[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ55679.1


[Show Plain Result]

## Summary of Sequence Search
   1::854
  49::856 3.3e-219 45.3% 0047001 00470011 1/1   minal nucleophile aminohydrolases (Ntn  
  50::856 2.6e-217 46.9% 0036097 00360971 1/1   minal nucleophile aminohydrolases (Ntn  
  44::855 3.9e-214 47.5% 0048627 00486271 1/1   minal nucleophile aminohydrolases (Ntn  
   1::854


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSVSVPRVRRWLLGILAAVLAVALITAGLAVWTVRRSFPQVSGELELPALSAPVTVYRDEYGITHLYADT
00470011   1/1  ------------------------------------------------GlsapveirrDeyGvPhIyAks
00360971   1/1  -------------------------------------------------lsapVeirrdayGvPhIyAen
00486271   1/1  -------------------------------------------eltlpglsapveirrdeyGvPhIyAks


                         -         -         *         -         -         -         -:140
query           PEDLFTAQGYVHAQDRFWSMDFNRHVTAGRLAELFGADQVPTDAYLRTMGWRRVAEAEYDLLAEETRRYL
00470011   1/1  ladlffglGYahAqdrlfqmellrrtarGrlaelfGpdalesDrlfrllglreaaeallaalspetrall
00360971   1/1  ladlffglGYvhAqdrlfqmellrrtarGelaevfGpdaldsDrllrtlglrraaeallaalspetrall
00486271   1/1  ladlffglGYahAqdrlfqlellrrtarGrlaelfGpdalesDrllrllglreaaeallaalspetrall


                         +         -         -         -         -         *         -:210
query           DAYAEGVNAYLEGKSATEVSLEYAVLAATNSEYEIEPWSAVDSLAWLKAMAWDLAGNMHDEIARASLLAR
00470011   1/1  eaYaaGvNaylaelpagalgllpleflllg.....yepepwtpeDslavlllmalllsgglgsevenlll
00360971   1/1  eaYaaGvNaylaelpadnddllppeflllgyk.....pepwtpeDvlailklmaldlsaglflellraal
00486271   1/1  eaYaaGvNaylae.....lPleflllg.....yepepwtpvDslavlllmalllsgnlleelll......


                         -         -         -         +         -         -         -:280
query           GLPREQVEELYPAYPEEQHAPILAGGRVRDGKFVLDSDEAEQRDEDAADIPATAAVRALAGLQEPLEAIP
00470011   1/1  laalaaa.lgpdllalllpdypglaapllptlldlalllla.............................
00360971   1/1  laa.lgpellaallpdypdellalidplallllll...................................
00486271   1/1  ......................................................................


                         -         *         -         -         -         -         +:350
query           RTFGPASSDLGSNSWVVSGEHTASGLPLLANDPHLGAVMPSIWYQMGLHCTTVDESCPFDVTGFTFPGLT
00470011   1/1  ......lllllllplgigSNawavagsrTasGkplLanDPHlglsapsiwyeahltlpg......ldviG
00360971   1/1  ......lllalpigSNawavggerTasGkalLandPHlglsapslwyeahLtapg......ldviGatlp
00486271   1/1  ........gigSNawavagsrTasgkplLanDPHlplsapsliwyeahltlpg......ldviGatlpGl


                         -         -         -         -         *         -         -:420
query           GVVIGANDTIAWGFTNLGPDVIDLYLEKLDGDSAIVDGAPEPLETRTETIRVAGGDDVEITVRSSRHGPL
00470011   1/1  atlpGlPgiliGhNgdlAWglTvsyadvvdlyveelnpdnplqYlydgewrpletreetikvkggdgvtl
00360971   1/1  GlPgvviGhNgdiAWglTnsyadvvdlyleelnpgdpnqylydgkwlpletrtetikvkggdgvtltvye
00486271   1/1  PgiliGhNgdlAWglTvsyadvvdlyveelnpddYlydgewrpletreetikvkggdglllpvtltvyrT


                         -         -         +         -         -         -         -:490
query           LSDPELGAQLRTFAAKAPVTPEGEPAETAQDGDYAVAISWTALTPGRTADAIFLLNRARTFDEFREAART
00470011   1/1  tvyrTrhGPvlsdl.........................ltdgtalAlrwaaldpedrsllallalnrAk
00360971   1/1  TrhGPvlsad.......................ldwgdgyalalrwaglept.sllalldlnrArnveef
00486271   1/1  rhGPvls...........................ldggtalAlrwaaldnlrsllallalnrAksveefl


                         *         -         -         -         -         +         -:560
query           FEVPAQNLIYADTSGNIGYQAPGKIPVRGKGDGRWPAPGWDSDYDWKEYLPFEELPTVVNPDSGFIVTAN
00470011   1/1  sveeflaala.lgapsqnlvyADrdGnigylaagrvPirdegvdgllplpgs.geyewqgylpfeelPql
00360971   1/1  laalarl.vpaqNlvyADkeGnigylvaglvPirsegldgllplpGs.geyewtgylpfeelPqlvnPas
00486271   1/1  aalallgipsqnlvyADrdGnigylvagavPirdegllvdgllplpgsdgeyewqgylpfeelPqlinPe


                         -         -         -         *         -         -         -:630
query           QAVVDSGYPHLLTTDWDYGYRSQRVVTLLEAAIADGGLTVEDMVDIQLDNENSGARALVPYLVEVDVEGA
00470011   1/1  inPesgyvvnaNnrpvlpddypyllgfswalglRarrirellea...ggkltledllalqleadtrslla
00360971   1/1  gyvvnaNnrpvpanypyplggfdwllglRaqrilelLea...ggkldlddllallaqldvrsllaelllp
00486271   1/1  sgyvvnaNnrpvlanlasplkgadyplllsgdwalglRarrilellea...ggkltledllalqldtrsl


                         -         +         -         -         -         -         *:700
query           AAQAQELLAGWDFQQDADSAAAAFYNATYRHLLPLVFDELGANPKIEASQAWLLLTSLVESPESEWWRGE
00470011   1/1  rlllplLlkaldalpldpdlaealalLaaWdgradadsddkllagvgallfrawlrallkalfadelgal
00360971   1/1  lLlkaldalpldddlaealelLaaWdgradadsvaaalfasllalllawlrellralfldelgelllaal
00486271   1/1  larlllplLlkaldalgdpdlaealalLaaWdgradadsvgallfaawlrallralfadelglall....


                         -         -         -         -         +         -         -:770
query           EVSSRDEALRVAMERAAAELTELLGEDVAAWRWGDLHTLTVRNASFGESGIAAVEWLFNRGPVATGGGSS
00470011   1/1  llllalafdpadplltprlllllslleaallrllldgdslwlddvdtlgv.esrddlllaaledavaele
00360971   1/1  ealgllavpfdpadplntprglalllrlllgedspwlddadtgggesvddillaaledalaelearlGgl
00486271   1/1  ..........sawadplltpgglslddlllaaledavaeleeaygsl..dwrwGevhrlllghpl.....


                         -         -         *         -         -         -         -:840
query           VVNATGWDPAQGYEVTTVPSMRMVVDLADVDNSQWINLTGNSGHAFHPHYADQLELWAAGTMLPMRMTRS
00470011   1/1  eaygglladwrwgevhrlrlghpl............lnvgpvplgGgsgtlnv.......gfevthgasy
00360971   1/1  padwrwGdlhrlvlghpl...............ipvpagggdltvna.......gllvtfGasyrmvvdf
00486271   1/1  lpllggllnlgpvpvggdsttvnv......ggflvtfGasyrmvvdfgdlesarfilptGqsgnplsphy


                         +         -         -         -         -         *         -:910
query           AVEEAAEHTLVLRP--------------------------------------------------------
00470011   1/1  rmlvvdlgdgesarfi------------------------------------------------------
00360971   1/1  gdgerargilpgGqsg------------------------------------------------------
00486271   1/1  ddqlelwangeylpl-------------------------------------------------------