkrlakelgvtvllvthd
00368571   1/1  ktaasilellrkllallldlggpafdlrdllslgeglivlillslggekqrvalarallsllfeallelg
00414121   1/1  ----sgGqkqrlalaralladpdlgellllDeptlvlDaasgedlldllkelaeqlgltvlivlnKiDll
00379961   1/1  ---lsggerqrvalaralalrpGllvlAdggvlllDEp.daldpevqaaLlrlleegevtieragitlll
00426051   1/1  gvvlsGgqrqrvalar.....pdlllfldeptselleRllkrltrpgldadteeellellerlareyerl
00371631   1/1  --vlsggqkqrlalaralvedpdvlilDgptalldpltr.ellellkelrdlldltilvdadlevlleRr
00379261   1/1  vgelsggqrqrvalarallaepgilflDEiDklagkrggggtnrldeevlnaLlelleelqvtgeyitvk
00475371   1/1  ggdlsgglrqr..larallgdpdvlliDepgrgldpellallaelldllrelradlgllvvdathdldav
00495031   1/1  lldrlprelsggqrqrvviDalalllrpell..DeptsaldvqlvaeilrlLkrlakelgvtvilvthdl
00406781   1/1  lgkyvgelsgglrqrlalara..adpgvlllDEidalldarsgsgsggdsssrrvlnaLlrlleelrlls
00368501   1/1  psqlSgGqkqRvalaralladpgvlflDEidklldargssggdesrervlnaLlelleggevlsnvtvia
00437941   1/1  -selsggerqrvliaralladpkvlllDEi.daldpeaqnaLlklleelpk.gvtvilttnrleeldpal
00404191   1/1  vsklsgglqeqrvaiafalarkpdllllDEidalgldpelqeellelldelaergvtlilttnnrpeeld
00532531   1/1  pselsgGqqqrv...........illldEPtsgLdpvsr..........................lelad
00457311   1/1  --elsgGqrQRv.ralaldpd..llilDeptsalgqpdpelr.elldllifldadlgltlirlitrdlge
00451571   1/1  elllsggkadlvifldaplevlleRllkrddekilkrleeqkqrvaiarallkkpailild---------
00356411   1/1  peelsggqkqrvalaralakdpdilll..ptsaldgegvdelfdallelilelnlrivtth---------
00503741   1/1  ---lsggerlrvalaeallalgkpdllilDEitnlldpetlspdvlelLlrlleegkltdkllgltlilt
00434401   1/1  vydlsggerqr...aralasgpdvlilDgptlgldv............lldlpdlvifvdhdlevalerr
00480471   1/1  vdeLpsggqkqrvaiarallkdp..lllDEptsaL-----------------------------------
00392701   1/1  lgkyvgelsgglrqr..larallakpsvlllDEidklapkrsptsgldvelrrrvlnaLlrlleglrlls
00515531   1/1  pselsgGqkqrvalaralaldpdllll..ptsaldgegieelfdlllelilelilv--------------
00478411   1/1  pdelsggqrqrvaiaralalepelllldeptsaldplavvellelllglnee.........ldiilalel
00487021   1/1  drippalsgGqgqrvildrallselayqpdvllldeplsgldaklreelrdllrellpegilpdlvifld
00515511   1/1  pselsggqkqrvalaralalapdlllldeptsaldgegveelfdallelileg-----------------
00519581   1/1  lidleaverhlldiaeellengeilildeptvgldskd...ildelakilkevnfelifithdedelre-
00405881   1/1  vellsggekqrlalarallgkpvilvlNKiDeptnel....dlellellee...lggtvvlvSahdgegl


                         -         -         -         +         -         -         -:280
query           WIIDLGPGAGHEGGRVVFEGTPAELVAARSTLTGQHLADYVGA---------------------------
00390411   1/1  laeladriivlddG--------------------------------------------------------
00509431   1/1  etrerllellkelae.grqvivvtHdlelaaladriiv--------------------------------
00466931   1/1  laaladriivlddGri------------------------------------------------------
00440861   1/1  laeelgktvilvtHdldvaar..liidlglllgll-----------------------------------
00367901   1/1  aladriivlg.....edGriveeg----------------------------------------------
00490801   1/1  rilvl......ddGriveegtpeellanpgllytllllgalp----------------------------
00510251   1/1  rilvl......ddGriveegtpeellenpgllytllllgalplll-------------------------
00379581   1/1  dealrladrilvl......ddGrivelgtpeellenpgllgl----------------------------
00422801   1/1  lslaaladrilvl......ddGri----------------------------------------------
00482201   1/1  rilvl......ddGrivelgtpeellenpgllytllllgeel----------------------------
00458601   1/1  drilvl......ddGriveegtpeelle------------------------------------------
00482261   1/1  sealladrilvl......ddGrivelgtpeellenpgllytll---------------------------
00530591   1/1  ealladrilvl......ddGriveegtpeellenpgllyll-----------------------------
00404101   1/1  dealrladrilvl......ddGrivelgtpeellenp---------------------------------
00475891   1/1  drilvl......ddGrivelgtpeellen-----------------------------------------
00502741   1/1  drilvl......ddGrivelgtpeellenpgllytllllgslp---------------------------
00420701   1/1  rladrilvl......ddGrivelgtpeellenpaslyta-------------------------------
00378981   1/1  adrilvl......ddGrivelgtpeellenpaslytae--------------------------------
00367481   1/1  aadrivvl......ngrvvadgtpeellflyklllg----------------------------------
00466971   1/1  drilvl......ddGrivelgtpee---------------------------------------------
00425571   1/1  adrilvl......ddGrivelgtpeellenpaslytael-------------------------------
00475991   1/1  sealrladrilvl......ddGriveegt-----------------------------------------
00361211   1/1  ldlldsallrpgkrpllsdlrgsgei--------------------------------------------
00436071   1/1  adriv-----------------------------------------------------------------
00372301   1/1  adrvvvl......ndgrivavgtpeelyklpaglldrslal-----------------------------
00422141   1/1  rllvlgdgrlllasaldviiaqnlvrrldpalrrpgrldriv----------------------------
00503371   1/1  arladrilvlk.....dggivavvlgt-------------------------------------------
00500441   1/1  adrilvl......ddGrivelgtpeellenpkslytaall------------------------------
00498251   1/1  ealadrvlvl......aggrilehgadtvll---------------------------------------
00424961   1/1  krlyPaidvllSvsrvldllllkei---------------------------------------------
00436511   1/1  s---------------------------------------------------------------------
00485931   1/1  hddgtakggaalslaleladrilvlg......dG------------------------------------
00468601   1/1  dlslalrladrilvlg......vGeivedgtpfel-----------------------------------
00488521   1/1  vllvthdldevarladrvlvlag......g----------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00468691   1/1  drilvl......edGsitalgtveellddlgdpitllllsil----------------------------
00485451   1/1  .adrilvlr-------------------------------------------------------------
00448931   1/1  gadlslaleladrilvlg......dGeivedgtpe-----------------------------------
00469451   1/1  ....Asdrvlvl......rdgrivev--------------------------------------------
00495371   1/1  ladrvavlag......griveqgadvvlf-----------------------------------------
00496111   1/1  ..dleeaedladsgriavladgri----------------------------------------------
00464791   1/1  eraadr.........eggsit-------------------------------------------------
00437981   1/1  lsrcqvirfpplseeelleildrilvl.------------------------------------------
00512891   1/1  riallrrg--------------------------------------------------------------
00379601   1/1  driivldd......Griveegtpeella------------------------------------------
00500611   1/1  lreveeladkrdrvvvl......rggriv-----------------------------------------
00368571   1/1  grlkppil--------------------------------------------------------------
00414121   1/1  selthdlellrela--------------------------------------------------------
00379961   1/1  pagvtviaatnddlgeldpalldRfdlvielgplrdreerl-----------------------------
00426051   1/1  ieplkkgg--------------------------------------------------------------
00371631   1/1  leRdlelvthdlddae------------------------------------------------------
00379261   1/1  sdvtvia---------------------------------------------------------------
00475371   1/1  lkaadrilvldlg.....----------------------------------------------------
00495031   1/1  revegrleladrvvvl......rggrile-----------------------------------------
00406781   1/1  gvtviatt--------------------------------------------------------------
00368501   1/1  atnrlliaigafeflkadeldpaLlrRfdlvievplpdee------------------------------
00437941   1/1  lsRfdviefpppdeeelleilklilkkeglk---------------------------------------
00404191   1/1  qallrll---------------------------------------------------------------
00532531   1/1  riyvl......lsGrivesgtteellt-------------------------------------------
00457311   1/1  agrsadr---------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00503741   1/1  thdldllerladrllsrfngkgivielppls---------------------------------------
00434401   1/1  lkrl------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00392701   1/1  gvtviatt--------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00478411   1/1  llldel----------------------------------------------------------------
00487021   1/1  adpe------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00405881   1/1  delldailellk----------------------------------------------------------