[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ55755.1


[Show Plain Result]

## Summary of Sequence Search
   1::388
  57::335  1.7e-12 22.3% 0051144 00511441 1/1   ase                                     
  59::367  1.2e-06 22.9% 0041693 00416931 1/1   ase                                     
  57::318  9.3e-06 22.8% 0051011 00510111 1/1   ase                                     
  59::322  1.7e-05 23.2% 0050359 00503591 1/1   ase                                     
  75::335    2e-05 24.3% 0046338 00463381 1/1   ase                                     
  75::335  2.9e-05 22.8% 0048312 00483121 1/1   ase                                     
  56::318  0.00055 23.7% 0046720 00467201 1/1   ase                                     
   1::388


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTSLTLRLPTPTGELETYTVLGTPVTPTRTTPARSRVAYAAAHVVADPLGSNGPGQPAQLDWDATLAFRH
00511441   1/1  --------------------------------------------------------lmmlmlllkGviva
00416931   1/1  ----------------------------------------------------------kllsGviaalvT
00510111   1/1  --------------------------------------------------------mlllkGvivalvTp
00503591   1/1  ----------------------------------------------------------sidldalarlve
00463381   1/1  ----------------------------------------------------------------------
00483121   1/1  ----------------------------------------------------------------------
00467201   1/1  -------------------------------------------------------msklkGiiaalvTpf


                         -         -         *         -         -         -         -:140
query           YLWDQGLGVADAMDTAQRGMGLDWAATAELIRRSAAEATARNAPLVCGVGTDHLEPSQATLESVIKAYRE
00511441   1/1  lvTpfdedgsidlealarlveflidagvdglvvlGttGEaatlsleErlevleavveavag.rvpviagv
00416931   1/1  pfddgeidldalaklidfligagvdglvvlGttGealllsleErlelvea.vveavggrvpviagvgans
00510111   1/1  fdedgsidlealarlveflidagvdglvvlGttGEfatlsleErlevleavveavag.rvpviagvgsns
00503591   1/1  flieagvdglvvlGttGEaatlsleErlevveavve....grvpviagvgsnstaea...........ie
00463381   1/1  ----klkGvivalvTpfdedgsidldalarlveflid..agvdglvvlGttGEaatlsleErlevleavv
00483121   1/1  ----klkGvivalvTpfdedgsidlealarlveflid..agvdglvvlGttGEfatlsleErlevleavv
00467201   1/1  dedgsldlealrrlvefliddagvdglvvlGttGEsatlsleErkelieavveavag.rvpviagvgsns


                         +         -         -         -         -         *         -:210
query           QLAVVQDAGATPVIMASRALAATAQSPDDYAKVYGQLLADVDRPVILHWLGAVFDPALDGYWGYTDPAEA
00511441   1/1  gsnstrea...........ielarhaeeagadavlvlppyyfkp..sqeglvahfkavadavdlpiilYn
00416931   1/1  tr...........eaielaklaeelGadailvlppyydk..psqegllahfkavaeavdlPvilYniPgr
00510111   1/1  ...........treaielarhaeeagadavlvlppyyfkp..sqeglvahfkavadavplpiilYniPgr
00503591   1/1  lakhaeeagadavlvvpPyyf.kkpsqeglvahfkavadavplpiilYniPgrtgvdlspetlarl....
00463381   1/1  eavagrvpviagvgsnstreaielaraaeeagadavlvlpPyyfkpsqeglvahfkavadavdlpiilYn
00483121   1/1  eavagrvpviagvgsnstreaielarhaeeagadavlvlppyyfkpsqeglvahfkavadavpdlpiilY
00467201   1/1  trea...........ielakhaeeagadavlvvpPyyyk..psqeglyahfkaiadavdlpiilY.....


                         -         -         -         +         -         -         -:280
query           IDAVAALIADHADRVDGIKVSLLDDTLEVRLRTLLPDGVRLYTGDDFNYPDLILGDADGHSHALLGIFAA
00511441   1/1  iPgrtgvdlsp...........etlarlae..ipnivgiKdssgdlarlarlia..gddfavlsGddell
00416931   1/1  tgvdls...........petlarlaeeipn.ivgiKdasgdlgrlerllrlleltgddfavlsGldllll
00510111   1/1  tgvdls...........petlarlae..ipnivgiKdasgdlarlarllallgddfavlsGlddlllpal
00503591   1/1  ................pnivgiKdssgdlarlarllal.gddfavlsGldelllpalalGadGvisglan
00463381   1/1  iPgrtgvdlspetlarlae..ipnivgiKdssgdlarlarllallgddfavlsgldelllpalalGadGv
00483121   1/1  niPgrtgvdlspetlarlae..ipnivgiKessgdlarlarllallgd.favlsGlddlllpalalGadG
00467201   1/1  ......niPgrtgvdlspetlarlak..ipnivgiKdssgdlarvlrllallgd.flvlsGsdelllpal


                         -         *         -         -         -         -         +:350
query           IAPAAAEALRALDDGDTDRYRALLAPTVPLSRHLFAAPTYYYKTGITFVAWLNGHQKGFSMVGGLQSARD
00511441   1/1  lpalalGadGvisglanvaPellvalyeaal...agdlaearelqdrllplidll---------------
00416931   1/1  palalGadGvisglanvl...Pellvelyeallagdleearelqdlllplldllfryg...npaavKaal
00510111   1/1  alGadgvisglanvlPellvelyeaala...gdleear--------------------------------
00503591   1/1  vlPellvalyeaala...gdleearelqdrllplidalfaeg----------------------------
00463381   1/1  isglanvlPellvelyeaala...gdleearelqarllplidllfaeg...npaa---------------
00483121   1/1  visglanvlPellvelyeaala...gdleearelqarllplidalfaeg...npa---------------
00467201   1/1  alGadgvisvtanvlPklavelydafl...agdleear--------------------------------


                         -         -         -         -         *         -         -:420
query           LPHLATAFRLADAAGVLTDPETAVSRMRTLLTVYGVDQ--------------------------------
00511441   1/1  ----------------------------------------------------------------------
00416931   1/1  allgliagp..vRlPll-----------------------------------------------------
00510111   1/1  ----------------------------------------------------------------------
00503591   1/1  ----------------------------------------------------------------------
00463381   1/1  ----------------------------------------------------------------------
00483121   1/1  ----------------------------------------------------------------------
00467201   1/1  ----------------------------------------------------------------------