[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ55697.1


[Show Plain Result]

## Summary of Sequence Search
   1::243
   1::226  3.4e-54 34.8% 0042280 00422801 1/1   p containing nucleoside triphosphate hy 
   3::228  5.1e-54 37.7% 0037958 00379581 1/1   p containing nucleoside triphosphate hy 
   9::222  7.9e-54 36.7% 0039041 00390411 1/1   p containing nucleoside triphosphate hy 
   4::228  3.3e-52 37.2% 0037898 00378981 1/1   p containing nucleoside triphosphate hy 
   5::239  1.2e-51 33.6% 0045860 00458601 1/1   p containing nucleoside triphosphate hy 
   7::228  3.1e-51 34.7% 0050943 00509431 1/1   p containing nucleoside triphosphate hy 
   5::228  3.3e-51 34.8% 0051025 00510251 1/1   p containing nucleoside triphosphate hy 
   7::228  4.7e-51 35.1% 0049080 00490801 1/1   p containing nucleoside triphosphate hy 
   4::228  2.4e-50 33.2% 0048220 00482201 1/1   p containing nucleoside triphosphate hy 
   4::228  6.9e-50 37.6% 0042070 00420701 1/1   p containing nucleoside triphosphate hy 
   7::226  9.4e-50 36.3% 0036790 00367901 1/1   p containing nucleoside triphosphate hy 
   1::228  3.2e-49 34.7% 0047589 00475891 1/1   p containing nucleoside triphosphate hy 
   5::228  3.7e-49 35.9% 0050274 00502741 1/1   p containing nucleoside triphosphate hy 
   7::228  8.5e-49 36.7% 0042557 00425571 1/1   p containing nucleoside triphosphate hy 
   5::228  9.5e-49 33.8% 0048226 00482261 1/1   p containing nucleoside triphosphate hy 
   8::239  1.4e-48 37.4% 0040410 00404101 1/1   p containing nucleoside triphosphate hy 
   1::228  1.5e-48 35.2% 0050044 00500441 1/1   p containing nucleoside triphosphate hy 
   2::227  2.4e-48 34.4% 0046697 00466971 1/1   p containing nucleoside triphosphate hy 
   1::237  2.9e-48 34.7% 0044086 00440861 1/1   p containing nucleoside triphosphate hy 
   5::215  3.4e-48 37.9% 0043607 00436071 1/1   p containing nucleoside triphosphate hy 
   7::228  5.9e-48 34.2% 0047599 00475991 1/1   p containing nucleoside triphosphate hy 
   7::228  8.9e-48 34.1% 0053059 00530591 1/1   p containing nucleoside triphosphate hy 
   4::228  5.6e-46 41.4% 0037230 00372301 1/1   p containing nucleoside triphosphate hy 
  12::224  7.8e-46 33.2% 0046693 00466931 1/1   p containing nucleoside triphosphate hy 
   1::228  8.7e-46 38.0% 0036748 00367481 1/1   p containing nucleoside triphosphate hy 
   3::228  1.8e-45 37.6% 0036121 00361211 1/1   p containing nucleoside triphosphate hy 
   6::209  3.7e-42 38.2% 0043651 00436511 1/1   p containing nucleoside triphosphate hy 
   6::233    4e-42 34.2% 0049825 00498251 1/1   p containing nucleoside triphosphate hy 
   2::227  6.1e-42 35.8% 0049537 00495371 1/1   p containing nucleoside triphosphate hy 
   4::228  7.5e-42 39.3% 0046869 00468691 1/1   p containing nucleoside triphosphate hy 
   1::228  1.3e-41 36.5% 0048852 00488521 1/1   p containing nucleoside triphosphate hy 
   4::227  6.2e-41 30.2% 0042496 00424961 1/1   p containing nucleoside triphosphate hy 
   5::235  6.4e-40 39.8% 0046945 00469451 1/1   p containing nucleoside triphosphate hy 
  13::214  6.7e-39 36.4% 0048545 00485451 1/1   p containing nucleoside triphosphate hy 
   3::229  3.4e-38 35.3% 0050061 00500611 1/1   p containing nucleoside triphosphate hy 
   9::228    1e-37 30.9% 0050337 00503371 1/1   p containing nucleoside triphosphate hy 
   7::239  1.3e-37 37.1% 0042214 00422141 1/1   p containing nucleoside triphosphate hy 
   8::209  6.2e-37 35.5% 0049611 00496111 1/1   p containing nucleoside triphosphate hy 
  22::215    4e-35 40.6% 0044893 00448931 1/1   p containing nucleoside triphosphate hy 
   4::222  1.7e-34 40.1% 0046479 00464791 1/1   p containing nucleoside triphosphate hy 
   4::229  3.5e-34 32.8% 0049503 00495031 1/1   p containing nucleoside triphosphate hy 
   1::230  1.1e-33 32.9% 0037960 00379601 1/1   p containing nucleoside triphosphate hy 
  32::188  2.8e-33 33.8% 0038144 00381441 1/1   p containing nucleoside triphosphate hy 
  27::228  2.2e-32 36.0% 0048593 00485931 1/1   p containing nucleoside triphosphate hy 
  17::222  1.4e-31 33.0% 0047841 00478411 1/1   arboxykinase-like                       
  24::215  4.1e-31 35.2% 0046860 00468601 1/1   p containing nucleoside triphosphate hy 
  19::200  4.3e-30 32.7% 0053253 00532531 1/1   arboxykinase-like                       
  21::221  6.6e-30 35.3% 0047537 00475371 1/1   p containing nucleoside triphosphate hy 
   6::226    7e-30 31.6% 0037163 00371631 1/1   p containing nucleoside triphosphate hy 
   3::219  1.1e-29 31.9% 0043798 00437981 1/1   p containing nucleoside triphosphate hy 
  30::227    1e-28 30.7% 0045731 00457311 1/1   p containing nucleoside triphosphate hy 
   1::217  5.3e-27 26.4% 0036857 00368571 1/1   p containing nucleoside triphosphate hy 
   9::228    2e-26 33.3% 0048957 00489571 1/1   p containing nucleoside triphosphate hy 
  18::190    5e-26 35.2% 0047552 00475521 1/1   arboxykinase-like                       
  16::221  7.3e-26 33.2% 0046276 00462761 1/1   p containing nucleoside triphosphate hy 
  30::216  1.3e-25 32.6% 0047797 00477971 1/1   p containing nucleoside triphosphate hy 
   1::131  1.5e-25 36.1% 0038720 00387201 1/1   p containing nucleoside triphosphate hy 
   1::219  2.4e-25 28.5% 0036850 00368501 1/1   p containing nucleoside triphosphate hy 
  30::219  4.8e-25 28.3% 0042605 00426051 1/1   p containing nucleoside triphosphate hy 
  12::214  1.6e-24 34.5% 0043440 00434401 1/1   p containing nucleoside triphosphate hy 
  30::214  6.9e-24 34.5% 0046441 00464411 1/1   p containing nucleoside triphosphate hy 
   8::242  1.1e-23 29.5% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
  30::212  1.1e-23 34.7% 0049657 00496571 1/1   p containing nucleoside triphosphate hy 
  33::216  4.5e-23 31.8% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
  30::218  1.4e-22 31.7% 0041412 00414121 1/1   p containing nucleoside triphosphate hy 
  31::196  1.6e-22 32.3% 0048410 00484101 1/1   p containing nucleoside triphosphate hy 
  24::220  8.9e-22 29.1% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
  26::173    1e-21 33.6% 0048047 00480471 1/1   p containing nucleoside triphosphate hy 
  31::215  1.6e-21 31.7% 0053350 00533501 1/1   p containing nucleoside triphosphate hy 
   9::209  1.7e-21 30.5% 0037996 00379961 1/1   p containing nucleoside triphosphate hy 
  33::201  8.7e-21 35.9% 0048702 00487021 1/1   p containing nucleoside triphosphate hy 
  32::229  2.2e-20 27.8% 0040588 00405881 1/1   p containing nucleoside triphosphate hy 
  31::194  3.2e-20 28.4% 0051553 00515531 1/1   p containing nucleoside triphosphate hy 
   7::228    4e-20 31.8% 0043794 00437941 1/1   p containing nucleoside triphosphate hy 
  31::177  7.6e-20 34.5% 0047538 00475381 1/1   p containing nucleoside triphosphate hy 
  17::203  2.5e-19 26.9% 0047844 00478441 1/1   arboxykinase-like                       
  31::217  3.6e-19 34.1% 0049343 00493431 1/1   p containing nucleoside triphosphate hy 
   1::216  8.7e-19 27.5% 0040419 00404191 1/1   p containing nucleoside triphosphate hy 
   2::215  5.4e-18 24.8% 0037926 00379261 1/1   p containing nucleoside triphosphate hy 
   4::215  6.4e-18 31.2% 0040678 00406781 1/1   p containing nucleoside triphosphate hy 
  31::191  3.1e-17 28.6% 0051551 00515511 1/1   p containing nucleoside triphosphate hy 
   9::199  6.9e-17 26.6% 0035641 00356411 1/1   p containing nucleoside triphosphate hy 
  33::232    1e-16 25.7% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
  16::215  2.6e-16 34.1% 0039270 00392701 1/1   p containing nucleoside triphosphate hy 
   4::229  4.7e-16 29.3% 0051056 00510561 1/1   p containing nucleoside triphosphate hy 
  27::199  6.8e-16 27.5% 0045157 00451571 1/1   p containing nucleoside triphosphate hy 
  23::216  8.5e-16 20.5% 0048025 00480251 1/1   p containing nucleoside triphosphate hy 
   2::238  1.1e-15 27.3% 0046895 00468951 1/1   p containing nucleoside triphosphate hy 
  32::202  4.9e-15 25.5% 0053247 00532471 1/1   p containing nucleoside triphosphate hy 
  33::222  6.6e-15 25.0% 0048044 00480441 1/1   p containing nucleoside triphosphate hy 
   8::239  1.1e-14 22.1% 0043986 00439861 1/1   p containing nucleoside triphosphate hy 
  31::215  5.5e-14 36.8% 0049919 00499191 1/1   p containing nucleoside triphosphate hy 
  26::201  1.1e-13 22.4% 0047073 00470731 1/1   p containing nucleoside triphosphate hy 
   8::239  1.8e-13 30.4% 0049853 00498531 1/1   p containing nucleoside triphosphate hy 
  32::222  3.1e-13 25.1% 0049881 00498811 1/1   p containing nucleoside triphosphate hy 
  21::202  6.2e-13 27.2% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
   6::227  1.7e-12 25.8% 0044438 00444381 1/1   p containing nucleoside triphosphate hy 
  19::217  2.1e-12 25.0% 0051325 00513251 1/1   p containing nucleoside triphosphate hy 
  31::220  1.1e-11 24.1% 0048963 00489631 1/1   p containing nucleoside triphosphate hy 
  26::196  1.6e-11 33.6% 0043218 00432181 1/1   p containing nucleoside triphosphate hy 
  10::199  1.9e-11 22.5% 0047701 00477011 1/1   p containing nucleoside triphosphate hy 
  23::218  8.8e-11 29.7% 0042094 00420941 1/1   p containing nucleoside triphosphate hy 
  11::208  9.5e-11 26.3% 0048255 00482551 1/1   p containing nucleoside triphosphate hy 
  33::195  4.1e-10 28.2% 0046916 00469161 1/1   p containing nucleoside triphosphate hy 
  19::201  9.4e-10 29.9% 0038674 00386741 1/1   p containing nucleoside triphosphate hy 
  30::216  1.4e-09 28.8% 0040237 00402371 1/1   p containing nucleoside triphosphate hy 
  25::229  2.5e-09 27.4% 0051769 00517691 1/1   p containing nucleoside triphosphate hy 
   1::202    8e-09 25.4% 0043792 00437921 1/1   p containing nucleoside triphosphate hy 
  14::200    1e-08 25.2% 0036729 00367291 1/1   p containing nucleoside triphosphate hy 
   6::218  1.2e-08 27.0% 0052155 00521551 1/1   p containing nucleoside triphosphate hy 
  25::195  1.2e-08 27.4% 0050867 00508671 1/1   p containing nucleoside triphosphate hy 
  27::190  1.2e-08 26.4% 0049933 00499331 1/1   p containing nucleoside triphosphate hy 
  32::233  3.1e-08 24.1% 0047808 00478081 1/1   p containing nucleoside triphosphate hy 
  25::202  5.1e-08 26.7% 0043790 00437901 1/1   p containing nucleoside triphosphate hy 
  24::217  7.8e-08 22.3% 0048266 00482661 1/1   p containing nucleoside triphosphate hy 
  16::66     1e-07 36.0% 0041032 00410321 1/1   p containing nucleoside triphosphate hy 
  31::171  1.2e-07 23.9% 0047607 00476071 1/1   p containing nucleoside triphosphate hy 
  32::194  2.4e-07 28.2% 0051535 00515351 1/1   p containing nucleoside triphosphate hy 
   9::201  2.1e-06 23.3% 0047394 00473941 1/1   p containing nucleoside triphosphate hy 
  21::218  2.4e-06 25.9% 0052726 00527261 1/1   p containing nucleoside triphosphate hy 
  31::191  2.5e-06 25.3% 0046162 00461621 1/1   p containing nucleoside triphosphate hy 
  26::203  2.6e-06 21.2% 0053315 00533151 1/1   p containing nucleoside triphosphate hy 
  25::186  4.6e-06 26.8% 0040984 00409841 1/1   p containing nucleoside triphosphate hy 
  31::100  4.9e-06 30.0% 0047813 00478131 1/1   p containing nucleoside triphosphate hy 
  32::178  5.4e-06 23.2% 0050989 00509891 1/1   p containing nucleoside triphosphate hy 
  31::216    1e-05 23.8% 0048706 00487061 1/1   p containing nucleoside triphosphate hy 
  28::221  1.3e-05 24.8% 0047291 00472911 1/1   p containing nucleoside triphosphate hy 
  28::74   1.8e-05 36.2% 0042008 00420081 1/1   p containing nucleoside triphosphate hy 
  28::67   2.5e-05 35.0% 0040121 00401211 1/1   p containing nucleoside triphosphate hy 
  16::213  2.6e-05 23.7% 0043012 00430121 1/1   p containing nucleoside triphosphate hy 
  31::185  2.6e-05 23.6% 0048272 00482721 1/1   p containing nucleoside triphosphate hy 
  18::191  3.1e-05 22.1% 0041617 00416171 1/1   p containing nucleoside triphosphate hy 
  20::199  3.3e-05 24.0% 0041053 00410531 1/1   p containing nucleoside triphosphate hy 
  26::215  3.3e-05 24.6% 0051138 00511381 1/1   p containing nucleoside triphosphate hy 
  17::53     5e-05 37.8% 0037862 00378621 1/1   p containing nucleoside triphosphate hy 
   4::64   6.7e-05 24.6% 0047127 00471271 1/1   p containing nucleoside triphosphate hy 
  21::67   0.00011 31.9% 0049577 00495771 1/1   p containing nucleoside triphosphate hy 
  28::67   0.00023 41.7% 0047839 00478391 1/1   p containing nucleoside triphosphate hy 
  28::100  0.00025 25.0% 0051604 00516041 1/1   p containing nucleoside triphosphate hy 
  31::200  0.00031 27.3% 0051958 00519581 1/1   p containing nucleoside triphosphate hy 
  27::54   0.00036 46.4% 0048939 00489391 1/1   p containing nucleoside triphosphate hy 
  31::66   0.00076 33.3% 0040315 00403151 1/1   p containing nucleoside triphosphate hy 
  28::54   0.00094 33.3% 0044482 00444821 1/1   p containing nucleoside triphosphate hy 
   1::243


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTTPPALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPP
00422801   1/1  llllllallllllllllldpllelenlsksyggrlvlalkdvsltvkpgeivalvGpnGsGKSTllklla
00379581   1/1  --lepllevenlsksyggvlalkdvsltvkpgeivalvGpnGsGKSTllkllagllkptsGeilldgldi
00390411   1/1  --------MknlslrygnfralkdvslelppG.ltalvGpNGsGKStLlkalagllgpdsglrvgklsdl
00378981   1/1  ---lpllelenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldl
00458601   1/1  ----lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdi
00509431   1/1  ------Mlelknlslsnfr..vlkdelvslefepg.ltaivGpNGsGKStlldalagllggrslrllrag
00510251   1/1  ----lllllllllaeellelleeeelllllllllllllgdpllelenlsksyggvpalkdvsltikpGei
00490801   1/1  ------llllllllalllelleeeeellllllalllllgdpllelenlsksyggvpalkdvsltikpGei
00482201   1/1  ---llllelknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdi
00420701   1/1  ---lpllelenlsksypgggvlalkdvsltvepgeivalvGpnGsGKSTllkllagllkptsGeilldgl
00367901   1/1  ------lelknlslsyg.ksilkdvsleip.geltalvGpnGsGKStllkalagllgpdvsallrlsgli
00475891   1/1  lllelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdi
00502741   1/1  ----lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdi
00425571   1/1  ------lelenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldl
00482261   1/1  ----lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdi
00404101   1/1  -------elenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagll.ptsGeilldgldl
00500441   1/1  lllelllelknlsksyggvlalddvsltikpgeivalvGpnGaGKSTllkllagllkptsGeilldgkdi
00466971   1/1  -llalllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdi
00440861   1/1  MpllslgepllelenlsksyggvvalkdislsipkGeildlldellellkeldgsllnvalvGpsGsGKS
00436071   1/1  ----pllelenlsksygg.lalkdvsltvepgeivalvGpnGaGKsTllkllagllkptsgeilldgldl
00475991   1/1  ------lllaaelpelgelllevvnlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagll
00530591   1/1  ------llllllaleelpllgelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkll
00372301   1/1  ---yvlPllsdgmpllelenlrkpyggllvlndvsl...pgeivaltGpnGaGKSTllrllaglllpasg
00466931   1/1  -----------Mkllslslgnfralkdvslelp.geltalvGpNGsGKStLlkalagllgpdsGeilldg
00367481   1/1  yvrPelldepllelengrhPllsksyggkvvlndislsip.gellvitGPngsGKSTllralaglllpas
00361211   1/1  --plellgepllelenlsksyggitalddvslgirkGeivllvGpsGsGKStllrnllagllaptggsvl
00436511   1/1  -----ievpvglallgrvldllgepidgkgplelgepllevenlsksyggrklvlepletgialddvslt
00498251   1/1  -----vekllglalllieklflkvlprllsllelenlskiytgipal.dvslglgGlppGeivlllGpsG
00495371   1/1  -esalellleledltklstgikaLddv.lggglpkGeivlllGpsGsGKttlalrllagllkp...evlv
00468691   1/1  ---lsvpvglallgrvldvlgepidglgplllllllpivrlappllelenlsksygtgialidvsltigr
00488521   1/1  lllllalelllevenlristgikeldkllsgglppgeitlivGpsGsGKTtLllqlavngllppdsGei.
00424961   1/1  ---lgepldglgplrpapgllelenvsksygtgialidlslpigkGervalvGpsGaGKttLlrliagll
00469451   1/1  ----allelenlskiyggvpkalddvslgiepGeivalvGpsGsGKstllrllagllaglptsGeillld
00485451   1/1  ------------skiygd.ealkdvsleikkllnlsgkpgeiigivGpsGsGKsTllrlLagllkplllt
00500611   1/1  --pgllsllelllelenltklptgipaLddv.lgggipkGeivllvGpsGsGKTtlllqlagllapdsge
00503371   1/1  --------Mmlkslelknfkslkdvsligdfspg.ltaivGpNGsGKStlldaiagllgpdsgeirldgk
00422141   1/1  ------dlsleelekllelllrdllglgplvklldplleeavvngasdihiepgggllrvryridgvlie
00496111   1/1  -------elenltklytgikaLddllslgippGeivllvGpsGsGKTtlalrllagllkptggkvliigl
00448931   1/1  ---------------------LddvslsvepgevialvGpnGsGKTTllnalagllapdggkvllvgadi
00464791   1/1  ---lsvpvgdkllGrvldvlgepidglgpllalerlpierlappllelenlskrfgtgivlidvslpigk
00495031   1/1  ---lsalellleledltkistgipaLddvlsggipkGelvllvGpsGsGKTtlllqlagllalglglipl
00379601   1/1  ltledllelenlsfsyggkealkdlslaiepgelvlivGptGsGKTTllkallgllppdegiitiegpde
00381441   1/1  -------------------------------GeliaivGpsGsGKsTLlklLagllppdsgsigslttrl
00485931   1/1  --------------------------LsvpkgevvalvGpnGaGKTTllallagllaptggkvllvgadi
00478411   1/1  ----------------Ggvlalhgvsldve.gevvlltGpsGsGKStllralagl.....Gtilldg.dl
00468601   1/1  -----------------------dlslevkkgevialvGpnGvGKTTllakLagllapqggkvlllgaDi
00532531   1/1  ------------------vlalkdvslviekGevvallGlSGsGKTTLlrllagllipddgeilidggdi
00475371   1/1  --------------------alddvslsikkgevialvGkgGvGKTTlaanlagllaptggkvlligaDi
00371631   1/1  -----mseliiylelselewallradvgltlteaelkrlkglndlleledlskiygplsrlikllleell
00437981   1/1  --lveklrpknldkvigqeealkdlslalkpgeiphalllvGppGsGKttlaralagllgpdsgkilldg
00457311   1/1  -----------------------------mkkgeiigivGpsGsGKSTlarllagllekpgsgvividgd
00368571   1/1  lplagladgdglgvllGkll..dgvpvtldlgelgrhllivGptGsGKStllrllaglllpdggrviviD
00489571   1/1  --------rvknlsksyggktalddvslsvepG.ivgLlGpNGaGKSTllrllaGllkpt..........
00475521   1/1  -----------------evlalhgvsldve.gevvllvGpsGsGKStllralag.....sGeilvdgdlv
00462761   1/1  ---------------yygdvtaldgvsltikkgevialvGpsGsGKsTlaraLagllpeepgsgvvlldg
00477971   1/1  -----------------------------hkgelvvlvGPsGaGKsTLlnaLlgll.ptsgvisvsgttr
00387201   1/1  mssgepllevenlskryggklalkdvslsvekgeivlLlGpnGaGKTtLlralagllgptsfvvsptftl
00368501   1/1  kerllllelrnvllddviGqeeakealsealelplkrpelfdglgvelpgknvlLvGppGvGKTtlaral
00426051   1/1  -----------------------------kpgevialvGpsGsGKSTlakllakelglefidsgdilrdg
00434401   1/1  -----------lsksyggllalddvslsvkkgliigitGpsGsGKTTlaraLaellrerggsvavidldd
00464411   1/1  -----------------------------vkkgeiivllGpsGsGKsTlaklLagllgptggsvlltgep
00503741   1/1  -------fifldlrplallplpdrlvgrdeeiealskalgg..aldgvslsiepggivllvGppGvGKTt
00496571   1/1  -----------------------------GkgelivllGpsGsGKsTlarlLagll...ggsvldtgepi
00512891   1/1  --------------------------------evilltGppGvGKTTlakalagelgakfgsvsltgrdv
00414121   1/1  -----------------------------kpgevvllvGpsGaGKTTLlrallglleglkvaviepdfge
00484101   1/1  ------------------------------kgpvigivGpsGsGKTTllraLagllkprggrvavigldi
00490731   1/1  -----------------------dvslsvkkgkvialvGkgGvGKTTlaaklagllakrggkvllidaDp
00480471   1/1  -------------------------sleikkgekvaivGpsGsGKSTLlnaLagllsptsvpettrdfil
00533501   1/1  ------------------------------rgeiialtGpsGsGKsTlaklLaellphldtgdvlldgep
00379961   1/1  --------yrpvdfddivGqeealralslalaagppegvllvGppGtGKstlaralagllppdsg.....
00487021   1/1  --------------------------------rmkiivltGpsGsGKsTlarlLaell....gvvvidtd
00405881   1/1  -------------------------------gervglvGrpgaGKSTLlnaltglkaivsgypgttldpn
00515531   1/1  ------------------------------kgekvallGlsgsGKSTllnrllglefaygpTigptsgti
00437941   1/1  ------lrplveklrpknlddvygqeevlkalslalekgrpehlllvGppGtGKTtlakalaglllptsg
00475381   1/1  ------------------------------mkgeiialtGpsGsGKsTlarlLagllkptsgivsvdglr
00478441   1/1  ----------------aevlalhgvsldin.gegvlivGpsGsGKStlalaLagl.....Gailvdddlv
00493431   1/1  ------------------------------kGelivllGpsGaGKsTllkllagllgptsgvisvggttr
00404191   1/1  vellpkvtlddlvgleelkealkealellslgikpgeivllyGppGtGKTtlakalanelkkrggrvlyv
00379261   1/1  -drllleelrpvllddviGqeeakealsealrlplkrlelferlglrrpgknvlLvGppGvGKTtlaral
00406781   1/1  ---plveklrpvllddvigqeeakeallealaglrlllkdlslgippgknvllvGppGtGKTtlakalag
00515511   1/1  ------------------------------kgekvlllGlsgsGKSTllnrllgleflpgpTigptegti
00356411   1/1  --------lknlsksygilkalkdislelkkgikilllGlsgsGKSTllnrllgleygpTiginegtiei
00513761   1/1  --------------------------------kiiaivGkgGsGKTTllnklaglla.dggkvlvidlDp
00392701   1/1  ---------------agarlaledlslgirpgknvlLvGppGvGKTtlaralagllgapfgrvda.....
00510561   1/1  ---ldglgepldgllpilaklfrpievlalgllerksverlstGikaLDll.lgiGglprGelvliaGpp
00451571   1/1  --------------------------MsikkgeiiaivGppGsGKsTlaklLakll..glivldgddl..
00480251   1/1  ----------------------EdlslavgkgkvialvGkgGvGKTTtaakLaaalaergkkvllidlDp
00468951   1/1  -lnvlgesidalgkilseilkllekgfltalgllerksverlstgikaLDll.lgiGglprGelvlivGp
00532471   1/1  -------------------------------pGkiIvitGpsGsGKsTlarlLaellnglggivsvddlg
00480441   1/1  --------------------------------rlivllGpsGaGKsTlaklLaell.pglivisvgdttr
00439861   1/1  -------kleeveristgipeldellgGglpkgslilitGppGsGKTtlalqlaanlaknggkvlyisle
00499191   1/1  ------------------------------kgkiigitGpsGsGKsTlaklLaellgatvgdvd......
00470731   1/1  -------------------------arpltfddvvgqdeakeeleellagllgikkpkvillvGppGsGK
00498531   1/1  -------ldklgkildlalkileksflklevlalgvlerkeverlstGikaLDal.lgiGglprGsltli
00498811   1/1  -------------------------------kPgkiigltGpsGsGKsTlarlLael.....gvividgd
00394721   1/1  --------------------aleallealrrgpprnvlLvGppGvGKTtlakalakelaagsgpilldgv
00444381   1/1  -----asdelekllelrpvlledvigqeeakkalslalelplkrlelfgklddligrspairrllellga
00513251   1/1  ------------------iellsdlslsipspevvllvGppGsGKstlakklaell..gfilidaddlr.
00489631   1/1  ------------------------------MkgklillvGppGsGKtTlaraLaellglpfiridgddll
00432181   1/1  -------------------------slelkkglkvalvGrpgvGKStLlnallglkvaivsdypgttrdp
00477011   1/1  ---------eelrklldlidklrdlllsldlglpkvaivGrsgsGKSTLlnall.............Gld
00420941   1/1  ----------------------lglslgirpgkgvllyGppGtGKTtlakalagel..gapfiridg...
00482551   1/1  ----------everlstgipalDellgGglppgslvliaGppGsGKTtlalqlaanaalplelgklggkv
00469161   1/1  --------------------------------llIvieGppGsGKsTlaklLaerlgltglsvlltredg
00386741   1/1  ------------------lealkavllgirpgehllLvGppGtGKTtlaralagelga............
00402371   1/1  -----------------------------rpgrnvllvGppGvGKTtlaralagllvrssgpilldgvpf
00517691   1/1  ------------------------lsfelkpglnvgivGhvgaGKSTLlnallgllgaivgdvlvdg...
00437921   1/1  lglllveklrpkllddvvgqeealerlllalkagklphlllvGppGvGKTtlaralarlllgsgggvdvi
00367291   1/1  -------------vtlddvvgqeeakeallealelalkgldlflslglrpgrnvllyGppGtGKTtlara
00521551   1/1  -----plveklrpvllddvigqeeakeallealarlkapelflslglrpgkgvlLvGppGtGKTtlaral
00508671   1/1  ------------------------hvsllklgeldislsikkgevivlvGpsGsGKsTlaraLakrLeep
00499331   1/1  --------------------------PslslkkgklivltGppGsGKtTlakaLaerl....glpfidtd
00478081   1/1  -------------------------------gkvivltGppGsGKtTlarlLaellkplgggvvvidtdd
00437901   1/1  ------------------------lslgirpgrillLyGppGvGKTtlakalakel.....gapvieida
00482661   1/1  -----------------------kkvaivllsnyalsislddlllildlykevqvaydnfykvdesdiay
00410321   1/1  ---------------yggllllkdlslelkkglkilllGlngaGKTTllnrllggefp.eygptig----
00476071   1/1  ------------------------------kgkiigltGpsGsGKsTlaklLaelglpvidtddltregv
00515351   1/1  -------------------------------mngklivltGppGsGKtTlaraLaerlglpvistddllr
00473941   1/1  --------eklrpvllddvvgqeevkkalllalalallrgepgehvlLvGppGtGKTtlaralagllga.
00527261   1/1  --------------------npfilgpkvdledfigreeelkeleeal.pk.ivlltGprGsGKTtllka
00461621   1/1  ------------------------------mkgmiialtGppGsGKsTlaklLaerl..glpfistddly
00533151   1/1  -------------------------MsldikkgklivltGppGsGKtTlarlLaerl..glpfistddll
00409841   1/1  ------------------------lslelkkglkvalvGrpgvGKSTLlnaLlgadlaivsdipgttrdp
00478131   1/1  ------------------------------kgkvivltGppGsGKtTlarlLaellkplglgvvvidgdd
00509891   1/1  -------------------------------pkvigitGpsGsGKTTlanaLarllkarglkvavidrdp
00487061   1/1  ------------------------------ldMkkgklIvieGppGsGKtTlakaLaer.gargldvvvi
00472911   1/1  ---------------------------mkmkkgklilltGppGsGKtTlaraLaellgapfisgddllrg
00420081   1/1  ---------------------------smkkglrIaleGpsGvGKTTlaklLarhlgptggrvllvgEPi
00401211   1/1  ---------------------------elkrglnvgivGhvgaGKSTLlnaLlgllldtlkgelerg---
00430121   1/1  ---------------vgqeeakeallealrrgrkglelgirpggnvllvGPpGvGKTtlakalagllfps
00482721   1/1  ------------------------------kgkiigltGpsGsGKsTlarlLael...glpvidtddlyr
00416171   1/1  -----------------diigqeeakkallealslaartgenvllvGppGtGKttlaralakllprsgvp
00410531   1/1  -------------------gelknlslelkkglkillvGlngvGKTtllkrlag................
00511381   1/1  -------------------------llllkpgglvlitGPtgsGKsttLlralnrleeagkgvilvkdai
00378621   1/1  ----------------glklllrrlslllkkglkvllvGlpgvGKstllnrla-----------------
00471271   1/1  ---prailelesliksllekllellkrlslklkkglkvalvGrpgvGKStLlnallggdfaevg------
00495771   1/1  --------------------alldilldilkgktvalvGpsGvGKStLlNaLlgellattgeipgdg---
00478391   1/1  ---------------------------msikkgklilltGppGsGKtTlaralaerl....glpvid---
00516041   1/1  ---------------------------mlk.gklillvGppGsGKtTlaralaeelglpfvvidaddl..
00519581   1/1  ------------------------------kpkvilltGppGvGKttlarlLakll.glpliidldalae
00489391   1/1  --------------------------lsikkgklivltGppGsGKtTlakaLae----------------
00403151   1/1  ------------------------------kglkivlvGdsgvGKTtLlnrllgdefpvsyiptig----
00444821   1/1  ---------------------------elkkllkvllvGlpgvGKttllnrllg----------------


                         -         -         *         -         -         -         -:140
query           AQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIG
00422801   1/1  gllkptsGeilldgldilalslaelrrrigyvfqdpalfpltvrenlalglllallllglskaeararal
00379581   1/1  talslaelrrrgigyvfqdp...alfpgltvrenlalglllllllllllllllllalskaearervlell
00390411   1/1  irrgadkasvelvfeldggllallrllslsggeklrvalakallgnpeillngepvnhldlrelllnllr
00378981   1/1  lllslaelllllrrgigyvfqdp...alfpgltvrenlalgllla....glskaeaaaraaellellgld
00458601   1/1  tglspqelrrlggvvvqevllffltllenlllglallllllvlllllllllllllaakeaalrallllll
00509431   1/1  glsdliflgslirsgadrasvelvfdlsdglyllerselilrrlilkpgsgeilingkdislldlrelrr
00510251   1/1  valvGpnGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvllffltll.......
00490801   1/1  valvGpnGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvllffltll.......
00482201   1/1  lglslkelrgigyvvqqdallpsltvlenlllgllllgllllllaakeaalralllllllgletlldrlp
00420701   1/1  dllllslaellalrrgigyvfqdp...alfpgltvrenlalgllla....glskaeararalellellgl
00367901   1/1  dlilkgllllprstvatvelifdllgllliirrlilrdgsgeilidgkdislldlrelrr..ligyvpqd
00475891   1/1  lglsllellrrgigyvfqdpalfpgltvlenlllgll......llglalkeaalralllllllgletlld
00502741   1/1  lglslaelrgigyvfqqlallpsltvlenlalgll....llglskaeaaaraaellellgledlldrlps
00425571   1/1  lalsllrrrigyvfqdp...alfpgltvrenlalgllll....glskaeaaaralellellglddlldrl
00482261   1/1  ldlslaelrgigyvfqqdallpsltvlenlllgllllgellllllaakeaalralllllllgletlldrl
00404101   1/1  talslaelrrgigyvfqdp...alfpgltvrenlalgll.........kaeararalellellgldelld
00500441   1/1  ldlsllrrgigyvfqdpa..lfpgltvlenlllgll....llglslaeaaeralelllllgledlldrlv
00466971   1/1  lglslaelllllrrgigyvfqdpa..lfpgltvlenlllgllllglllllaakeaalrlellllllglet
00440861   1/1  tLlnaLlgllkpdegvilvggk.gvTrdivlytledgvkltliDtpGlgdtklsdeeklilkyleeadlv
00436071   1/1  la..lrrgigyvfqdp...alfpgltvlenlalgllllgll......ealaralellellglgdl.drlv
00475991   1/1  kptsGeilldgkdildlslaelrgigyvfqqdallpsltvlenlllglllagellllllaakeaalrall
00530591   1/1  agllkptsGeilldgkditdlslkelrgigyvvqqdallpsltvlenlllgllllgllllllaakeaalr
00372301   1/1  gilvdgedlr.......igyvfq........................................llervgl
00466931   1/1  kdilalspeellrllrrrigyvfqepalfpgltveenlllglllrlllelllgrlelllllllllellal
00367481   1/1  ggilvpgedalll...............................................rvdeiltrvg
00361211   1/1  ldgleisalslaerlragigyvfqdl...alfpeltvlenlalg.................rarellerl
00436511   1/1  ikkGervglvGpsGaGKtTLlkllagllkpdsGeilvdgligerlrevlelirelelaelrr..rigyvf
00498251   1/1  sGKTtLalrllagllkpgggvvyidgeesldllrarrlgvvlqell..lfpeltveenl...........
00495371   1/1  dgldltglsparggiglvfqteallpp..ltvrenlealgldlr.glld......rerviellelvglee
00468691   1/1  GervglvGpnGaGKttLlkllagllkpdsgeilvdGedlrelrelrrrigyvfqdp...alfpeltvlen
00488521   1/1  ...........ggkvlyvdqee...slfpltvlenlalg...............gedveellerlgl.dl
00424961   1/1  dpdsgeilldgvdigersrevtelleelrrviglvfqdp...plfprltvaenialgaeyf....rdega
00469451   1/1  gkdvlylsleesleqlrrrigyvfqdpalfp...............................aeellelv
00485451   1/1  ggkvlvigldifrlsarelrkrigvfqdpa..llphltvpenldlglll..........eilervlelle
00500611   1/1  illggkvlyisleeslrrrrigmvfqelgldpdltv.......................arerviellel
00503371   1/1  dlliylsdlirrgagiayveqef..dlfdgltvlenvllglgdeliirrrilrdgrseyllnglgvslke
00422141   1/1  lifldeeellallsrlkslaglpilearlpqggriqavlppvvvdfrvstlpdigglslvirklrevilt
00496111   1/1  elsaeelrerr.rrigyvfqepa..lfpeltvlenlalgll.............................
00448931   1/1  arlaareqlgivfqd......pgltvlenlalg.............eleararellellgledydvvliD
00464791   1/1  GervglvGpnGaGKTtLlkllagllkpdsgeivvygligerprevrellglllelgvlf...........
00495031   1/1  ggkvlyigleltlsperlrlraqsl.............................gldldellerllvidl
00379601   1/1  l...lrnkigyvfQdpv...lfpltvren.........................................
00381441   1/1  prlgevdgvdltfls.reeigyvfqepa..llpdltvlenlylglllalllaleegkivildgdreraee
00485931   1/1  rr......igavpqlp..vlfprltvlenlalg...........gadlaeraeellellglegfdvvliD
00478411   1/1  vrlglkdgigmvfqdp..alfplltvrengvalgllla....glskaeieervdlllelvglddlldryp
00468601   1/1  yraaaaerlgigavpqdvplfpsltvldnlalar......dlleaakaagydvvlidtaglld.ldrlvg
00532531   1/1  nleggfyakaigllrrkigyvfq.....lfpfltvlenvalgld......glvdeedleraenllalvgl
00475371   1/1  ...........................................rrpsarellgllgellgldvlvgargg
00371631   1/1  rllgklalddvslsvkkpeiigiaGpsGsGKSTlarlLagllapesgglkvlligtDifylpaeqlkrig
00437981   1/1  kdi.....rrgiglvfqli...glfphltvlelvalgl..........ggilveevrellkel.......
00457311   1/1  dlyklsreelrklrrrigmvfqdpalflnpgltvrenlaeplrll.klgkk...........llepvglp
00368571   1/1  pkgeyaglarglgvvildpgdgrsvrlnplaliddeedaaellralvsemgrgeddfftpaarallrali
00489571   1/1  ......................................................................
00475521   1/1  dleplrrdigmvfqdpa..lfplltvrenvilgllelagl...skaealarvdellelvglddellldrl
00462761   1/1  ddlr...lglliglvfqdp...dllpfltvlenvllpllaagliv.........ivdgtlllvglrealr
00477971   1/1  pprpgevdg.vgyvfqsrelfpel..tvagnflegaevr....gnlygtsrerveellea.gldvlldid
00387201   1/1  vreyelGeilldgrdlyrlsleeallllfldeileidglllvelregigyvfqdp..alfp---------
00368501   1/1  akllgapfiridgseltekdyvGesvearlrelfeeaigyvfqdp...alfpgtvlenlalgllvselig
00426051   1/1  vdlggesglllrdlrrliglvfqdpilfpgltvglllffldnidlgllirgdeeleaalelaglprviel
00434401   1/1  fyrpaaell..lreglgidfqlpdal.....................drellreevlellglgevvivdv
00464411   1/1  vsgeplgeligevfqdg..ilfpdltvlenvalgrygllglikealaegviv...ildrvglsdla..yp
00503741   1/1  Lakllagllkpkfgeillfg..........kvvyvnvselldl...........................
00496571   1/1  rgeplgelirglvfq..dpllldeltvlenlalgrylhl...glilaalaagvgvvldrvglsdlaygfp
00512891   1/1  ..rsarrgigyvfq..........tveellgllaelvgle................vrgeleellktlik
00414121   1/1  ilidgqlledlgvlavrlgigyvpqtl..glfpaltvlellalall....lredpdlilid.........
00484101   1/1  grldldellg........igylfqdvgllpvltvrenlalllrglpgysaeeleralellelagfdvili
00490731   1/1  yrpaadellgvlaee...........................................lgldvllgargg
00480471   1/1  geilldgkdltlvdtpgiargrlklllearraai.givfqdv..dllltltvaenlllgldllllellke
00533501   1/1  igtp.lgrgigyvfqdpalfpgltvrenlelllvfadrygvlrglikpalaegvsvildrvglsdlaydg
00379961   1/1  ..........rivlvgnlsdlldpkdlrell......ragiplvflnfaalpasllesel..........
00487021   1/1  dllra......gevfqdyalfphltvlelldnvllgleir.gllk...aerlervevllervgl..lldr
00405881   1/1  lgvveldd.......................grqlvlvDtpGlielaslgeglvrqalealeradvillv
00515531   1/1  eidgvklqlwDtgGqerfrslwilyfedadaiifvvdlsdrdsflelrrwigrlfqdlnlfpsltvlenl
00437941   1/1  gvrvlgidaselld........................................................
00475381   1/1  lavlsrdllgllreglirigyvfqdyalfprltvlenvllgll...........................
00478441   1/1  llelrgrdilmvfqppa...lfpllevrglniaevlela.glskaealkrvdlvlelvgld......dry
00493431   1/1  eprpgevrg.igyvfqsgalfphlivagnllegaevhgl......lygtskerveeale.kgllvlldr.
00404191   1/1  sa...................................................................d
00379261   1/1  Akllgapfvevdaselteggyvgedlekr....irelfqearllvfltvlenirldaseylekrvvsrli
00406781   1/1  elgvpfvrisa...........................................................
00515511   1/1  eidgvklqlwDtgGqerfrslwllyfegadaiifvvdlsdgdsllalrrwigrlfqslnllesllvlenl
00356411   1/1  dgvkltlwDtgGqesfrklwilyfegadaiifvvdasdrdsflnldkwrnrlgevlqllelilnltvlen
00513761   1/1  aranlpeqlgi.......dirdlidletvme.lglgpngalvfaleellttldillealelleedydyil
00392701   1/1  .............................................................sdllgkyvg
00510561   1/1  GsGKTtlalqlaanlaaqggkvlyisteesleqlrarrlgldldrlllldaltv................
00451571   1/1  .......lreaiglvtqdgelllelidegilvpdeiv...........iellrealeeldadgvildgfp
00480251   1/1  yrpsapeqlgilgellg...................vpvvgvltgldlagalrealellllegy.dvvli
00468951   1/1  pGsGKTtlalqlaanlaklggkvlyidteesldqlr.arrlgld..........................
00532471   1/1  rdvgelggaalldivd................egrliglvfqdldllpllevlellaa..rleellerip
00480441   1/1  epregevlg.vdyvfvdrelfeelivagnlledaivhgllygtsk......erieealda.glgvlldgf
00439861   1/1  esreqllera.....................................erlgldleellllgllsiliadp
00499191   1/1  .....gllvgvvfqd...dfylllpalevlengafll..dlllpdaldrelllelllalveglvvlldry
00470731   1/1  TTlaralakel..gagfilidgddlrekavgeleklgrdlfqvaregglvpdilfideidallrkgpdvi
00498531   1/1  aGppGsGKTtlalqlaanlaklggkvlyisteesleqlrarrlgld........................
00498811   1/1  dltrelvaggglliglifqdfglfelldrellielllenlalglalegvildalrrrllelldllgldvv
00394721   1/1  pv........................................................vrldlsellsvs
00444381   1/1  rpgenvlLvGppGtGKTtlakalakllgvpfiridgselte.....kelvGe..................
00513251   1/1  ......................................................................
00489631   1/1  rellgellgrgigf...............gfqqgdlledatvlenlalllldeidka.........ledg
00432181   1/1  tlgvveldgrkl..........................................................
00477011   1/1  vlpvgggpgtrrptelrlsetpgltvlvvflelgerldllglvfqdfsllpelielenralagpiagisr
00420941   1/1  .............................................................sellgkyvg
00482551   1/1  lyisteeafsperlreralsl............................gldleelld.rllvidatdll
00469161   1/1  fgtplgelirelllegfqdlilvpdllvlellaanraglrelikellaagkgvi...ldrfplsrl....
00386741   1/1  ..............................................................pfvrldas
00402371   1/1  vrldaselle......................................................fgkyvg
00517691   1/1  ...............................................gtlllllgllsfllalvldslpl
00437921   1/1  elda.................................................sdlrgvddlreligevl
00367291   1/1  lanel..gapfirvda......................................................
00521551   1/1  agllga................................................................
00508671   1/1  gsgvvlldgddlraglsiglilsdedraalrrrlgevfqelllagrlvvldgtalglelrdelrellkea
00499331   1/1  dllrepvigagtdigevfqdlll..aggllvddev..................rrlllealdelllaggk
00478081   1/1  lrreairell.lgldlleilf................................................e
00437901   1/1  selrd........................................................vddlsgyvg
00482661   1/1  qyallakedenaaaflksnrqkklvrdladrviaeerlellekiieellrirldklledldeiveelppv
00410321   1/1  ----------------------------------------------------------------------
00476071   1/1  llggpllerirellgegyllfdeal............................drellaallfglelega
00515351   1/1  eavpggtdigelfqdyllfpfltvdeni..............................rglllealeell
00473941   1/1  .................................................................pfiel
00527261   1/1  lakel...................gkpviyidlselsskgyvdleellrelaeelgell..........e
00461621   1/1  revvergtelgklikdyfdpgalvpd.llirlllerllfldeg...ggflldgfprtleqaeals....k
00533151   1/1  relvpggldigevfqdaleagl.........................llfddefrglllerleellargp
00409841   1/1  ilgv..................................................................
00478131   1/1  lrreavgqlglglsieeldealllpdalrr----------------------------------------
00509891   1/1  grldldeplgv.......drerlrrvgelallla...........................ggglcalva
00487061   1/1  yepvdywaavgggdllrlirelllrlg...................fgepdafdnellgellealleg..
00472911   1/1  lageggkpl..........................................................gll
00420081   1/1  aywr------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00430121   1/1  gvpfirinlselte......................................................kl
00482721   1/1  elvaggtplgerirellgegyllpdea............lfrallaellfgdllalalldgvvydrlrde
00416171   1/1  fvrvncsalte......................................................dlles
00410531   1/1  .........................................gefv..dygptigvnfktvevdgvklviw
00511381   1/1  dtrlgielvvsriglvleavglffaldllelll.....................................
00378621   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00516041   1/1  ..lrgeelgriielfdearelvpelallfi----------------------------------------
00519581   1/1  llfgdvgglvvdli........................................................
00489391   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDE
00422801   1/1  ellellplgldtlldrlvgeLSgGqrqrvalArallldpdllllDEptsgLDpetraellellrelak.g
00379581   1/1  elvgldtlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakegltvll
00390411   1/1  rrgiglvpqeh..dlfplltvaenialldelaglpkygnylsllkeklkelnallkelelqlkelarlle
00378981   1/1  dlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdl
00458601   1/1  lgledlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvt
00509431   1/1  ..ligyvpqdpn..llfqltvlenlllgpeerrelldellglellsleealaraeealeelnallkelee
00510251   1/1  ......lllaakeaalraellllllgletlldrrpseLSgGqrqRvalArallldpdllllDEPtsgLDp
00490801   1/1  ......lllaakeaalralllllllgletlldrrpseLSgGqrqRvalArallldpdlllLDEPtsgLDp
00482201   1/1  seLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelak.gltvllvthdlsea.rlad
00420701   1/1  ddlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthd
00367901   1/1  p..alfpqltvlenlllglelrrklldellgllellalleellklleellkelevleaalaallkeeiee
00475891   1/1  rlvseLSgGqrqrvalarallldpkllllDEPtsgLDpetraellellrelakegltvllvthdldealr
00502741   1/1  eLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvthdldealrladr
00425571   1/1  vgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealal
00482261   1/1  pseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelak.gltvllvthdlseal.la
00404101   1/1  rlvgeLSgGqrqrvalarallllleelsldpdllllDEPtsglDpetraellellrelakegltvllvth
00500441   1/1  seLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakelgltvllvthdlsealrla
00466971   1/1  lldrlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakegltvllvthdlde
00440861   1/1  llviddglteldlellkllkelgkpvilvlnkiDllkkeelekllkslnkelglkelrrgigyvfqdp..
00436071   1/1  seLSgGqrqrvalarallldpdllllDEptsglDpetralllellrelaeelgltvllvthdldlalala
00475991   1/1  lllllgletlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltv
00530591   1/1  alllllllgletlldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelak.g
00372301   1/1  edlldrlpstlsgGqrqrvai.ralatepsllLlDEptsgldpelraalaeallellaelgatvlfvtHd
00466931   1/1  lldlllllllllllllllllllvlllllllllvlllllllalllllalkeaallleelllllglgdlldr
00367481   1/1  lsdlldrgls.lsggerqrvalaralatdpslllLDEptsgldpedgaalaeallellaellgatvlvvt
00361211   1/1  glail.drlpgeLSgGqqqrvaiaralaldpdllllDeptsalssrssendpetvaellellkelakelg
00436511   1/1  qdpalpallrllalfpaltvaenlrfgl....glavlllldsatrlaqakreisalarellervglpgd-
00498251   1/1  ........................drlprllsggqrqrvvidsalalrpkllllDEPtsgldplsarell
00495371   1/1  lldrlprelsggnqrqrvvia.alallpkllllDEptsaldvslraeilrlLkrlakelgvtvllvthdl
00468691   1/1  lalgallag....................lglaeyldelgkdLSgGqrqrvalAr.....pvlLllDEpt
00488521   1/1  ldrlphqlsggqrqrvaiaralaeelkpdllvlDeitalfraelegrptsaldvsllrellrlLkrlake
00424961   1/1  dvllladsllrlagalrevlgrlgrelSgGqkqrvaiarallleragnleggGsiTalatvlveggsdpd
00469451   1/1  gledlldrlpgelSgGqrq..aiara.ardpdllllDeptsalrgsenDpetraeilrlLkelakelgvt
00485451   1/1  lvgldvvlldtyphelSgGqrqRvaiaralaldpdvlllDEptsglDpetralelldllrtdldkelgrt
00500611   1/1  vgllelldrlprelkrsggqrqrvviDaralllrpel..lDEptsaldvslraeilrlLkrlakelgvtv
00503371   1/1  liellldlsggelnrvalllqgevdlllldepterldfldelagleeykgnyeellklleeleellkele
00422141   1/1  ledlglsygdpealkdlslaippgglvlltGptGsGKtTllralagllnpdegriltiedp.........
00496111   1/1  .drlpgeldlSgglqrqrvaia...agdpdllllDeptsalrslgndpelraellrllkrlkelgvtvi-
00448931   1/1  tagrlrlpselsggqkqrvaiaralaaplppevllldeptsglda..lrellellrel...gltvlvvth
00464791   1/1  .....................aaellervglvaatadeppgelsggqrqrlaiAraladdqgkpvllllD
00495031   1/1  lelvgllelldrlprelsggqrqrvviDalalllrpell..DeptsaldvqlvaeilrlLkrlakelgvt
00379601   1/1  ...........laralrqdPdilllDEptsalda..e..llqallt....ghtvvlvthhlntaldladr
00381441   1/1  llellgldadlviilpasleellerldrrggelsggqkqRvalarall----------------------
00485931   1/1  tagrgrrvgelsggqkqrvaiarallllldpelllldEptsglda..lrlllellkel...gltvlvvth
00478411   1/1  delsggqrqrvaiaralalepelllldeptsaldplavvellelllglnee.................ld
00468601   1/1  elsggqkqrvaiarala.apevllldeptsgldalae..llelleel...gltvlvvtKlDgtakgghdl
00532531   1/1  eeipnrypselsgGqqqrv...........illldEPtsgLdpvsrleladriyvl.lsG----------
00475371   1/1  dlsgglrqr..larallgdpdvlliDepgrgldpellallaelldllrelradlgllvvdathdldavlk
00371631   1/1  llfqkglpealdveellellldlke..............................gledilvpvlsggqk
00437981   1/1  .....lsgGqkqrvaiaralagdpkvlllDEpt.aldpdaqnaLlklleelak.gvtvilathdlsellp
00457311   1/1  evldryphelsgGqrQRv...ralaldpdllilDeptsalgqpdpelr.elldllifldadlgltlirli
00368571   1/1  lalaeepeptldellellselglrdladrleklvagglagllegaektaasilellrkllallldlggpa
00489571   1/1  ......lallelrntteagaasgsrdkgllgklkpetraelldllre...egttilvvth.ldeaer.aD
00475521   1/1  p...sggqqqeilrvaiallilpvllgralallpelllldeptsaldpdl--------------------
00462761   1/1  kllgllsgGqkqrvadlvvlldadpevllaReptrgldpeteeeleellerleereplygadiviithdl
00477971   1/1  pqglsggqkqrlalaralilppsllrgldep.ealdarle.raleellelae.gfdvvivnhdleealel
00387201   1/1  ----------------------------------------------------------------------
00368501   1/1  appgyvggdlggllteavlealriklvegelgfrelerevlldlplhdasviallgggrelrdgellkal
00426051   1/1  llegldtlaggggvvlsGgqrqrvalar.....pdlllfldeptselleRllkrltrpgldadteeelle
00434401   1/1  ydlsggerqr...aralasgpdvlilDgptlgldv............lldlpdlvifvdhdlevalerrl
00464411   1/1  gflsggeqqrvaiarallpkpdlvllldepteelde...RllkRg.rllekleyikkrlehylelaepyk
00503741   1/1  .kellrlllealglpppyq.....lsggerlrvalaeallalgkpdllilDEitnlldpetlspdvlelL
00496571   1/1  rtlsglgqrqrvalarallkpdlvifldeppteeldeRlrkrl........rlgdteevlehrleraeel
00512891   1/1  elsggekqrvalarallakpdvlllDEid.gldpdvleallelleelkrsgvtvilttndldel.eladr
00414121   1/1  .............sgGqkqrlalaralladpdlgellllDeptlvlDaasgedlldllkelaeqlgltvl
00484101   1/1  eGllelalplilelrelsdgqiqrvaparallrdpllllldedtvvldkvdlasil--------------
00490731   1/1  dlsgglrqr..larallgdydvliiDtp.gtldvllelallellkellaelgadvvllvvdatlgleaad
00480471   1/1  lkydpvilllnkidllddrllrraeaeerieel-------------------------------------
00533501   1/1  fprllsgggrqrvalaralvvkpdlvilldeplevldeRlrkrgrlelreldseevlekrlehyle.lle
00379961   1/1  .....lsggerqrvalaralalrpGllvlAdggvlllDEp.daldpevqaaLlrlleegevtieragit-
00487021   1/1  ippalsgGqgqrvildrallselayqpdvllldeplsgldaklreelrdllrellpegilp---------
00405881   1/1  vdasdplldqpvellsggekqrlalarallgkpvilvlNKiDep....tneldlellellee..lggtvv
00515531   1/1  anvpillvlnKiDlleakeraeellellglgdlldklpselsgGqkqrvalara----------------
00437941   1/1  .......pselsggerqrvliaralladpkvlllDEi.daldpeaqnaLlklleelpk.gvtvilttnrl
00475381   1/1  .llgglvvildggvrqrlalarallldpdvllldepl---------------------------------
00478441   1/1  pyelsggerqrvailr..vllpklllpdepgrnldvlievavlnlilkllg..idallelvdr-------
00493431   1/1  ..dlsggqqlrvalaralvvfildpslelldeRlsgrdadtreeirkrlkrlleelgplieydyvivndd
00404191   1/1  elvsklsgglqeqrvaiafalarkpdllllDEidalgldpelqeellelldelaergvtlilttnnrpee
00379261   1/1  gappgyvgyglggllteavrrlpysvllldelekahrpirvlllsaslvlllgglglpevgelllelldd
00406781   1/1  .......sellgkyvgelsgglrqrlalara..adpgvlllDEidalldarsgsgsggdsssrrvlnaLl
00515511   1/1  anvpillvlnKiDlleaklvllllvglfdlldglpselsggqkqrvalara-------------------
00356411   1/1  vpiilvlNKiDlleekive.ellellgleykgdrdpeelsggqkqrvalaralakdpdi-----------
00513761   1/1  iDtpGglelrallalllaiaralaadeillvddptsgldaetqleilelllelllklgipiilvlnKlDl
00392701   1/1  elsgglrqr..larallakpsvlllDEidklapkrsptsgldvelrrrvlnaLlrlleglrllsgvtvia
00510561   1/1  .....................eellalaerllsggkvdlvviDsltalapalelsllldeptsgldasll
00451571   1/1  rllgqaelllsggkadlvifldaplevlleRllkrddekilkrleeqkqrvaiarallk-----------
00480251   1/1  Dtagglqrglllalaladlllvllldepllvldatagtellelakgllealgldgvvltkldlvaalgaa
00468951   1/1  ..lddllllpaltveellala.........erllsggkpqlvviDsltalrpalllldeptgellgldvr
00532471   1/1  palsggqgqrvildrslysrpavlllllyvdeplsgldvelreelrdlleslllvlplpdlv--------
00480441   1/1  prglsqaqalrlaldlvllldpslevlleRllgrgddteevirkrlerlapeleyyeelgladvvivndd
00439861   1/1  lglsgeellrvllalalelkpdlliiDeltalldaervrelrellralkrlakelgvtvilvsqltelil
00499191   1/1  prllsggqrqrvaia.....dpdvlildgptllldpe............................lrpla
00470731   1/1  ldgagrtpeqlealldllee......lgrpvvviilttnrevlldral.rRpgrllldep.---------
00498531   1/1  .......ldellllpaltveellala.........erllsggkpdlvviDsltalapslllldepgrvtq
00498811   1/1  ilegplllsgglrqrpdlvifldappevlleRllkRggldeetiekrlelylelaplygaadividnd.l
00394721   1/1  dlvgelegglrgllteala.lakpsvlflDEidrlldardsesslevlnaLlrlledgnvlv--------
00444381   1/1  ......................................segailsggfkqrvgia..lladpgilflDEi
00513251   1/1  ....gqkqrvalleaalkegylvvvDet..gldraqrlellelardlgrpvlviflatspevlierlldr
00489631   1/1  gvvlldgfdrsqlqrlailrallddppdlvvfldapleellerllkRdgrteeeilerlarleeryradl
00432181   1/1  .vliDtpGleefa.sggekqrvalalallreadvlllvvdadeptsfldle....l--------------
00477011   1/1  dairleielpglpdltlvDtPGlgsva..vvdqlsggqkqrvalarallknpdtlillv-----------
00420941   1/1  elsgglrqllalara..akpsilllDEidklapkrsptsaldadvrrevlnaLlrlldglqalsnvtvia
00482551   1/1  dllellerlrrllsegkvdlvviDslallarael..ldepllgldarelrellrlLkrlakelgvtvi--
00469161   1/1  ayqlsggerqrlaidlegalllerllldepfpdlvifldaspeelleRllkRgre---------------
00386741   1/1  elsggeklrgllarala.kpgvlllDEida.ldpdvqeallelleegeltivgggllteld---------
00402371   1/1  afegglrqllglaraa..kpgvlflDEidsllgarggsgvdpevqnaLlrlleeg...nvrviaatnrpe
00517691   1/1  erergitidvalarllldgrkilllDtP..Ghed....fvkevlralrladgallvvdadegvslpqtre
00437921   1/1  qalglllgg.............kpdvlllDEi.drldpdaqnallklleel.pagvtliltt--------
00367291   1/1  ..........selleklvg..egegrlrgalaealradpgvlflDEidalagkrgsgtsr----------
00521551   1/1  ..pfvrlsaselvgkyvgelegglrqllalar..aanpgvlflDEidklapkrsptsglddvsrrrvlna
00508671   1/1  glpll.vvfldaplevlleRdrrglypeelsgglkqrvaiarplelaaepdlvi.---------------
00499331   1/1  vvildgfpggllqrealrrllprpdlvilldappeelleRllkrgrldgr--------------------
00478081   1/1  glllsdefrelleealalladgdvvilDgfgrlldarq..lleelllllleepppdlviflda.......
00437901   1/1  elsggeklrellaealteavlkgkpsvlllDEi.daldpdvlnallklldglrdlsgvliil--------
00482661   1/1  lfddlvgqeeakeallenlklflkgpellldlglpkgrgllLyGPpGtGKTtlakalanel...ggpvi.
00410321   1/1  ----------------------------------------------------------------------
00476071   1/1  lldglvygvlqdrllerllaagpdvlildgp---------------------------------------
00515351   1/1  aag.kvvildglsggllqrvallrallrpdlvifldapleelleRllkRd.dse----------------
00473941   1/1  sasdllg..esdlrggfkqa........akpgvlflDEidrl.drevqnaLlelleelqvt---------
00527261   1/1  llkkllkklsellglsilglelilglsggdleelleelaellkklgkpvililDEiqslldvsske.lle
00461621   1/1  pavlsggrkqrlalaralavdpe.lildgrllgrrllplpdlvifldaspe-------------------
00533151   1/1  vvildgfpggllqrealrrlllrpdlvifldapleelleRllkrgrlirleddseevlekrle-------
00409841   1/1  ..............vlldgrdllllDtPGlidfaseptnlldleii------------------------
00478131   1/1  ----------------------------------------------------------------------
00509891   1/1  ddlagaleel.laralaggpdviliEgagllplpliel--------------------------------
00487061   1/1  ..gki.vlsarraqlleirlirpllaegkvvilDrepdsadlafagagyllggldleevkaleelllvlp
00472911   1/1  fedaleagfrqrladlirallakgkvvild..gtglsreareellellkelg..pvlvifldadpevlle
00420081   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00430121   1/1  lvselighppg.yvGedelgvlfeaarkappsvlllDE....idkldpdvlnaLlqlleegevtdlggrv
00482721   1/1  llaelsggqgdvliiegalllepgllplpdlvifldappevlleR-------------------------
00416171   1/1  elfghekgafgggekqrlgllrla..dggvlflDEidkl.....dpdvqna-------------------
00410531   1/1  DtaGqerfrsllarylrgadgillvvdatdglsfeevaklleellglaglegvpiilvg-----------
00511381   1/1  ..................qdpdviliDE.aqfldp....evvevlleladtgilvlvtglemdfagelfe
00378621   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00519581   1/1  dleaverhlldiaeellengeilildeptvgldskd...ildelakilkevnfelifith----------
00489391   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           AILLHRRVLAHGSPDRVLVPELMLRAFGLEEPA-------------------------------------
00422801   1/1  ltvllvthdlsla.al------------------------------------------------------
00379581   1/1  vthdldealrladrilvl----------------------------------------------------
00390411   1/1  lleglkeeaeka----------------------------------------------------------
00378981   1/1  sealrladrilvlddGri----------------------------------------------------
00458601   1/1  HdldealrladrilvlddGriveegtpee-----------------------------------------
00509431   1/1  eleligplldglellvgl----------------------------------------------------
00510251   1/1  etraellellrelakegk----------------------------------------------------
00490801   1/1  etraellellrelakegk----------------------------------------------------
00482201   1/1  rilvlddGrivelgtpee----------------------------------------------------
00420701   1/1  lsealrladrilvlddGr----------------------------------------------------
00367901   1/1  raeellellglgglld------------------------------------------------------
00475891   1/1  ladrilvlddGrivelgt----------------------------------------------------
00502741   1/1  ilvlddGrivelgtpeel----------------------------------------------------
00425571   1/1  adrilvlddGrivelgtp----------------------------------------------------
00482261   1/1  drilvlddGrivelgtpe----------------------------------------------------
00404101   1/1  dldealrladrilvlddGrivelgtpeel-----------------------------------------
00500441   1/1  drilvlddGrivelgtpe----------------------------------------------------
00466971   1/1  alrladrilvlddGriv-----------------------------------------------------
00440861   1/1  .nlfpglvvlisaltgegldeltvren-------------------------------------------
00436071   1/1  drivv-----------------------------------------------------------------
00475991   1/1  llvtHdlsealrladril----------------------------------------------------
00530591   1/1  ltvllvtHdlseal.lad----------------------------------------------------
00372301   1/1  lelaalladrvvvlndgr----------------------------------------------------
00466931   1/1  pvstLSGGerqrva--------------------------------------------------------
00367481   1/1  Hdlelaalaadrivvlng----------------------------------------------------
00361211   1/1  vtvilvthdldlldsall----------------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00498251   1/1  ellrrllrlakelgvtvllvthd-----------------------------------------------
00495371   1/1  eeveeladrvavlaggr-----------------------------------------------------
00468691   1/1  sgldalre..ilellrel----------------------------------------------------
00488521   1/1  lgvtvllvthdldevarl----------------------------------------------------
00424961   1/1  llllDeptsalDgeivl-----------------------------------------------------
00469451   1/1  vilvtH...........Asdrvlvl---------------------------------------------
00485451   1/1  iilv------------------------------------------------------------------
00500611   1/1  llvthdlreveeladkrdr---------------------------------------------------
00503371   1/1  krlellekeleeleelle----------------------------------------------------
00422141   1/1  ieyvfqsp...nlfpl.............-----------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00448931   1/1  lDlla-----------------------------------------------------------------
00464791   1/1  Eptsgldal..r----------------------------------------------------------
00495031   1/1  vilvthdlrevegrlelad---------------------------------------------------
00379601   1/1  iivlddGriveegtpeella--------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00485931   1/1  ddgtakggaalslalela----------------------------------------------------
00478411   1/1  iilalellllde----------------------------------------------------------
00468601   1/1  slalr-----------------------------------------------------------------
00532531   1/1  ----------------------------------------------------------------------
00475371   1/1  aadrilvldlg-----------------------------------------------------------
00371631   1/1  qrlalaralvedpdvl------------------------------------------------------
00437981   1/1  allsrcqvi-------------------------------------------------------------
00457311   1/1  trdlgeagrsadrvl..-----------------------------------------------------
00368571   1/1  fdlrdll---------------------------------------------------------------
00489571   1/1  rvavldd.....Gtpeel----------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00462761   1/1  s.ieevadril-----------------------------------------------------------
00477971   1/1  ldrilv----------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00368501   1/1  k..eaeaee-------------------------------------------------------------
00426051   1/1  llerlarey-------------------------------------------------------------
00434401   1/1  krlg------------------------------------------------------------------
00464411   1/1  ddvv------------------------------------------------------------------
00503741   1/1  lrlleegkltdkllgltliltthdldllerla--------------------------------------
00496571   1/1  ad--------------------------------------------------------------------
00512891   1/1  iallrr----------------------------------------------------------------
00414121   1/1  ivlnKiDl--------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00490731   1/1  rilvlleglg------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00533501   1/1  kadrv-----------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00405881   1/1  lvSahdgegldelldaile---------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00437941   1/1  eeldpallsRfdviefpp----------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00493431   1/1  leealee---------------------------------------------------------------
00404191   1/1  ldqall----------------------------------------------------------------
00379261   1/1  vgltd-----------------------------------------------------------------
00406781   1/1  rllee-----------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00513761   1/1  lseeglelvlelleellellpi------------------------------------------------
00392701   1/1  ttnrp-----------------------------------------------------------------
00510561   1/1  reilrllkrlakelgvtvl---------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00480251   1/1  lsvali----------------------------------------------------------------
00468951   1/1  llsellrllkrlakelgvtvilvshvlk------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00480441   1/1  leealelllail----------------------------------------------------------
00439861   1/1  dalagggaleqladgvillkrdetakggr-----------------------------------------
00499191   1/1  dlvif-----------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00498531   1/1  gldarllreilrllkrlakelgitvllts-----------------------------------------
00498811   1/1  sleevvdrilal----------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00444381   1/1  dkllddrgeaegggdvs-----------------------------------------------------
00513251   1/1  vllldeg---------------------------------------------------------------
00489631   1/1  vivtddl...------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00420941   1/1  ttnrpeel--------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00402371   1/1  lvklge----------------------------------------------------------------
00517691   1/1  vlllllll...gvpniivv---------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00521551   1/1  Llrllegl--------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00478081   1/1  ...dpevlleRllkRgrrerkdd-----------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00482661   1/1  .......---------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00527261   1/1  aLlrllde--------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00487061   1/1  kpdlvi----------------------------------------------------------------
00472911   1/1  Rllkrgrallr-----------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00430121   1/1  vdl-------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00511381   1/1  gsllL-----------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------