[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ55822.1


[Show Plain Result]

## Summary of Sequence Search
   1::239
   3::76   1.1e-16 39.2% 0047247 00472471 1/1   ed helix" DNA-binding domain            
   1::102  3.6e-16 36.5% 0050048 00500481 1/1   ed helix" DNA-binding domain            
   5::79   1.4e-10 33.3% 0037767 00377671 1/1   ed helix" DNA-binding domain            
   5::71   4.2e-06 28.4% 0038753 00387531 1/1   ed helix" DNA-binding domain            
  15::72   4.8e-06 25.9% 0039384 00393841 1/1   ed helix" DNA-binding domain            
  22::72   9.7e-06 27.5% 0045968 00459681 1/1   ed helix" DNA-binding domain            
   6::71   1.6e-05 31.7% 0045032 00450321 1/1   ed helix" DNA-binding domain            
   2::72   0.00034 25.7% 0051665 00516651 1/1   ed helix" DNA-binding domain            
  22::69   0.00048 29.2% 0045862 00458621 1/1   ed helix" DNA-binding domain            
   5::69   0.00077 27.7% 0052198 00521981 1/1   ed helix" DNA-binding domain            
   1::239


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGSESLADRLADRLLDQVVRGELAVDEALPSEAEIAAAADVSRLTVREAVKVLRTKNIVRVKRGRGTYVN
00472471   1/1  --slplyeqvaealreailsgelapgdrLPsereLaerlgvsrttvrealrrLeaeglverrpgrgtfVa
00500481   1/1  mldllsslplyeqiaealreaIlsgelapgdrLpsereLaeelgvsrttvreAlrlLeaeglverrpgrG
00377671   1/1  ----dveeRlarlLlllalrlglrlgdgllidlllteeeLAellgvsretvsraLkeLekeglielrrgr
00387531   1/1  ----saeeRlarlLlllaerlglllgsgiillpltqeelAellglsretvsrvLkkLekeglieleggri
00393841   1/1  --------------llmllderlllillllleggepvsveeLaeelgvsrstvrrdlalLeelglvirrr
00459681   1/1  ---------------------lllledgrlsveeLaeelgvSrstvrrhlkrLeeaGliiesvpgkgyrl
00450321   1/1  -----kkldyalrillylal......depvsseeiAerlgvspstlrkilslLkkaglvesvrGaGgyvl
00516651   1/1  -allsveeRlarlLllladrlgsl.ltlpltqeelAdllglsretvsrlLkkLeeeglieldrgrilild
00458621   1/1  ---------------------lllledgplsvseLaerlgvspptvsralkrLeedGlvererdggdrl-
00521981   1/1  ----sveeRlarlLlllaerlgllgdgllillpltqeelAdllgltretvsrlLskLekeglielergr-


                         -         -         *         -         -         -         -:140
query           APEHWTDLELILRMAQRRSGAGAAALGLLEVRRILEAGAAELCAQRRSDADLALLTTHVAEMDKAIAADD
00472471   1/1  elslde----------------------------------------------------------------
00500481   1/1  tfVaels......leelaadllalllllllll--------------------------------------
00377671   1/1  givvldlda-------------------------------------------------------------
00387531   1/1  t---------------------------------------------------------------------
00393841   1/1  gg--------------------------------------------------------------------
00459681   1/1  ll--------------------------------------------------------------------
00450321   1/1  a---------------------------------------------------------------------
00516651   1/1  le--------------------------------------------------------------------
00458621   1/1  ----------------------------------------------------------------------
00521981   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ASTFARAETAFHETIVRSCGNVFIPAICAPVDRLLLHLHARTATIAHIRVRAQSHHRRILSGIAAGSPAA
00472471   1/1  ----------------------------------------------------------------------
00500481   1/1  ----------------------------------------------------------------------
00377671   1/1  ----------------------------------------------------------------------
00387531   1/1  ----------------------------------------------------------------------
00393841   1/1  ----------------------------------------------------------------------
00459681   1/1  ----------------------------------------------------------------------
00450321   1/1  ----------------------------------------------------------------------
00516651   1/1  ----------------------------------------------------------------------
00458621   1/1  ----------------------------------------------------------------------
00521981   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           ARDAMRAHFDQLAEDLLRHVVDRCGVSEP-----------------------------------------
00472471   1/1  ----------------------------------------------------------------------
00500481   1/1  ----------------------------------------------------------------------
00377671   1/1  ----------------------------------------------------------------------
00387531   1/1  ----------------------------------------------------------------------
00393841   1/1  ----------------------------------------------------------------------
00459681   1/1  ----------------------------------------------------------------------
00450321   1/1  ----------------------------------------------------------------------
00516651   1/1  ----------------------------------------------------------------------
00458621   1/1  ----------------------------------------------------------------------
00521981   1/1  ----------------------------------------------------------------------