[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ55880.1


[Show Plain Result]

## Summary of Sequence Search
   1::252
  18::232  5.1e-64 41.6% 0039041 00390411 1/1   p containing nucleoside triphosphate hy 
  16::239  1.6e-60 43.3% 0042280 00422801 1/1   p containing nucleoside triphosphate hy 
   6::253  2.3e-60 39.8% 0044086 00440861 1/1   p containing nucleoside triphosphate hy 
  15::239  1.9e-59 43.0% 0037898 00378981 1/1   p containing nucleoside triphosphate hy 
  12::237  4.8e-59 44.0% 0037958 00379581 1/1   p containing nucleoside triphosphate hy 
  15::239  1.3e-57 44.3% 0042070 00420701 1/1   p containing nucleoside triphosphate hy 
  30::237  1.3e-56 42.9% 0046693 00466931 1/1   p containing nucleoside triphosphate hy 
  16::238  3.5e-56 39.0% 0050943 00509431 1/1   p containing nucleoside triphosphate hy 
   7::246  4.1e-56 43.6% 0036121 00361211 1/1   p containing nucleoside triphosphate hy 
  16::237    7e-55 40.0% 0051025 00510251 1/1   p containing nucleoside triphosphate hy 
  30::237  8.1e-55 43.5% 0046697 00466971 1/1   p containing nucleoside triphosphate hy 
  16::237  8.2e-55 41.0% 0049080 00490801 1/1   p containing nucleoside triphosphate hy 
  16::239  1.2e-54 38.7% 0036790 00367901 1/1   p containing nucleoside triphosphate hy 
  30::237  2.8e-54 43.6% 0047589 00475891 1/1   p containing nucleoside triphosphate hy 
  16::239  3.1e-54 43.9% 0042557 00425571 1/1   p containing nucleoside triphosphate hy 
  32::236  4.3e-54 43.5% 0049537 00495371 1/1   p containing nucleoside triphosphate hy 
  22::237  6.1e-54 46.3% 0048545 00485451 1/1   p containing nucleoside triphosphate hy 
  30::237  6.5e-54 43.8% 0048220 00482201 1/1   p containing nucleoside triphosphate hy 
  14::228  7.3e-54 39.5% 0043607 00436071 1/1   p containing nucleoside triphosphate hy 
  18::237  8.8e-54 44.9% 0040410 00404101 1/1   p containing nucleoside triphosphate hy 
  30::237    9e-54 44.7% 0050044 00500441 1/1   p containing nucleoside triphosphate hy 
  15::233  1.7e-53 47.5% 0046945 00469451 1/1   p containing nucleoside triphosphate hy 
  30::237    4e-53 40.6% 0045860 00458601 1/1   p containing nucleoside triphosphate hy 
  30::237  6.4e-53 43.8% 0048226 00482261 1/1   p containing nucleoside triphosphate hy 
   6::232  4.3e-52 45.5% 0050061 00500611 1/1   p containing nucleoside triphosphate hy 
  30::237  6.9e-52 44.3% 0053059 00530591 1/1   p containing nucleoside triphosphate hy 
  30::237  7.9e-52 44.1% 0047599 00475991 1/1   p containing nucleoside triphosphate hy 
  30::237    7e-51 44.1% 0050274 00502741 1/1   p containing nucleoside triphosphate hy 
   4::248  2.7e-49 42.0% 0037230 00372301 1/1   p containing nucleoside triphosphate hy 
   6::236  3.5e-49 39.1% 0048852 00488521 1/1   p containing nucleoside triphosphate hy 
  15::246  4.1e-49 41.4% 0049825 00498251 1/1   p containing nucleoside triphosphate hy 
  13::239  8.4e-49 37.6% 0042496 00424961 1/1   p containing nucleoside triphosphate hy 
  13::245  7.8e-48 43.2% 0046869 00468691 1/1   p containing nucleoside triphosphate hy 
  18::235  1.1e-46 46.7% 0049611 00496111 1/1   p containing nucleoside triphosphate hy 
  15::222  7.7e-46 35.8% 0043651 00436511 1/1   p containing nucleoside triphosphate hy 
  35::250  2.1e-45 44.8% 0044893 00448931 1/1   p containing nucleoside triphosphate hy 
  10::232    4e-45 43.3% 0049503 00495031 1/1   p containing nucleoside triphosphate hy 
  43::251  4.8e-45 42.8% 0045731 00457311 1/1   p containing nucleoside triphosphate hy 
  40::249  9.6e-45 41.9% 0048593 00485931 1/1   p containing nucleoside triphosphate hy 
  37::250  2.6e-44 38.8% 0046860 00468601 1/1   p containing nucleoside triphosphate hy 
   4::234  7.5e-44 39.3% 0036748 00367481 1/1   p containing nucleoside triphosphate hy 
  33::243    1e-42 37.7% 0050337 00503371 1/1   p containing nucleoside triphosphate hy 
  45::198  7.6e-41 47.9% 0038144 00381441 1/1   p containing nucleoside triphosphate hy 
  16::234  2.5e-40 40.9% 0037960 00379601 1/1   p containing nucleoside triphosphate hy 
  29::237  5.1e-40 41.3% 0046276 00462761 1/1   p containing nucleoside triphosphate hy 
  16::229  6.4e-39 40.7% 0042214 00422141 1/1   p containing nucleoside triphosphate hy 
  32::232  6.7e-39 38.8% 0053253 00532531 1/1   arboxykinase-like                       
  31::219  1.5e-37 41.0% 0047841 00478411 1/1   arboxykinase-like                       
  44::214  2.4e-36 45.3% 0047538 00475381 1/1   p containing nucleoside triphosphate hy 
  32::202  2.6e-36 43.2% 0047552 00475521 1/1   arboxykinase-like                       
  39::185  4.5e-36 46.2% 0048047 00480471 1/1   p containing nucleoside triphosphate hy 
  12::246  3.2e-35 35.0% 0043798 00437981 1/1   p containing nucleoside triphosphate hy 
  15::238  3.6e-35 39.7% 0037163 00371631 1/1   p containing nucleoside triphosphate hy 
  13::245  1.5e-34 33.0% 0046479 00464791 1/1   p containing nucleoside triphosphate hy 
  34::233  2.4e-34 40.4% 0047537 00475371 1/1   p containing nucleoside triphosphate hy 
  44::206  3.1e-34 41.0% 0051553 00515531 1/1   p containing nucleoside triphosphate hy 
  43::231    4e-34 39.3% 0042605 00426051 1/1   p containing nucleoside triphosphate hy 
  32::233    2e-33 33.1% 0051056 00510561 1/1   p containing nucleoside triphosphate hy 
  43::252  2.6e-33 36.8% 0041412 00414121 1/1   p containing nucleoside triphosphate hy 
  43::225  1.5e-32 38.6% 0047797 00477971 1/1   p containing nucleoside triphosphate hy 
  44::250    3e-31 35.9% 0053350 00533501 1/1   p containing nucleoside triphosphate hy 
  31::216  3.1e-31 39.4% 0047844 00478441 1/1   arboxykinase-like                       
  22::233  1.7e-30 35.5% 0046895 00468951 1/1   p containing nucleoside triphosphate hy 
  44::202  2.8e-30 40.3% 0051551 00515511 1/1   p containing nucleoside triphosphate hy 
  22::233    3e-30 34.1% 0049853 00498531 1/1   p containing nucleoside triphosphate hy 
  29::248    8e-30 33.2% 0036850 00368501 1/1   p containing nucleoside triphosphate hy 
  47::233  9.4e-30 37.0% 0048702 00487021 1/1   p containing nucleoside triphosphate hy 
  33::249  9.7e-30 34.8% 0037996 00379961 1/1   p containing nucleoside triphosphate hy 
  44::232  8.3e-28 36.9% 0049343 00493431 1/1   p containing nucleoside triphosphate hy 
  46::253  1.4e-27 32.6% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
  44::209  2.5e-27 38.1% 0048410 00484101 1/1   p containing nucleoside triphosphate hy 
  17::250  2.6e-27 33.8% 0048957 00489571 1/1   p containing nucleoside triphosphate hy 
   9::143  4.4e-27 36.2% 0038720 00387201 1/1   p containing nucleoside triphosphate hy 
  43::242  9.9e-27 36.8% 0046441 00464411 1/1   p containing nucleoside triphosphate hy 
   4::232  1.1e-26 32.1% 0036857 00368571 1/1   p containing nucleoside triphosphate hy 
  19::212  7.9e-26 39.7% 0047701 00477011 1/1   p containing nucleoside triphosphate hy 
  44::250  8.2e-25 34.6% 0049657 00496571 1/1   p containing nucleoside triphosphate hy 
  32::226  1.2e-24 36.9% 0043440 00434401 1/1   p containing nucleoside triphosphate hy 
  18::211  2.6e-24 31.4% 0035641 00356411 1/1   p containing nucleoside triphosphate hy 
   9::238  6.5e-23 36.1% 0043794 00437941 1/1   p containing nucleoside triphosphate hy 
  37::232  1.4e-22 35.1% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
  17::248  2.3e-22 32.1% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
  38::208  7.6e-22 36.4% 0050867 00508671 1/1   p containing nucleoside triphosphate hy 
  40::211  9.1e-22 37.7% 0045157 00451571 1/1   p containing nucleoside triphosphate hy 
  44::232  2.4e-21 28.7% 0047073 00470731 1/1   p containing nucleoside triphosphate hy 
  42::237  2.6e-21 31.2% 0043986 00439861 1/1   p containing nucleoside triphosphate hy 
  45::214  4.2e-21 36.2% 0053247 00532471 1/1   p containing nucleoside triphosphate hy 
  33::227  9.1e-21 29.5% 0037926 00379261 1/1   p containing nucleoside triphosphate hy 
  45::229    1e-20 29.5% 0049881 00498811 1/1   p containing nucleoside triphosphate hy 
  10::228  2.5e-20 30.3% 0040419 00404191 1/1   p containing nucleoside triphosphate hy 
   4::231  5.4e-20 28.6% 0039270 00392701 1/1   p containing nucleoside triphosphate hy 
  44::249    1e-18 36.1% 0049919 00499191 1/1   p containing nucleoside triphosphate hy 
   1::229  1.3e-18 24.7% 0040678 00406781 1/1   p containing nucleoside triphosphate hy 
  44::232  2.3e-18 32.7% 0048963 00489631 1/1   p containing nucleoside triphosphate hy 
  36::251  4.2e-18 24.1% 0048025 00480251 1/1   p containing nucleoside triphosphate hy 
  33::232  2.4e-17 31.9% 0044438 00444381 1/1   p containing nucleoside triphosphate hy 
  22::227  1.9e-16 31.2% 0048255 00482551 1/1   p containing nucleoside triphosphate hy 
  45::213  4.1e-16 36.3% 0040588 00405881 1/1   p containing nucleoside triphosphate hy 
  46::233  2.4e-15 22.8% 0048044 00480441 1/1   p containing nucleoside triphosphate hy 
  32::236  3.7e-15 32.5% 0051325 00513251 1/1   p containing nucleoside triphosphate hy 
  46::212  1.1e-14 23.1% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
  39::247  2.7e-14 24.2% 0049933 00499331 1/1   p containing nucleoside triphosphate hy 
  45::187  4.1e-14 40.0% 0051535 00515351 1/1   p containing nucleoside triphosphate hy 
  39::210  6.1e-14 38.9% 0043218 00432181 1/1   p containing nucleoside triphosphate hy 
  36::246  7.8e-14 28.5% 0042094 00420941 1/1   p containing nucleoside triphosphate hy 
  12::214  3.1e-13 27.3% 0038674 00386741 1/1   p containing nucleoside triphosphate hy 
  38::214  1.8e-12 31.9% 0043790 00437901 1/1   p containing nucleoside triphosphate hy 
  43::222    5e-12 31.1% 0046162 00461621 1/1   p containing nucleoside triphosphate hy 
  36::214  1.7e-11 28.6% 0036729 00367291 1/1   p containing nucleoside triphosphate hy 
  33::215  2.8e-11 28.6% 0043792 00437921 1/1   p containing nucleoside triphosphate hy 
  38::214  3.7e-11 31.8% 0052155 00521551 1/1   p containing nucleoside triphosphate hy 
  33::223  6.6e-11 29.5% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
   6::214  9.5e-11 25.3% 0040237 00402371 1/1   p containing nucleoside triphosphate hy 
  33::223  4.2e-10 23.6% 0052726 00527261 1/1   p containing nucleoside triphosphate hy 
  39::230  6.8e-10 26.4% 0053315 00533151 1/1   p containing nucleoside triphosphate hy 
  38::213  1.5e-09 26.7% 0051769 00517691 1/1   p containing nucleoside triphosphate hy 
  39::227    2e-09 28.7% 0051138 00511381 1/1   p containing nucleoside triphosphate hy 
  46::181  2.1e-09 28.2% 0046916 00469161 1/1   p containing nucleoside triphosphate hy 
  33::214  6.3e-09 26.4% 0047394 00473941 1/1   p containing nucleoside triphosphate hy 
  44::214  1.4e-08 26.8% 0051958 00519581 1/1   p containing nucleoside triphosphate hy 
  44::203  2.1e-08 29.1% 0047607 00476071 1/1   p containing nucleoside triphosphate hy 
  44::244  5.5e-08 21.8% 0045785 00457851 1/1   p containing nucleoside triphosphate hy 
  33::212  6.4e-08 23.8% 0041053 00410531 1/1   p containing nucleoside triphosphate hy 
  45::214  1.1e-07 31.1% 0047808 00478081 1/1   p containing nucleoside triphosphate hy 
  41::214  1.2e-07 26.8% 0047291 00472911 1/1   p containing nucleoside triphosphate hy 
  23::181  2.2e-07 24.3% 0041617 00416171 1/1   p containing nucleoside triphosphate hy 
  45::201  2.6e-07 21.0% 0047772 00477721 1/1   p containing nucleoside triphosphate hy 
  45::213  4.1e-07 28.2% 0049606 00496061 1/1   p containing nucleoside triphosphate hy 
  47::247  7.1e-07 24.0% 0043012 00430121 1/1   p containing nucleoside triphosphate hy 
  44::185    2e-06 25.6% 0048272 00482721 1/1   p containing nucleoside triphosphate hy 
  29::97   2.6e-06 22.4% 0041032 00410321 1/1   p containing nucleoside triphosphate hy 
  38::199  5.3e-06 28.9% 0040984 00409841 1/1   p containing nucleoside triphosphate hy 
  37::214  7.1e-06 29.6% 0048266 00482661 1/1   p containing nucleoside triphosphate hy 
  33::78   7.5e-06 37.2% 0049577 00495771 1/1   p containing nucleoside triphosphate hy 
  44::78   7.5e-06 37.1% 0047813 00478131 1/1   p containing nucleoside triphosphate hy 
  41::214  7.6e-06 24.8% 0047839 00478391 1/1   p containing nucleoside triphosphate hy 
  41::213  1.1e-05 30.2% 0040121 00401211 1/1   p containing nucleoside triphosphate hy 
  44::249  1.2e-05 27.2% 0048706 00487061 1/1   p containing nucleoside triphosphate hy 
  32::81   2.6e-05 30.6% 0047127 00471271 1/1   p containing nucleoside triphosphate hy 
  41::78   3.7e-05 44.7% 0042008 00420081 1/1   p containing nucleoside triphosphate hy 
  45::234    6e-05 23.1% 0051604 00516041 1/1   p containing nucleoside triphosphate hy 
  45::224    9e-05 27.3% 0050989 00509891 1/1   p containing nucleoside triphosphate hy 
  44::202  0.00028 23.9% 0037884 00378841 1/1   p containing nucleoside triphosphate hy 
  45::77   0.00037 39.4% 0049317 00493171 1/1   p containing nucleoside triphosphate hy 
  45::246  0.00047 19.5% 0045788 00457881 1/1   p containing nucleoside triphosphate hy 
  30::77   0.00066 27.1% 0037862 00378621 1/1   p containing nucleoside triphosphate hy 
  44::68   0.00066 40.0% 0051206 00512061 1/1   p containing nucleoside triphosphate hy 
  40::66   0.00068 40.7% 0048939 00489391 1/1   p containing nucleoside triphosphate hy 
  44::67   0.00079 37.5% 0049398 00493981 1/1   p containing nucleoside triphosphate hy 
  44::66     0.001 39.1% 0047756 00477561 1/1   p containing nucleoside triphosphate hy 
   1::252


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPTPPAPSGTAEPHAVVVQGLTKVYPTGGEPVRALDGVDVSFARGAFTAIMGPSGSGKSTLMHCMAGLDT
00390411   1/1  -----------------Mknlslrygn....fralkdvslelppG.ltalvGpNGsGKStLlkalagllg
00422801   1/1  ---------------llllllallllllllllldpllelenlsksy..ggrlvlalkdvsltvkpgeiva
00440861   1/1  -----Mpllslgepllelenlsksy....ggvvalkdislsipkGeildlldellellkeldgsllnval
00378981   1/1  --------------lpllelenlsksy....ggvlalkdvsltvepgeivalvGpnGaGKSTllkllagl
00379581   1/1  -----------lepllevenlsksy....ggvlalkdvsltvkpgeivalvGpnGsGKSTllkllagllk
00420701   1/1  --------------lpllelenlsksyp..gggvlalkdvsltvepgeivalvGpnGsGKSTllkllagl
00466931   1/1  -----------------------------Mkllslslgnfralkdvslelp.geltalvGpNGsGKStLl
00509431   1/1  ---------------Mlelknlslsnfr......vlkdelvslefepg.ltaivGpNGsGKStlldalag
00361211   1/1  ------plellgepllelenlsksyg....gitalddvslgirkGeivllvGpsGsGKStllrnllagll
00510251   1/1  ---------------lllllllllaeellelleeeelllllllllllllgdpllelenlsksy....ggv
00466971   1/1  -----------------------------llalllevknlsksyggvlalkdvsltikpgeivalvGpnG
00490801   1/1  ---------------llllllllalllelleeeeellllllalllllgdpllelenlsksy..gg..vpa
00367901   1/1  ---------------lelknlslsyg.....ksilkdvsleip.geltalvGpnGsGKStllkalagllg
00475891   1/1  -----------------------------lllelllevknlsksyggvlalkdvsltikpgeivalvGpn
00425571   1/1  ---------------lelenlsksy....ggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllk
00495371   1/1  -------------------------------esalellleledltklstgikaLddv.lggglpkGeivl
00485451   1/1  ---------------------skiy...gd..ealkdvsleikkllnlsgkpgeiigivGpsGsGKsTll
00482201   1/1  -----------------------------llllelknlsksyggvlalkdvsltikpgeivalvGpnGsG
00436071   1/1  -------------pllelenlsksygg.....lalkdvsltvepgeivalvGpnGaGKsTllkllagllk
00404101   1/1  -----------------elenlsksy....ggvlalkdvsltvepgeivalvGpnGaGKSTllkllagll
00500441   1/1  -----------------------------lllelllelknlsksyggvlalddvsltikpgeivalvGpn
00469451   1/1  --------------allelenlskiy..ggvp.kalddvslgiepGeivalvGpsGsGKstllrllagll
00458601   1/1  -----------------------------lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGK
00482261   1/1  -----------------------------lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGK
00500611   1/1  -----pgllsllelllelenltklp.tg...ipaLddv.lgggipkGeivllvGpsGsGKTtlllqlagl
00530591   1/1  -----------------------------llllllaleelpllgelllevknlsksyggvlalkdvslti
00475991   1/1  -----------------------------lllaaelpelgelllevvnlsksyggvlalkdvsltikpge
00502741   1/1  -----------------------------lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGK
00372301   1/1  ---yvlPllsdgmpllelenlrkpy....ggllvlndvsl...pgeivaltGpnGaGKSTllrllaglll
00488521   1/1  -----lllllalelllevenlristgike....ldkllsgglppgeitlivGpsGsGKTtLllqlavngl
00498251   1/1  --------------vekllglalllieklflkvlprllsllelenlskiy.tg...ipal.dvslglgGl
00424961   1/1  ------------lgepldglgplrpapgllelenvsksygtg....ialidlslpigkGervalvGpsGa
00468691   1/1  ------------lsvpvglallgrvldvlgepidglgplllllllpivrlappllelenlsksygtg...
00496111   1/1  -----------------elenltkly.tg...ikaLddllslgippGeivllvGpsGsGKTtlalrllag
00436511   1/1  --------------ievpvglallgrvldllgepidgkgplelgepllevenlsksyggrklvlepletg
00448931   1/1  ----------------------------------LddvslsvepgevialvGpnGsGKTTllnalaglla
00495031   1/1  ---------lsalellleledltkis.tg...ipaLddvlsggipkGelvllvGpsGsGKTtlllqlagl
00457311   1/1  ------------------------------------------mkkgeiigivGpsGsGKSTlarllagll
00485931   1/1  ---------------------------------------LsvpkgevvalvGpnGaGKTTllallaglla
00468601   1/1  ------------------------------------dlslevkkgevialvGpnGvGKTTllakLaglla
00367481   1/1  ---yvrPelldep.llelengrhPllsksyg....gkvvlndislsip.gellvitGPngsGKSTllral
00503371   1/1  --------------------------------Mmlkslelknfkslkdvsligdfspg.ltaivGpNGsG
00381441   1/1  --------------------------------------------GeliaivGpsGsGKsTLlklLagllp
00379601   1/1  ---------------llllpllllpdeplaaldvalqralvslerllellvdpgasdihinpggpvrvri
00462761   1/1  ----------------------------yygdvtaldgvsltikkgevialvGpsGsGKsTlaraLagll
00422141   1/1  ---------------dlsleelekllelllrdllglgplvklldplleeavvngasdihiepgggllrvr
00532531   1/1  -------------------------------vlalkdvslviekGevvallGlSGsGKTTLlrllaglli
00478411   1/1  ------------------------------Ggvlalhgvsldve.gevvlltGpsGsGKStllralagl.
00475381   1/1  -------------------------------------------mkgeiialtGpsGsGKsTlarlLagll
00475521   1/1  -------------------------------evlalhgvsldve.gevvllvGpsGsGKStllralag..
00480471   1/1  --------------------------------------sleikkgekvaivGpsGsGKSTLlnaLaglls
00437981   1/1  -----------lveklrpknldkvi....gqeealkdlslalkpgeiphalllvGppGsGKttlaralag
00371631   1/1  --------------mseliiylelselewallradvgltlteaelkrlkglndlleledlskiygplsrl
00464791   1/1  ------------lsvpvgdkllGrvldvlgepidglgpllalerlpierlappllelenlskrfgtgi..
00475371   1/1  ---------------------------------alddvslsikkgevialvGkgGvGKTTlaanlaglla
00515531   1/1  -------------------------------------------kgekvallGlsgsGKSTllnrllglef
00426051   1/1  ------------------------------------------kpgevialvGpsGsGKSTlakllakelg
00510561   1/1  -------------------------------ldglgepldgllpilaklfrpievlalgllerksverls
00414121   1/1  ------------------------------------------kpgevvllvGpsGaGKTTLlrallglle
00477971   1/1  ------------------------------------------hkgelvvlvGPsGaGKsTLlnaLlgll.
00533501   1/1  -------------------------------------------rgeiialtGpsGsGKsTlaklLaellp
00478441   1/1  ------------------------------aevlalhgvsldin.gegvlivGpsGsGKStlalaLagl.
00468951   1/1  ---------------------lnvlgesidalgkilseilkllekgfltalgllerksverlstg...ik
00515511   1/1  -------------------------------------------kgekvlllGlsgsGKSTllnrllglef
00498531   1/1  ---------------------ldklgkildlalkileksflklevlalgvlerkeverlstG...ikaLD
00368501   1/1  ----------------------------kerllllelrnvllddviGqeeakealsealelplkrpelfd
00487021   1/1  ----------------------------------------------rmkiivltGpsGsGKsTlarlLae
00379961   1/1  --------------------------------ealralslalaagppegvllvGppGtGKstlaralagl
00493431   1/1  -------------------------------------------kGelivllGpsGaGKsTllkllagllg
00512891   1/1  ---------------------------------------------evilltGppGvGKTTlakalagelg
00484101   1/1  -------------------------------------------kgpvigivGpsGsGKTTllraLagllk
00489571   1/1  ----------------rvknlsksyggk....talddvslsvepG.ivgLlGpNGaGKSTllrllaGllk
00387201   1/1  --------mssgepllevenlskry....ggklalkdvslsvekgeivlLlGpnGaGKTtLlralagllg
00464411   1/1  ------------------------------------------vkkgeiivllGpsGsGKsTlaklLagll
00368571   1/1  ---llgvrllpplppklagllplagladgdglgvllGklldgvpvtldlgelgrhllivGptGsGKStll
00477011   1/1  ------------------eelrklldlidklrdlllsld....lglpkvaivGrsgsGKSTLlnallGld
00496571   1/1  -------------------------------------------GkgelivllGpsGsGKsTlarlLagll
00434401   1/1  -------------------------------llalddvslsvkkgliigitGpsGsGKTTlaraLaellr
00356411   1/1  -----------------lknlsksyg....ilkalkdislelkkgikilllGlsgsGKSTllnrllgley
00437941   1/1  --------lrplveklrpknlddvy..gqe..evlkalslalekgrpehlllvGppGtGKTtlakalagl
00490731   1/1  ------------------------------------dvslsvkkgkvialvGkgGvGKTTlaaklaglla
00503741   1/1  ----------------fifldlrplallplpdrlvgrdeeiealskalgg......aldgvslsiepggi
00508671   1/1  -------------------------------------hvsllklgeldislsikkgevivlvGpsGsGKs
00451571   1/1  ---------------------------------------MsikkgeiiaivGppGsGKsTlaklLakll.
00470731   1/1  -------------------------------------------arpltfddvvgqdeakeeleellagll
00439861   1/1  -----------------------------------------kleeveristgipeldellgGglpkgsli
00532471   1/1  --------------------------------------------pGkiIvitGpsGsGKsTlarlLaell
00379261   1/1  --------------------------------drllleelrpvllddviGqeeakealsealrlplkrle
00498811   1/1  --------------------------------------------kPgkiigltGpsGsGKsTlarlLael
00404191   1/1  ---------vellpkvtlddlvgleelkealkealellslgikpgeivllyGppGtGKTtlakalanelk
00392701   1/1  ---eklrpvllddvvgqeeakeallealagarlaledlslgirpgknvlLvGppGvGKTtlaralagllg
00499191   1/1  -------------------------------------------kgkiigitGpsGsGKsTlaklLaellg
00406781   1/1  plveklrpvllddvigqeeakeallealaglrlllkdlslgippgknvllvGppGtGKTtlakalagelg
00489631   1/1  -------------------------------------------MkgklillvGppGsGKtTlaraLaell
00480251   1/1  -----------------------------------EdlslavgkgkvialvGkgGvGKTTtaakLaaala
00444381   1/1  --------------------------------asdelekllelrpvlledvigqeeakkalslalelplk
00482551   1/1  ---------------------everlstg...ipalDel.lgGglppgslvliaGppGsGKTtlalqlaa
00405881   1/1  --------------------------------------------gervglvGrpgaGKSTLlnaltglka
00480441   1/1  ---------------------------------------------rlivllGpsGaGKsTlaklLaell.
00513251   1/1  -------------------------------iellsdlslsipspevvllvGppGsGKstlakklaell.
00513761   1/1  ---------------------------------------------kiiaivGkgGsGKTTllnklaglla
00499331   1/1  --------------------------------------PslslkkgklivltGppGsGKtTlakaLaerl
00515351   1/1  --------------------------------------------mngklivltGppGsGKtTlaraLaer
00432181   1/1  --------------------------------------slelkkglkvalvGrpgvGKStLlnallglkv
00420941   1/1  -----------------------------------lglslgirpgkgvllyGppGtGKTtlakalagelg
00386741   1/1  -----------klrpvllddvvgqeeakeallealkavllgirpgehllLvGppGtGKTtlaralagelg
00437901   1/1  -------------------------------------lslgirpgrillLyGppGvGKTtlakalakel.
00461621   1/1  ------------------------------------------mkgmiialtGppGsGKsTlaklLaerlg
00367291   1/1  -----------------------------------lflslglrpgrnvllyGppGtGKTtlaralanel.
00437921   1/1  --------------------------------lglllveklrpkllddvvgqeealerlllalkagklph
00521551   1/1  -------------------------------------lslglrpgkgvlLvGppGtGKTtlaralagllg
00394721   1/1  --------------------------------ealeallealrrgpprnvlLvGppGvGKTtlakalake
00402371   1/1  -----vlektgipltkllrpvllddviGqeealeallealrrrpgrnvllvGppGvGKTtlaralagllv
00527261   1/1  --------------------------------npfilgpkvdledfigreeelkeleeal.pk.ivlltG
00533151   1/1  --------------------------------------MsldikkgklivltGppGsGKtTlarlLaerl
00517691   1/1  -------------------------------------lsfelkpglnvgivGhvgaGKSTLlnallgllg
00511381   1/1  --------------------------------------llllkpgglvlitGPtgsGKsttLlralnrle
00469161   1/1  ---------------------------------------------llIvieGppGsGKsTlaklLaerlg
00473941   1/1  --------------------------------evkkalllalalallrgepgehvlLvGppGtGKTtlar
00519581   1/1  -------------------------------------------kpkvilltGppGvGKttlarlLakll.
00476071   1/1  -------------------------------------------kgkiigltGpsGsGKsTlaklLaelgl
00457851   1/1  -------------------------------------------PkgklivltGppGsGKtTlakaLaerl
00410531   1/1  --------------------------------gelknlslelkkglkillvGlngvGKTtllkrlag...
00478081   1/1  --------------------------------------------gkvivltGppGsGKtTlarlLaellk
00472911   1/1  ----------------------------------------mkmkkgklilltGppGsGKtTlaraLaell
00416171   1/1  ----------------------diigqeeakkallealslaartgenvllvGppGtGKttlaralakllp
00477721   1/1  --------------------------------------------kpklilltGppGsGKttlaraLaeel
00496061   1/1  --------------------------------------------gklivltGppGsGKtTlaklLaerlg
00430121   1/1  ----------------------------------------------iPvsklleddrplleklrpvlfdd
00482721   1/1  -------------------------------------------kgkiigltGpsGsGKsTlarlLael..
00410321   1/1  ----------------------------yggllllkdlslelkkglkilllGlngaGKTTllnrllggef
00409841   1/1  -------------------------------------lslelkkglkvalvGrpgvGKSTLlnaLlgadl
00482661   1/1  ------------------------------------kkvaivllsnyalsislddlllildlykevqvay
00495771   1/1  --------------------------------galldilldilkgktvalvGpsGvGKStLlNaLlgell
00478131   1/1  -------------------------------------------kgkvivltGppGsGKtTlarlLaellk
00478391   1/1  ----------------------------------------msikkgklilltGppGsGKtTlaralaerl
00401211   1/1  ----------------------------------------elkrglnvgivGhvgaGKSTLlnaLlgll.
00487061   1/1  -------------------------------------------ldMkkgklIvieGppGsGKtTlakaLa
00471271   1/1  -------------------------------prailelesliksllekllellkrlslklkkglkvalvG
00420081   1/1  ----------------------------------------smkkglrIaleGpsGvGKTTlaklLarhlg
00516041   1/1  --------------------------------------------mlkgklillvGppGsGKtTlaralae
00509891   1/1  --------------------------------------------pkvigitGpsGsGKTTlanaLarllk
00378841   1/1  -------------------------------------------kelkillvGdsgvGKstLlnrllgdef
00493171   1/1  --------------------------------------------mgklivllGpsGaGKsTlaklLaekl
00457881   1/1  --------------------------------------------mgklivltGppGsGKtTlaklLaerl
00378621   1/1  -----------------------------glklllrrlslllkkglkvllvGlpgvGKstllnrlageef
00512061   1/1  -------------------------------------------kkkkgklivltGppGsGKtTlakaL--
00489391   1/1  ---------------------------------------lsikkgklivltGppGsGKtTlakaLa----
00493981   1/1  -------------------------------------------kpklilltGppGsGKttlaraLae---
00477561   1/1  -------------------------------------------kkpkvillvGppGsGKtTlaraL----


                         -         -         *         -         -         -         -:140
query           PTSGSVRLGATELTALSDKQLTLLRRDRIGFVFQSFNLLPMLTARQNILLPSQISKRKVDPERFRHIVEV
00390411   1/1  pdsglrvgklsdlirrgadkasvelvfeldggllallrllslsggeklrvalakallgnpeillngepvn
00422801   1/1  lvGpnGsGKSTllkllagllkptsGeilldgldilalslae....lrrrigyvfqdpalfp.ltvrenla
00440861   1/1  vGpsGsGKStLlnaLlgllkpdegvilvggkgvTrdivlytledgvkltliDtpGlgdtklsdeeklilk
00378981   1/1  lkptsGeilldgldllllslaelllllrrgigyvfqdpalfpgltvrenlalglllaglskaeaaaraae
00379581   1/1  ptsGeilldglditalslael...rrrgigyvfqdpalfpgltvrenlalglllllllllllllllllal
00420701   1/1  lkptsGeilldgldllllslaellalr.rgigyvfqdpalfpgltvrenlalglllaglskaeararale
00466931   1/1  kalagllgpdsGeilldgkdilalspeellrllrrrigyvfqepalfpgltveenlllglllrlllelll
00509431   1/1  llggrslrllragglsdliflgslirsgadrasvelvfdlsdglyllerselilrrlilkpgsgeiling
00361211   1/1  aptggsvlldglei...salslaerlragigyvfqdlalfpeltvlenlalg...........rarelle
00510251   1/1  palkdvsltikpGeivalvGpnGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdv
00466971   1/1  sGKSTllkllagllkptsGeilldgkdilglslaelllllrrgigyvfqdpalfpgltvlenlllgllll
00490801   1/1  lkdvsltikpGeivalvGpnGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvll
00367901   1/1  pdvsallrlsglidlilkgllllprstvatvelifdllgllliirrlilrdgsgeilidgkdi...slld
00475891   1/1  GsGKSTllkllagllkptsGeilldgkdilgls...llellrrgigyvfqdpalfpgltvlenlllglll
00425571   1/1  ptsGeilldgldllalsl......lrrrigyvfqdpalfpgltvrenlalgllllglskaeaaaralell
00495371   1/1  llGpsGsGKttlalrllagllkp...evlvdgldltglspa......rggiglvfqteallppltvrenl
00485451   1/1  rlLagllkpllltggkvlvigldifrlsa....relrkrig.vfqdpallphltvpenldlglll....e
00482201   1/1  KSTllkllagllkptsGeilldgkdilglslkel.....rgigyvvqqdallpsltvlenlllgllllgl
00436071   1/1  ptsgeilldgldlla.........lrrgigyvfqdpalfpgltvlenlalgllllgllealaralellel
00404101   1/1  .ptsGeilldgldltalslael....rrgigyvfqdpalfpgltvrenlalgll...kaeararalelle
00500441   1/1  GaGKSTllkllagllkptsGeilldgkdildlsl......lrrgigyvfqdpalfpgltvlenlllglll
00469451   1/1  aglptsGeillldgkdvlylsleesleqlrrrigyvfqdpalfp.......................aee
00458601   1/1  STllkllagllkptsGeilldgkditglspqelrrlggvvvqevllffltllenlllglallllllvlll
00482261   1/1  STllkllagllkptsGeilldgkdildlslael.....rgigyvfqqdallpsltvlenlllgllllgel
00500611   1/1  lapdsgeillggkvlyislee...slrrrrigmvfqelgldpdltv...............arerviell
00530591   1/1  kpgeivalvGpnGsGKSTllkllagllkptsGeilldgkditdlslkel.....rgigyvvqqdallpsl
00475991   1/1  ivalvGpnGsGKSTllkllagllkptsGeilldgkdildlslael.....rgigyvfqqdallpsltvle
00502741   1/1  STllkllagllkptsGeilldgkdilglslael.....rgigyvfqqlallpsltvlenlalgllllgls
00372301   1/1  pasggilvdgedlr..............igyvfq................................ller
00488521   1/1  lppdsGei...................ggkvlyvdqeeslfp.ltvlenlalg.........gedveell
00498251   1/1  ppGeivlllGpsGsGKTtLalrllagllkpgggvvyidgeesldll.......rarrlgvvlqelllfpe
00424961   1/1  GKttLlrliaglldpdsgeilldgvdigersrevtelleelrrviglvfqdpplfprltvaenialgaey
00468691   1/1  .ialidvsltigrGervglvGpnGaGKttLlkllagllkpdsgeilvdGedlrelre......lrrrigy
00496111   1/1  llkptggkvliigle...lsaeelrerr.rrigyvfqepalfpeltvlenlalgll..............
00436511   1/1  ialddvsltikkGervglvGpsGaGKtTLlkllagllkpdsGeilvdgligerlrevlelirelelaelr
00448931   1/1  pdggkvllvgadiarla.......areqlgivfqd....pgltvlenlalg.......eleararellel
00495031   1/1  lalglgliplggkvlyiglelt.lsperlrlraqsl.............................gldld
00457311   1/1  ekpgsgvividgddlyklsreelrklr.rrigmvfqdpalflnpgltvrenlaeplrllklgkk......
00485931   1/1  ptggkvllvgadi.............rrigavpqlpvlfprltvlenlalg.....gadlaeraeellel
00468601   1/1  pqggkvlllgaDiyraaaae.....rlgigavpqdvplfpsltvldnlalardlleaakaagydvvlidt
00367481   1/1  aglllpasggilvpgedalll..............................................rvd
00503371   1/1  KStlldaiagllgpdsgeirldgkdlliylsdlir..rgagiayveqefdlfdgltvlenvllglgdeli
00381441   1/1  pdsgsigslttrlprlgevdgvdltfls........reeigyvfqepallpdltvlenlylglllallla
00379601   1/1  dgvlelllvvldllsldleellalasriavlagrdiserrlpldgallpdgsrvrvrlsplptllggesl
00462761   1/1  peepgsgvvlldgddlr..........lglliglvfqdpdllpfltvlenvllpllaagliv...ivdgt
00422141   1/1  yridgvlielifldeeellallsrlkslaglpilearlpqggriqavlppvvvdfrvstlpdigglslvi
00532531   1/1  pddgeilidggdinleggfyakaigllrrkigyvfq...lfpfltvlenvalgldglvdeedleraenll
00478411   1/1  ....Gtilldg.dlvrlglkd.......gigmvfqdpalfplltvrengvalglllaglskaeieervdl
00475381   1/1  kptsgivsvdglrlavlsrdllgllreglirigyvfqdyalfprltvlenvllgll..............
00475521   1/1  ...sGeilvdg.dlv......dleplrrdigmvfqdpalfplltvrenvilgllelaglskaealarvde
00480471   1/1  ptsvpettrdfilgeilldgkdltlvdtpgiargrlklllearraaigivfqdvdllltltvaenlllgl
00437981   1/1  llgpdsgkilldgkdi............rrgiglvfqliglfphltvlelvalgl....ggilveevrel
00371631   1/1  ikllleellrllgklalddvslsvkkpeiigiaGpsGsGKSTlarlLagllapesgglkvlligtDifyl
00464791   1/1  ..vlidvslpigkGervglvGpnGaGKTtLlkllagllkpdsgeivvyg..ligerprevrellglllel
00475371   1/1  ptggkvlligaDi..........................................rrpsarellgllgel
00515531   1/1  aygpTigptsgtieidgvklqlwDtgGqerfrslwilyfedadaiifvvdlsdrdsflelrrwigrlfqd
00426051   1/1  lefidsgdilrdgvdlggesglllrdlrrl.iglvfqdpilfpgltvglllffldnidlgllirg.deel
00510561   1/1  tGikaLDll.lgiGglprGelvliaGppGsGKTtlalqlaanlaaqggkvlyisteesleql......ra
00414121   1/1  glkvaviepdfgeilidgqll....edlgvlavrlgigyvpqtlglfpaltvlellalalllredpdlil
00477971   1/1  ptsgvisvsgttrpprpg......evdgvgyvfqsrelfpeltvagnflegaevrgnlygtsrerveell
00533501   1/1  hldtgdvlldgepigtp........lgrgigyvfqdpalfpgltvrenlelllvfadrygvlrglikpal
00478441   1/1  ....Gailvdd.dlvll......elrgrdilmvfqppalfpllevrglniaevlelaglskaealkrvdl
00468951   1/1  aLDll.lgiGglprGelvlivGppGsGKTtlalqlaanla.klggkvlyidteesldqlr......arrl
00515511   1/1  lpgpTigptegtieidgvklqlwDtgGqerfrslwllyfegadaiifvvdlsdgdsllalrrwigrlfqs
00498531   1/1  al.lgiGglprGsltliaGppGsGKTtlalqlaanlaklggkvlyisteesleql......rarrlgldl
00368501   1/1  glgvelpgknvlLvGppGvGKTtlaralakllga..pfiridgseltekdyvGesvearlrelfeeaigy
00487021   1/1  ll....gvvvidtddllra.............gevfqdyalfphltvlelldnvllgleirgllkaerle
00379961   1/1  lppdsgrivlvgnlsdlldpkdlrellragiplvflnfaalpasllesel....................
00493431   1/1  ptsgvisvggttreprpgev......rgigyvfqsgalfphlivagnllegaevhgllygtskerveeal
00512891   1/1  akfgsvsltgrdv.........rsarrgigyvfq........tveellgllaelvgle..........vr
00484101   1/1  prggrvavigldigrldldellg.....igylfqdvgllpvltvrenlalllrglpgysaeeleralell
00489571   1/1  pt....................................................................
00387201   1/1  ptsfvvsptftlvreyelGeilldgrdlyrlsleeallllfldeileidglllvelregigyvfqdpalf
00464411   1/1  gptggsvlltgepvsgeplge.......ligevfqdgilfpdltvlenvalgrygll.glikealaegvi
00368571   1/1  rllaglllpdggrviviDpkgeyaglarglgvvildpgdgrsvrlnplaliddeedaaellralvsemgr
00477011   1/1  vlpvgggpgtrrptelrlsetpgltvlvvflelgerldllglvfqdfsllpelielenralagpiagisr
00496571   1/1  ...ggsvldtgepirgeplgelir......glvfqdpllldeltvlenlalgrylhlglilaalaa.gvg
00434401   1/1  erggsvavidlddfyrpaaell..lreglgidfqlpdal....................drellreevle
00356411   1/1  gpTiginegtieidgvkltlwDtgGqesfrklwilyfegadaiifvvdasdrdsflnldkwrnrlgevlq
00437941   1/1  llptsggvrvlgidaselld..................................................
00490731   1/1  krggkvllidaDp..........................................yrpaadellgvlaee
00503741   1/1  vllvGppGvGKTtLakllagllkpkfgeillfg.................kvvyvnvselldlkellrll
00508671   1/1  TlaraLakrLeepgsgvvlldgddlraglsiglilsdedraalrrr.lgevfqelllagrlvvldgtalg
00451571   1/1  ...glivldgddl...........lreaiglvtqdgelllelid.egilvpdeiviellrealeeldadg
00470731   1/1  gikkpkvillvGppGsGKTTlaralakel..gagfilidgddlrekavgeleklgr.dlfqvaregglvp
00439861   1/1  litGppGsGKTtlalqlaanlaknggkvlyisle....esreqlleraerlgldleellllgll......
00532471   1/1  nglggivsvddlgrdvgelggaalldivdegrliglvfqdldllpllevlellaa...............
00379261   1/1  lferlglrrpgknvlLvGppGvGKTtlaralAkll.....gapfvevdaselteggyvgedlekrirelf
00498811   1/1  .....gvividgddlt....relvaggglliglifqdfglfelldrellielllenlalglalegvilda
00404191   1/1  krggrvlyvsa...........................................................
00392701   1/1  apfgrvda..............................................................
00499191   1/1  atvgdvd..................gllvgvvfqddfylllpalevlengaflldlllpdaldrelllel
00406781   1/1  vpfvrisa..............................................................
00489631   1/1  glpf..iridgddllrellgel...lgrgigfgfqqgdlledatvlenlalllldeidka..........
00480251   1/1  ergkkvllidlDpyrpsapeqlgilgellg.....................vpvvgvltgldlagalrea
00444381   1/1  rlelfgklddligrspairrllellgarpgenvlLvGppGtGKTtlakalakll..gvpfiridgselte
00482551   1/1  naalplelgklggkvlyistee.afsperlreralsl.............................gldl
00405881   1/1  ivsgypgttldpnlgvvelddgrqlvlvDtpGlielaslgeglvrqalealeradvillvvdasd.....
00480441   1/1  p..glivisvgdtt....repregevlgvdyvfvdrelfeelivagnlledaivhgllygtskerieeal
00513251   1/1  ...gfilidaddlr........................................................
00513761   1/1  .dggkvlvidlDparanlpeqlgidirdl...idletvme.lglgpngalvfaleellttldillealel
00499331   1/1  ....glpfidtddllrepvig....agtdigevfqdlllaggllvddev...............rrllle
00515351   1/1  lglpvistddllreav............pggtdigelfqdyllfpfltvdeni.................
00432181   1/1  aivsdypgttrdptlgvveldgrkl.............................................
00420941   1/1  apfiridg..............................................................
00386741   1/1  a.....................................................................
00437901   1/1  .gapvieidaselrd.......................................................
00461621   1/1  lpfistddlyrevvergtelg............klikdyfdpgalvpdllirlllerllfldeg..ggfl
00367291   1/1  .gapfirvdasellek......................................................
00437921   1/1  lllvGppGvGKTtlaralarlllgsgggvdvieldasdlrgvddl...religevlqalglllgg.....
00521551   1/1  apfvrlsas.............................................................
00394721   1/1  laagsgpilld.......................................................gvpv
00402371   1/1  rssgpilldgvpfvrldaselle...............................................
00527261   1/1  prGsGKTtllkalakel..gkpviyidlselsskgyvdleellrelaeelgell................
00533151   1/1  glpfistddllrelvpggldig................evfqda.leaglllfddefrglller......
00517691   1/1  aivgdvlvdg.................................................gtlllllglls
00511381   1/1  eagkgvilvkdaidtrlgielv....vsriglvleavglffaldllelll....................
00469161   1/1  ltglsv...lltredgfgtplgelirelllegfqdlilvpdllvlellaanraglrelikellaagkgvi
00473941   1/1  alagllga..............................................................
00519581   1/1  glpliidldalaellfgdvgglvvdli...........................................
00476071   1/1  pvidtddltregvll................................ggpllerirellgegyllfdeal
00457851   1/1  glpvistddllre............avpggtrlgeviqdlfllggllffdeldellkerieellaag.gv
00410531   1/1  .......................................................gefvdygptigvnfk
00478081   1/1  plgggvvvidt................................................ddlrreairel
00472911   1/1  gapfisgddllrglageggkpl................................................
00416171   1/1  rsgvpfvrvncsalte......................................................
00477721   1/1  ....glpfidtddll....relvgegielilelfd.........................rarfrkllie
00496061   1/1  lpvistddllreevepggtdlgeifqalllagellfddevlgll............rerldelielllag
00430121   1/1  vvgqeeakeallealrrgrkglelgirpggnvllvGPpGvGKTtlakalagllfp..sgvpfirinlsel
00482721   1/1  ...glpvidtddlyrelvaggtplgerirellgegyllpdealfrallaellfgdllala.........l
00410321   1/1  p.eygptiginvgtveldg.vklqlwD-------------------------------------------
00409841   1/1  aivsdip.gttrdpilgv....................................................
00482661   1/1  dnfykvdesdiayqyallakedenaaaflksnrqkklvrdladrviaeerlellekiieellrirldkll
00495771   1/1  attgeipg--------------------------------------------------------------
00478131   1/1  plglgvvv--------------------------------------------------------------
00478391   1/1  ....glpvidgddllrelvgeggrlgrd....lfdedrllfrellideidl...................
00401211   1/1  ......................................................................
00487061   1/1  er.gargldvvviyepvdywaavgggdllrlirelllrlgfgepdafdn.ellgellealleg.......
00471271   1/1  rpgvGKStLln-----------------------------------------------------------
00420081   1/1  ptggrvll--------------------------------------------------------------
00516041   1/1  el....glpfvvidaddl......lrgeelgriielfdearelvpelallfideidell...........
00509891   1/1  arglkvavidrdpgrld................................ldeplgv...drerlrrvgel
00378841   1/1  iveyiptigvdvytktveidgkkvklqlwDtaGqerfrsllelyyrgadgillvvdvtdresfeelkkwl
00493171   1/1  glivlsv---------------------------------------------------------------
00457881   1/1  glpvidtddllrele............pdgtelgellqdlllag...............gllpdaivrdl
00378621   1/1  dtpgtti---------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           TGLADRLEHLPAKLSGGQQQRVAVARALVGSPEVLYADEPTGNLDSRSGAEVLSFLRDSVRELGQTIVMV
00390411   1/1  hldlrelllnllrrrgiglvpqehdlfplltvaenialldelaglpkygnylsllkeklkelnallkele
00422801   1/1  lglllallllglskaeararalellellplgldtlldrlvgeLSgGqrqrvalArallldpdllllDEpt
00440861   1/1  yleeadlvllviddglteldlellkllkelgkpvilvlnkiDllkkeelekllkslnkelglkelrrgig
00378981   1/1  llellglddlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelglt
00379581   1/1  skaearervlellelvgldtlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellel
00420701   1/1  llellglddlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelglt
00466931   1/1  grlelllllllllellallldlllllllllllllllllllvlllllllllvlllllllalllllalkeaa
00509431   1/1  kdi...slldlrelrr.ligyvpqdpnllfqltvlenlllgpeerrelldellglellsleealaraeea
00361211   1/1  rlglail.drlpgeLSgGqqqrvaiaralaldpdllllDeptsalssrssendpetvaellellkelake
00510251   1/1  llffltll............lllaakeaalraellllllgletlldrrpseLSgGqrqRvalArallldp
00466971   1/1  glllllaakeaalrlellllllgletlldrlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetr
00490801   1/1  ffltll............lllaakeaalralllllllgletlldrrpseLSgGqrqRvalArallldpdl
00367901   1/1  lrelrr.ligyvpqdpalfpqltvlenlllglelrrklldellgllellalleellklleellkelevle
00475891   1/1  lglalkeaalralllllllgletlldrlvseLSgGqrqrvalarallldpkllllDEPtsgLDpetrael
00425571   1/1  ellglddlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvl
00495371   1/1  ealgldlrglld.rerviellelvgleelldrlprelsggnqrqrvvia.alallpkllllDEptsaldv
00485451   1/1  ilervlellelvgldvvlldtyphelSgGqrqRvaiaralaldpdvlllDEptsglDpetralelldllr
00482201   1/1  lllllaakeaalralllllllgletlldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetra
00436071   1/1  lglgdl.drlvseLSgGqrqrvalarallldpdllllDEptsglDpetralllellrelaeelgltvllv
00404101   1/1  llgldelldrlvgeLSgGqrqrvalarallllleelsldpdllllDEPtsglDpetraellellrelake
00500441   1/1  lglslaeaaeralelllllgledlldrlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetrael
00469451   1/1  llelvgledlldrlpgelSgGqrq..aiara.ardpdllllDeptsalrgsenDpetraeilrlLkelak
00458601   1/1  llllllllllaakeaalralllllllgledlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLD
00482261   1/1  lllllaakeaalralllllllgletlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetra
00500611   1/1  elvgllelldrlprelkrsggqrqrvviDaralllrpe.l.lDEptsaldvslraeilrlLkrlakelgv
00530591   1/1  tvlenlllgllllgllllllaakeaalralllllllgletlldrlpseLSgGqrqrvalArallldpkll
00475991   1/1  nlllglllagellllllaakeaalralllllllgletlldrlpseLSgGqrqrvalArallldpdllllD
00502741   1/1  kaeaaaraaellellgledlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellell
00372301   1/1  vgledlldrlpstlsgGqrqrvai.ralatepsllLlDEptsgldpelraalaeallellaelgatvlfv
00488521   1/1  erlgl.dlldrlphqlsggqrqrvaiaralaeelkpdllvlDeitalfraelegrptsaldvsllrellr
00498251   1/1  ltveenl.............................drlprllsggqrqrvvidsalalrpkllllDEPt
00424961   1/1  f.rdegadvllladsllrlagalrevlgrlgrelSgGqkqrvaiarallleragnleggGsiTalatvlv
00468691   1/1  vfqdpalfpeltvlenlalgallag..............lglaeyldelgkdLSgGqrqrvalAr.....
00496111   1/1  ..........drlpgeldlSgglqrqrvaia...agdpdllllDeptsalrslgndpelraellrllkrl
00436511   1/1  rrigyvfqdpalpallrllalfpaltvaenlrfglglavlllldsatrlaqakreisalarellervglp
00448931   1/1  lgledydvvliDtagrlrlpselsggqkqrvaiaralaaplppevllldeptsglda......lrellel
00495031   1/1  ellerllvidllelvgllelldrlprelsggqrqrvviDalalllrpell..Deptsaldvqlvaeilrl
00457311   1/1  llepvglpevldryphelsgGqrQRv...ralaldpdllilDeptsalgqpdpelr.elldllifldadl
00485931   1/1  lglegfdvvliDtagrgrrvgelsggqkqrvaiarallllldpelllldEptsglda......lrlllel
00468601   1/1  aglld.ldrlvgelsggqkqrvaiarala.apevllldeptsglda......laellelleelgltvlvv
00367481   1/1  eiltrvglsdlldrgls.lsggerqrvalaralatdpslllLDEptsgldpedgaalaeallellaellg
00503371   1/1  irrrilrdgrseyllnglgvslkeliellldlsggelnrvalllqgevdlllldepterldfldelagle
00381441   1/1  leegkivildgdreraeellellgldadlviilpasleellerldrrggelsggqkqR------------
00379601   1/1  virklpkliltledllelenlsfsy...gg.kealkdlslaiepgelvlivGptGsGKTTllkallgllp
00462761   1/1  lllvglrealrkllgllsgGqkqrvadlvvlldadpevllaReptrgldpeteeeleellerleereply
00422141   1/1  rklreviltledlglsy....gdpealkdlslaippgglvlltGptGsGKtTllralagllnpdegrilt
00532531   1/1  alvgleeipnrypselsgGqqqrv...........illldEPtsgLdpvsr...................
00478411   1/1  llelvglddlldrypdelsggqrqrvaiaralalepelllldeptsaldplavvellelllglnee..ld
00475381   1/1  ........llgglvvildggvrqrlalarallldpdvllldeplllldaalr............dlpdlv
00475521   1/1  llelvglddellldrlp...sggqqqeilrvaiallilpvllgralallpelllldeptsal--------
00480471   1/1  dllllellkelkydpvilllnkidllddrllrraeaeerieelle-------------------------
00437981   1/1  lkel............lsgGqkqrvaiaralagdpkvlllDEpt.aldpdaqnaLlklleelak..gvtv
00371631   1/1  paeql.....krigllfq.kglpealdveellellldlke..................gledilvpvlsg
00464791   1/1  gvlf............................aaellervglvaatadeppgelsggqrqrlaiAralad
00475371   1/1  lgldvlvgarggdlsgglrqr..larallgdpdvlliDepgrgldpellallaelldllrelradlgllv
00515531   1/1  lnlfpsltvlenlanvpillvlnKiDlleakeraeellellglgdlldklpselsgGqkqrvalar----
00426051   1/1  eaalelaglprvielllegldtlaggggvvlsGgqrqrvalar....pdlllfldeptselleRllkrlt
00510561   1/1  rrlgldldrlllldaltv.............................eellalaerllsggkvdlvviDs
00414121   1/1  id........................sgGqkqrlalaralladpdlgellllDeptlvlDaasgedlldl
00477971   1/1  ea.gldvlldidpqglsggqkqrlalaralilppsllrgldep.ealdarle.raleellelae..gfdv
00533501   1/1  aegvsvildrvglsdlaydgfprllsgggrqrvalaralvvkpdlvilldeplevldeRlrkrgrlelre
00478441   1/1  vlelvglddr...ypyelsggerqrvailr..vllpklllpdepgrnldvlievavlnlilkl...lgid
00468951   1/1  gldlddllllpaltveellala.............................erllsggkpqlvviDslta
00515511   1/1  lnllesllvlenlanvpillvlnKiDlleaklvllllvglfdlldglpselsggqkqrvala--------
00498531   1/1  dellllpaltveellala.............................erllsggkpdlvviDsltalaps
00368501   1/1  vfqdpalfpg.tvlenlalgllvseligappgyvggdlggllteavlealriklvegelgfrelerevll
00487021   1/1  rvevllervgllldrippalsgGqgqrvildrallselayqpdvllldeplsgldaklreelrdllrell
00379961   1/1  ...............lsggerqrvalaralalrpGllvlAdggvlllDEp.daldpevqaaLlrlleege
00493431   1/1  e....kgllvlldrdlsggqqlrvalaralvvfildpslelldeRlsgrdadtreeirkrlkrlleelgp
00512891   1/1  geleellktlikelsggekqrvalarallakpdvlllDEid.gldpdvleallelleel.krsgvtvilt
00484101   1/1  elagfdvilie..Gllelalplilelrelsdgqiqrvaparallrdpllllldedtvvldkvdlasild-
00489571   1/1  .................lallelrntteagaasgsrdkgllgklkpetraelldllre....egttilvv
00387201   1/1  pel-------------------------------------------------------------------
00464411   1/1  vildrvglsdla..ypgflsggeqqrvaiarallpkpdlvllldepteeldeRllkRg.....rllekle
00368571   1/1  geddfftpaarallralilalaeepe......ptldellellselg....lrdladrleklvagglagll
00477011   1/1  dair.........leielpglpdltlvDtPGlgsvavvdqlsggqkqrvalarallknpdtlillvedan
00496571   1/1  vvldrvglsdlaygfprtlsglgqrqrvalarallkpdlvifldeppteeldeRlrkrl.........rl
00434401   1/1  llglgevvivdvydlsggerqr...aralasgpdvlilDgptlgldv.............lldlpdlvif
00356411   1/1  llelilnltvlenvpiilvlNKiDlleekiveellellgleykgdrdpeelsggqkqrvalaralakdpd
00437941   1/1  ............pselsggerqrvliaralladpkvlllDEi.daldpeaqnaLlklleelpk..gvtvi
00490731   1/1  lgldvllgarggdlsgglrqr..larallgdydvliiDtp.gtldvllelallellkellaelgadvvll
00503741   1/1  .........................lealglpppyqlsggerlrvalaeallalgkpdllilDEitnlld
00508671   1/1  lelrdelrellkeaglpll.vvfldaplevlleRdrrglypeelsgglkqrvaiarplelaaepdlvi--
00451571   1/1  vildgfprllgqaelllsggkadlvifldaplevlleRllkrddekilkrleeqkqrvaiarallkkpai
00470731   1/1  dilfideidall..rkgpdvildgagrtpeqlealldllee...lgrpvvviilttnrevlldral.rRp
00439861   1/1  ..........................siliadplglsgeellrvllalalelkpdlliiDeltalldaer
00532471   1/1  ......rleellerippalsggqgqrvildrslysrpavlllllyvdeplsgldvelreelrdlleslll
00379261   1/1  qearllvfltvlenirldaseylekrvvsrligappgyvgyglggllteavrrlpysvllldelekahrp
00498811   1/1  lrrrllelldllgldvvilegplllsgglrqrpdlvifldappevlleRllkRggldeetiekrlelyle
00404191   1/1  .......delvsklsgglqeqrvaiafalarkpdllllDEidalgldpelqeellelldelaer.gvtli
00392701   1/1  ...sdllgkyvgelsgglrqr..larallakpsvlllDEidklapkrsptsgldvelrrrvlnaLlrlle
00499191   1/1  llalveglvvlldryprllsggqrqrvaia.....dpdvlildgptllldpe............lrplad
00406781   1/1  ...sellgkyvgelsgglrqrlalara..adpgvlllDEidalldarsgsgsggdsssrrvlnaLlrlle
00489631   1/1  .........ledggvvlldgfdrsqlqrlailrallddppdlvvfldapleellerllkRdgrteeeile
00480251   1/1  lellllegydvvliDtagglqrglllalaladlllvllldepllvldatagtellelakgllealgldgv
00444381   1/1  ..........kelvGe................................................segail
00482551   1/1  eelldrllvidatdlldllellerlrrllsegkvdlvviDslallarael..ldepllgldarelrellr
00405881   1/1  ................................plldqpvellsggekqrlalarallgkpvilvlNKiDe
00480441   1/1  da.glgvlldgfprglsqaqalrlaldlvllldpslevlleRllgrgddteevirkrlerlapeleyyee
00513251   1/1  ................gqkqrvalleaalkegylvvvDet..gldraqrlellelardlgrpv.lvifla
00513761   1/1  l..eedydyiliDtpGglelrallalllaiaralaadeillvddptsgldaetqleilelllelllklgi
00499331   1/1  aldelllaggkvvildgfpggllqrealrrllprpdlvilldappeelleRllkrgrldgreddslelle
00515351   1/1  ....rglllealeellaagkvvildglsggllqrvallrallrpdlv-----------------------
00432181   1/1  .......vliDtpGleefa.......sggekqrvalalallreadvlllvvdadeptsfldle....lle
00420941   1/1  ...sellgkyvgelsgglrqllalara..akpsilllDEidklapkrsptsaldadvrrevlnaLlrlld
00386741   1/1  ....pfvrldaselsggeklrgllarala.kpgvlllDEida.ldpdvqeallelleegeltivgggllt
00437901   1/1  ...vddlsgyvgelsggeklrellaealteavlkgkpsvlllDEi.daldpdvlnallklldglrdlsgv
00461621   1/1  ldgfprtleqaeals....kpavlsggrkqrlalaralavdpe.lildgrllgrrllplpdlvifldasp
00367291   1/1  ...........lvgegegrlrgalaealradpgvlflDEidalagkrgsgtsrldpevqnaLlrlleelr
00437921   1/1  .....................................................kpdvlllDEi.drldpd
00521551   1/1  ....elvgkyvgelegglrqllalaraa..npgvlflDEidklapkrsptsglddvsrrrvlnaLlrlle
00394721   1/1  vrldlsellsvsdlvgelegglrgllteala.lakpsvlflDEidrlldardsesslevlnaLlrlledg
00402371   1/1  ......fgkyvgafegglrqllglaraa..kpgvlflDEidsllgarggsgvdpevqnaLlrlleegnvr
00527261   1/1  .....ellkkllkklsellglsilglelilglsggdleelleelaellkklgkpvililDEiqsll.dvs
00533151   1/1  ..........leellargpvvildgfpggllqrealrrlllrpdlvifldapleelleRllkrgrlirle
00517691   1/1  fllalvldslplerergitidvalarllldgrkilllDtP.Ghed......fvkevlralrladgallvv
00511381   1/1  ..............................qdpdviliDE.aqfldp....evvevllelad.tgilvlv
00469161   1/1  ldrfp..lsrlayqlsggerqrlaidlegalllerllldep-----------------------------
00473941   1/1  ..pfielsasdllg...esdlrggfkqa........akpgvlflDEidrl.drevqnaLlelleelqvti
00519581   1/1  ............dleaverhlldiaeellengeilildeptvgldskd...ildelakilkevnfelifi
00476071   1/1  drellaallfglelegalldglvygvlqdrllerllaagpdvlildgpl.lldvellplpdlv-------
00457851   1/1  ild.........gfpldlegaealreallragplpdlvifldapleelleRllkrgreplddteevilkr
00410531   1/1  tvevdgvklviwDtaGqerfrsllarylrgadgillvvdatdglsfeevaklleellglaglegvpiilv
00478081   1/1  llgldlleilfeglllsdefrelleealalladgdvvilDgfgrlldarq...lleelllllleepppdl
00472911   1/1  .........gllfedaleagfrqrladlirallakgkvvild..gtglsreareellellkelg...pvl
00416171   1/1  dlleselfghekgafgggekqrlgllrla..dggvlflDEi-----------------------------
00477721   1/1  lldellaaggvvldlgrtlllrralrellreldlvvfldapleelleRllkRggrfdllie---------
00496061   1/1  gvvildgf.......pldlegalllrealarallpdl.vifldapleelleRllkrgrllereddseevl
00430121   1/1  te....................................................kllvselighppgyvG
00482721   1/1  ldgvvydrlrdellaelsggqgdvliiegalllepgllplpdlvi-------------------------
00410321   1/1  ----------------------------------------------------------------------
00409841   1/1  ..........................vlldgrdllllDtPGlidfaseptnlldleiie-----------
00482661   1/1  edldeiveelppvlfddlvgqeeakeallenlklflkgpellldlglpkgrgllLyGPpGtGKTtlakal
00495771   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00478391   1/1  ............................llakgkvvildgtn..........lsealdealrrllrpdlv
00401211   1/1  ......ldtlkgelergitikigaasllldklaivsdtpgttldpilgvleldgpkllllDtPGh.....
00487061   1/1  ................................gki.vlsarraqlleirlirpllaegkvvilDrepdsa
00471271   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00516041   1/1  .............akgkvvildgtgrlleldealellgpdlvifldappeelleRllkrgldeeaieerl
00509891   1/1  alllaggglcalvaddlagaleel.laralaggpdviliE.gagllplpliellrdlldlvvlvvldgiv
00378841   1/1  eeilrlle..agvpiilvgnKiDllgrqvlveearalakelgiplf..etSaktgegvdelf--------
00493171   1/1  ----------------------------------------------------------------------
00457881   1/1  llel..leelladgkgvildgfprdleqaealrallaelglppdlvifldaplevlleRllkrgddpeea
00378621   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           THDPIAASYADRVVFLRDGRVVDDVTHPTPQLILDRLAGLEG----------------------------
00390411   1/1  lqlkelarllelleglkeeaek------------------------------------------------
00422801   1/1  sgLDpetraellellrelak..gltvllv-----------------------------------------
00440861   1/1  yvfqdpnlfpglvvlisaltgegldeltvrenlalglrlrg..---------------------------
00378981   1/1  vllvthdlsealrladrilvlddGrivel-----------------------------------------
00379581   1/1  lrelake.gltvllvthdldealrlad-------------------------------------------
00420701   1/1  vllvthdlsealrladrilvlddGrivel-----------------------------------------
00466931   1/1  llleelllllglgdlldrpvstLSGGe-------------------------------------------
00509431   1/1  leelnallkeleeeleligplldglell------------------------------------------
00361211   1/1  lgvtvilvthdldlldsallrpgkrpllsdlrgsge----------------------------------
00510251   1/1  dllllDEPtsgLDpetraellellrel-------------------------------------------
00466971   1/1  aellellrelake.gltvllvthdlde-------------------------------------------
00490801   1/1  llLDEPtsgLDpetraellellrelak-------------------------------------------
00367901   1/1  aalaallkeeieeraeellellglgglld-----------------------------------------
00475891   1/1  lellrelake.gltvllvthdldealr-------------------------------------------
00425571   1/1  lvthdlsealaladrilvlddGrivelgt-----------------------------------------
00495371   1/1  slraeilrlLkrlakelgvtvllvth--------------------------------------------
00485451   1/1  tdldkelgrtiilvthdlreae.adri-------------------------------------------
00482201   1/1  ellellrelak..gltvllvthdlsea-------------------------------------------
00436071   1/1  thdldlalaladrivvld----------------------------------------------------
00404101   1/1  .gltvllvthdldealrladrilvldd-------------------------------------------
00500441   1/1  lellrelakelgltvllvthdlsealr-------------------------------------------
00469451   1/1  elgvtvilvtH.......Asdrv-----------------------------------------------
00458601   1/1  petraellellrelake.gltvllvtH-------------------------------------------
00482261   1/1  ellellrelak..gltvllvthdlsea-------------------------------------------
00500611   1/1  tvllvthdlreveeladkrdrv------------------------------------------------
00530591   1/1  llDEPtsgLDpetraellellrelak.-------------------------------------------
00475991   1/1  EPtsgLDpetraellellrelake.gl-------------------------------------------
00502741   1/1  relake.gltvllvthdldealrladr-------------------------------------------
00372301   1/1  tHdlelaalladrvvvlndgrivav...gtpeelyklp--------------------------------
00488521   1/1  lLkrlakelgvtvllvthdldevarl--------------------------------------------
00498251   1/1  sgldplsarellellrrllrlakelgvtvllvthdl----------------------------------
00424961   1/1  eggsdpdllllDeptsalDgeivlsllla-----------------------------------------
00468691   1/1  pvlLllDEptsgldalr..eilellrellkelgyt-----------------------------------
00496111   1/1  .kelgvtvilvthdleeaedladsg---------------------------------------------
00436511   1/1  gdlftllsrlde----------------------------------------------------------
00448931   1/1  lrelgltvlvvthlDllakggadlslaleladrilvlgdG------------------------------
00495031   1/1  Lkrlakelgvtvilvthdlrev------------------------------------------------
00457311   1/1  gltlirlitrdlgeagrsadrvl....griveqgppeelfi-----------------------------
00485931   1/1  lkelgltvlvvthddgtakggaalslaleladrilvlgd-------------------------------
00468601   1/1  tKlDgtakgghdlslalrladrilvlgvGeivedgtpfel------------------------------
00367481   1/1  atvlvvtHdlelaalaadrivvln----------------------------------------------
00503371   1/1  eykgnyeellklleeleellkelekrlelleke-------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00379601   1/1  pdegiitiegpdel..........----------------------------------------------
00462761   1/1  gadiviithdlsieevadrilallegr-------------------------------------------
00422141   1/1  iedp...............---------------------------------------------------
00532531   1/1  ........leladriyvllsGr------------------------------------------------
00478411   1/1  iilalelll-------------------------------------------------------------
00475381   1/1  ifld------------------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00437981   1/1  ilathdlsellpallsrcqvirfpplseeelleild----------------------------------
00371631   1/1  gqkqrlalaralvedpdvlilDgptall------------------------------------------
00464791   1/1  dqgkpvllllDEptsgldal..reillllgellse-----------------------------------
00475371   1/1  vdathdldavlkaadrilvldlg-----------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00426051   1/1  rpgldadteeellellerlar-------------------------------------------------
00510561   1/1  ltalapalelsllldeptsglda-----------------------------------------------
00414121   1/1  lkelaeqlgltvlivlnKiDllselthdlellreladrilvl----------------------------
00477971   1/1  vivnhdleealelld-------------------------------------------------------
00533501   1/1  lds.eevlekrlehylellekadrvvvidaggsleevvee------------------------------
00478441   1/1  allelv----------------------------------------------------------------
00468951   1/1  lrpalllldeptgellgldvrll-----------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00498531   1/1  lllldepgrvtqgldarllreil-----------------------------------------------
00368501   1/1  dlplhdasviallgggrelrdgellkalkeaeaeelle--------------------------------
00487021   1/1  pe.gilpdlvifldadpeell..-----------------------------------------------
00379961   1/1  vtieragitlllpagvtviaatnddlgeldpalldRfdl-------------------------------
00493431   1/1  lieydyvivnddleealeelld------------------------------------------------
00512891   1/1  tndldeleladriallrrgri.velgplseeelleilrrrlnr---------------------------
00484101   1/1  ----------------------------------------------------------------------
00489571   1/1  thldeaer.aDrvavlddGtpeellarpanpyvrellgav------------------------------
00387201   1/1  ----------------------------------------------------------------------
00464411   1/1  yikkrlehylelaepykddvvvidangsieev--------------------------------------
00368571   1/1  egaektaasilellrkllalll------------------------------------------------
00477011   1/1  dl--------------------------------------------------------------------
00496571   1/1  gdteevlehrleraeeladrlialyegavvvidasglsle------------------------------
00434401   1/1  vdhdlevalerrlkrl------------------------------------------------------
00356411   1/1  i---------------------------------------------------------------------
00437941   1/1  lttnrleeldpallsRfdviefpppdee------------------------------------------
00490731   1/1  vvdatlgleaadrilvlleglg------------------------------------------------
00503741   1/1  petlspdvlelLlrlleegkltdkllgltliltthdld--------------------------------
00508671   1/1  ----------------------------------------------------------------------
00451571   1/1  l---------------------------------------------------------------------
00470731   1/1  grllldep..eldppdreerle------------------------------------------------
00439861   1/1  vrelrellralkrlakelgvtvilvsq-------------------------------------------
00532471   1/1  vlpl------------------------------------------------------------------
00379261   1/1  irvlllsaslvlllggl-----------------------------------------------------
00498811   1/1  laplygaadividndlsle---------------------------------------------------
00404191   1/1  lttnnrpeeldqallrll----------------------------------------------------
00392701   1/1  glrllsgvtviattnrpeeld-------------------------------------------------
00499191   1/1  lvifldaspeelleRllkRgrlergddleevlerilerv-------------------------------
00406781   1/1  elrllsgvtviattndlee---------------------------------------------------
00489631   1/1  rlarleeryradlvivtddl..------------------------------------------------
00480251   1/1  vltkldlvaalgaalsvalilglpilflgtgenvddlevfn-----------------------------
00444381   1/1  sggfkqrvgia..lladpgilf------------------------------------------------
00482551   1/1  lLkrlakelgvtvilts-----------------------------------------------------
00405881   1/1  p..-------------------------------------------------------------------
00480441   1/1  lgladvvivnddleealelllai-----------------------------------------------
00513251   1/1  tspevlierlldrvllldegslvdlg--------------------------------------------
00513761   1/1  pi--------------------------------------------------------------------
00499331   1/1  krleryeeltrdlielyeeadrvividaglsieevve---------------------------------
00515351   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00420941   1/1  glqalsnvtviattnrpeeldpallrpgRfdlvief----------------------------------
00386741   1/1  eldg------------------------------------------------------------------
00437901   1/1  liil------------------------------------------------------------------
00461621   1/1  eelleRllkrgr----------------------------------------------------------
00367291   1/1  vlsg------------------------------------------------------------------
00437921   1/1  aqnal-----------------------------------------------------------------
00521551   1/1  gled------------------------------------------------------------------
00394721   1/1  nvlviattnrp..---------------------------------------------------------
00402371   1/1  viaa------------------------------------------------------------------
00527261   1/1  skelleaLlrlld---------------------------------------------------------
00533151   1/1  ddseevlekrlerylklyer--------------------------------------------------
00517691   1/1  dad-------------------------------------------------------------------
00511381   1/1  tglemdfagelfegsll-----------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00473941   1/1  lggg------------------------------------------------------------------
00519581   1/1  thde------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00457851   1/1  lerlrelyerliepyeeaddvividaslsieevv------------------------------------
00410531   1/1  gn--------------------------------------------------------------------
00478081   1/1  vifl------------------------------------------------------------------
00472911   1/1  vifl------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00496061   1/1  ekr-------------------------------------------------------------------
00430121   1/1  edelgvlfeaarkappsvlllDE.idkldpdvlnaLl---------------------------------
00482721   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00482661   1/1  anel------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00478391   1/1  ifld------------------------------------------------------------------
00401211   1/1  ..e-------------------------------------------------------------------
00487061   1/1  dlafagagyllggldleevkaleell.............-------------------------------
00471271   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00516041   1/1  erlreilepleeaddlvidtanld----------------------------------------------
00509891   1/1  llvdaidrleaadl--------------------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00457881   1/1  lekrlklyepllelyeea....dylividaslsiee----------------------------------
00378621   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------