[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ55924.1


[Show Plain Result]

## Summary of Sequence Search
   1::707
 141::581   7e-129 38.2% 0045947 00459471 1/1   s)glycosidases                          
  50::577 7.7e-108 33.9% 0038123 00381231 1/1   s)glycosidases                          
 158::579  1.4e-98 34.8% 0039218 00392181 1/1   s)glycosidases                          
 146::578  2.6e-97 33.2% 0047491 00474911 1/1   s)glycosidases                          
 147::548  3.2e-96 38.8% 0046963 00469631 1/1   s)glycosidases                          
 144::578  1.3e-94 35.4% 0046152 00461521 1/1   s)glycosidases                          
 143::578  1.5e-94 36.0% 0046139 00461391 1/1   s)glycosidases                          
 157::581  4.6e-94 36.1% 0046336 00463361 1/1   s)glycosidases                          
 153::578  2.6e-93 32.0% 0050760 00507601 1/1   s)glycosidases                          
 107::584  6.4e-93 33.1% 0046924 00469241 1/1   s)glycosidases                          
 146::578  1.6e-92 36.7% 0036198 00361981 1/1   s)glycosidases                          
 149::576  1.8e-92 34.2% 0044469 00444691 1/1   s)glycosidases                          
 159::572    2e-92 34.9% 0046455 00464551 1/1   s)glycosidases                          
 101::579  1.1e-91 36.9% 0047591 00475911 1/1   s)glycosidases                          
 147::578  7.6e-91 34.8% 0046023 00460231 1/1   s)glycosidases                          
 146::578  9.9e-90 35.0% 0049424 00494241 1/1   s)glycosidases                          
 143::576  1.1e-89 35.3% 0042224 00422241 1/1   s)glycosidases                          
 141::579  2.2e-89 34.9% 0051975 00519751 1/1   s)glycosidases                          
 149::576  1.1e-88 33.2% 0040789 00407891 1/1   s)glycosidases                          
 148::578  1.7e-88 36.1% 0046505 00465051 1/1   s)glycosidases                          
 145::581    4e-88 35.3% 0046266 00462661 1/1   s)glycosidases                          
 141::583  9.8e-88 33.3% 0048117 00481171 1/1   s)glycosidases                          
 147::575  1.4e-86 36.3% 0051481 00514811 1/1   s)glycosidases                          
 161::577  1.6e-86 36.8% 0047545 00475451 1/1   s)glycosidases                          
 152::575    2e-86 35.8% 0049836 00498361 1/1   s)glycosidases                          
 147::577  2.9e-86 32.0% 0046559 00465591 1/1   s)glycosidases                          
 158::578    7e-85 35.4% 0040700 00407001 1/1   s)glycosidases                          
 149::578  1.5e-84 36.4% 0048959 00489591 1/1   s)glycosidases                          
 171::582  1.8e-84 33.6% 0046948 00469481 1/1   s)glycosidases                          
 150::582  6.8e-84 35.8% 0051733 00517331 1/1   s)glycosidases                          
 149::582  8.2e-81 37.2% 0052962 00529621 1/1   s)glycosidases                          
 155::554  1.8e-78 35.3% 0052913 00529131 1/1   s)glycosidases                          
 156::551  2.1e-78 35.5% 0047246 00472461 1/1   s)glycosidases                          
 146::578  2.9e-76 32.6% 0047117 00471171 1/1   s)glycosidases                          
 159::572  4.2e-76 33.5% 0048530 00485301 1/1   s)glycosidases                          
 158::575  2.3e-75 35.6% 0045828 00458281 1/1   s)glycosidases                          
 159::575  4.1e-71 34.6% 0052376 00523761 1/1   s)glycosidases                          
 152::605  1.3e-70 32.7% 0048242 00482421 1/1   s)glycosidases                          
 156::549  1.2e-66 36.3% 0047236 00472361 1/1   s)glycosidases                          
 154::602    7e-63 29.9% 0049124 00491241 1/1   s)glycosidases                          
 158::533  7.8e-54 30.4% 0044281 00442811 1/1   s)glycosidases                          
   8::150  2.5e-49 57.6% 0045945 00459451 1/1    domains                                
 161::589    2e-39 24.5% 0052585 00525851 1/1   s)glycosidases                          
 169::565  1.5e-28 24.2% 0050004 00500041 1/1   s)glycosidases                          
 590::700  1.3e-26 48.0% 0045946 00459461 1/1   syl hydrolase domain                    
   6::123  1.4e-19 31.4% 0048116 00481161 1/1    domains                                
  13::118  6.8e-18 36.7% 0046558 00465581 1/1    domains                                
   3::116  5.3e-13 34.7% 0051973 00519731 1/1    domains                                
 214::346  4.2e-06 23.0% 0051737 00517371 1/1   s)glycosidases                          
   1::707


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPMVEVWPGHAYPLGATYDGSGTNFSLFSEVATGVELCLFDDDGAETRVPLTEQDGHVWHGYLPTVGPGQ
00459471   1/1  ----------------------------------------------------------------------
00381231   1/1  -------------------------------------------------ipllktggvwkveipgldggl
00392181   1/1  ----------------------------------------------------------------------
00474911   1/1  ----------------------------------------------------------------------
00469631   1/1  ----------------------------------------------------------------------
00461521   1/1  ----------------------------------------------------------------------
00461391   1/1  ----------------------------------------------------------------------
00463361   1/1  ----------------------------------------------------------------------
00507601   1/1  ----------------------------------------------------------------------
00469241   1/1  ----------------------------------------------------------------------
00361981   1/1  ----------------------------------------------------------------------
00444691   1/1  ----------------------------------------------------------------------
00464551   1/1  ----------------------------------------------------------------------
00475911   1/1  ----------------------------------------------------------------------
00460231   1/1  ----------------------------------------------------------------------
00494241   1/1  ----------------------------------------------------------------------
00422241   1/1  ----------------------------------------------------------------------
00519751   1/1  ----------------------------------------------------------------------
00407891   1/1  ----------------------------------------------------------------------
00465051   1/1  ----------------------------------------------------------------------
00462661   1/1  ----------------------------------------------------------------------
00481171   1/1  ----------------------------------------------------------------------
00514811   1/1  ----------------------------------------------------------------------
00475451   1/1  ----------------------------------------------------------------------
00498361   1/1  ----------------------------------------------------------------------
00465591   1/1  ----------------------------------------------------------------------
00407001   1/1  ----------------------------------------------------------------------
00489591   1/1  ----------------------------------------------------------------------
00469481   1/1  ----------------------------------------------------------------------
00517331   1/1  ----------------------------------------------------------------------
00529621   1/1  ----------------------------------------------------------------------
00529131   1/1  ----------------------------------------------------------------------
00472461   1/1  ----------------------------------------------------------------------
00471171   1/1  ----------------------------------------------------------------------
00485301   1/1  ----------------------------------------------------------------------
00458281   1/1  ----------------------------------------------------------------------
00523761   1/1  ----------------------------------------------------------------------
00482421   1/1  ----------------------------------------------------------------------
00472361   1/1  ----------------------------------------------------------------------
00491241   1/1  ----------------------------------------------------------------------
00442811   1/1  ----------------------------------------------------------------------
00459451   1/1  -------pgspypLGatyladgggvnFavfsptAtrVeLlLfdegdgeleiallpltertggvWhvfvpe
00525851   1/1  ----------------------------------------------------------------------
00500041   1/1  ----------------------------------------------------------------------
00459461   1/1  ----------------------------------------------------------------------
00481161   1/1  -----ehadpyevLGahllgldgvggvvfrvwaPnAesVslvgdfnnwdgeahpmerldeggvwelflpg
00465581   1/1  ------------vLGahllgdgvrfrvwaPnaesVslvlfngw....rlplerddsgvwelfvpgllpgt
00519731   1/1  --legrhhdpfavLGahllggvggvvfrvwaPnaerVsvvl...dgnew..pmtrlddgvfelflp.lgp
00517371   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           RYGYRVHGPYDPERGLRCNPNKLLVDPYAKAIDGQIHWHESLFDYHFADPGRVNNHDSAPYVPTCVVVSP
00459471   1/1  ----------------------------------------------------------------------
00381231   1/1  lykyrvygpy......reldpktlsdpyalal..................yawgdlewllaraaldalap
00392181   1/1  ----------------------------------------------------------------------
00474911   1/1  ----------------------------------------------------------------------
00469631   1/1  ----------------------------------------------------------------------
00461521   1/1  ----------------------------------------------------------------------
00461391   1/1  ----------------------------------------------------------------------
00463361   1/1  ----------------------------------------------------------------------
00507601   1/1  ----------------------------------------------------------------------
00469241   1/1  ------------------------------------kellekeleklleellaeleaelekngelellll
00361981   1/1  ----------------------------------------------------------------------
00444691   1/1  ----------------------------------------------------------------------
00464551   1/1  ----------------------------------------------------------------------
00475911   1/1  ------------------------------dldspldvkdaviYqifpd..rfangd.....psndvvdp
00460231   1/1  ----------------------------------------------------------------------
00494241   1/1  ----------------------------------------------------------------------
00422241   1/1  ----------------------------------------------------------------------
00519751   1/1  ----------------------------------------------------------------------
00407891   1/1  ----------------------------------------------------------------------
00465051   1/1  ----------------------------------------------------------------------
00462661   1/1  ----------------------------------------------------------------------
00481171   1/1  ----------------------------------------------------------------------
00514811   1/1  ----------------------------------------------------------------------
00475451   1/1  ----------------------------------------------------------------------
00498361   1/1  ----------------------------------------------------------------------
00465591   1/1  ----------------------------------------------------------------------
00407001   1/1  ----------------------------------------------------------------------
00489591   1/1  ----------------------------------------------------------------------
00469481   1/1  ----------------------------------------------------------------------
00517331   1/1  ----------------------------------------------------------------------
00529621   1/1  ----------------------------------------------------------------------
00529131   1/1  ----------------------------------------------------------------------
00472461   1/1  ----------------------------------------------------------------------
00471171   1/1  ----------------------------------------------------------------------
00485301   1/1  ----------------------------------------------------------------------
00458281   1/1  ----------------------------------------------------------------------
00523761   1/1  ----------------------------------------------------------------------
00482421   1/1  ----------------------------------------------------------------------
00472361   1/1  ----------------------------------------------------------------------
00491241   1/1  ----------------------------------------------------------------------
00442811   1/1  ----------------------------------------------------------------------
00459451   1/1  lelenlgllpgqlYgYrvdGpydplsdkleelslaglladvdedGhrfnpnklLlDPYAkalvgnlvlsl
00525851   1/1  ----------------------------------------------------------------------
00500041   1/1  ----------------------------------------------------------------------
00459461   1/1  ----------------------------------------------------------------------
00481161   1/1  llpgqlYkyrvdgpd........getllllDPyafalelgpl.....daslvv-----------------
00465581   1/1  lYkyrv............ggtlllaDPyafalelgvhdaslvvdldhe----------------------
00519731   1/1  gtrYkfrvdg.............llvaDPyafaqelgvldlslvad------------------------
00517371   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           FFDWGAEQHPNIPYHETVIYEAHVRGMTIRHPDVPPPLRGTYAGMAHPAIIEHLLSLGVTAVELMPIHHF
00459471   1/1  dfdwgddaplprwwkdaviYeihvrsftdgdgdivelgggdfagiiek..LdyLkdlGvtaiwLsPvfes
00381231   1/1  plsyvvvlpdpdwwkdaviYeihvrsftdgngdgdplgsldpllglflgGtlagliek..LdylkdlGvt
00392181   1/1  -----------------yiyefhdgdfd.........ggGdlagiiek..LdyLkdlGvtaiwLsPifes
00474911   1/1  -----gdlppppwwkdaviYeihvrsftdgdgdgdeelglllltgfdtivllfggdlaglie..kldylk
00469631   1/1  ------drkplvplvdtviyevhvrlltrsfsdvelfgggtlaglie..kldyLkdlGvtavwlsPvfes
00461521   1/1  ---lweddlppppwwkdaviYeihpdsfadgdgdgdplnglllqgrevivhlfggdlagiidkalldyLk
00461391   1/1  --lweddlppppwwkdaviYeihvrsfadgdgdgdplngllllgrevivhlfggdlagiidkllldyLkd
00463361   1/1  ----------------kviyelhprsftdln.....gdggdlagla..ekldnylkdlGvtavwllPife
00507601   1/1  ------------WwkdaviYeihprsftdgdgdgiplivhlfggdlaglie..kldylkdlGvtaiwlsP
00469241   1/1  eleelllgllelllklygdplevrlrlallvllllgyvlldaawlairaptprwwkdaviYekllGliih
00361981   1/1  -----dklpspawwkdaviYeihvrsfsdgdgdgvpllrlfegdltnlvllfggdlaglaekldlpyLkd
00444691   1/1  --------pkplwwkdaviYeihvrsfadgngdgv....gdlagiiekl..dyLkdlGvtaiwLsPifes
00464551   1/1  ------------------iYevhvdrFadgnpd....gggdlagiiek..ldyLkdlGvtaiwlsPvfes
00475911   1/1  afdwgddrppliwwedav..........idsngdgiflrlfegdlagla..ekLdylkdkLGvtavwllP
00460231   1/1  ------lkppppwwkdaviYeihvrsftdgdgdgdpalrglllltdtytlllrfggdlaglie..kLdyl
00494241   1/1  -----ddlpppewwkdaviYeihvrsftdgdgdgvhlfqlfwgdialelqlflggdlaglie..kLdylk
00422241   1/1  --lweddlppprwwkdaviYeihvrsfadgdgdgvhlfewylgdiarlqeylggdlagliek..ldleyL
00519751   1/1  tydwkddaplprwwkdaviYevhvrsftd.........ggdlaglae..kLdylkdlGvtavwllPifes
00407891   1/1  --------pkprwwkdaviYeihprsfadsdgdgi....Gdlagiie..kLdyLkdlGvtaiwlsPifes
00465051   1/1  -------lppplwwkdaviYeihvrsftdgdgdgdlllgfewevgtdrllllfggdlaglae..kldylk
00462661   1/1  ----aPllllpspewwkdaviYeihvrsfadgdgdgilllrllelglttivhlfgGdlaglae..kLdlg
00481171   1/1  vvvdpdrldlpawwkdaviYeihvrsf...tndspgdgggdlaglaekl.ldylkdlGvtavwllPifes
00514811   1/1  ------llppplwwkdaviyqlfv...............Gdykgiaekl.ldyLkdlGvtaiwlsPvfes
00475451   1/1  --------------------qidpl.lsfldsngdglfggdlaglae..kLdeylkdlGvtavwlsPife
00498361   1/1  -----------ewwkdaviYelfv...............gdfagiiek..ldylkdlGvtaiwlsPifes
00465591   1/1  ------lddptplwwkdaviYeihvrsft...dg......gdlaglie..kldylkdlGvtavwllPife
00407001   1/1  -----------------aviYeihvrsftdgdgd....gggdlaglaekl..dyLkdlGvtaiwlsPife
00489591   1/1  --------pspewwkdaviYqifprrfadgdgdngiplrplliyelhvgsivhlfgGdlagla..ekldy
00469481   1/1  ------------------------------lPesildsfgGdlagiaek.lldylkdlGvtavwllPife
00517331   1/1  ---------lspawwkdaviYeihvrsfadgdgdgvlalrtlivhlfgGdlaglae..kldylkdlGvta
00529621   1/1  --------Aspd.wwkdaviYeihvrsfadgdgdgvpllrttilglfggdlagla..ekldylkdlGvta
00529131   1/1  --------------sdaviyelfvr.......dsngdg.gdlaglae..kldylkdlGvtavwlsPife.
00472461   1/1  ---------------daviYevhvrsfnw.dsngd...ggdlagla..ekldylkdlGvtavwlsPifes
00471171   1/1  -----lvlptpewwkdaviYeihvdsfadgdgdgvlllqlfewyapydlqllfggdlagiie..kLdyLk
00485301   1/1  ------------------iYevhvdsFadsngd....gggdlkgiiek..ldyLkelGvtaiwlsPvfes
00458281   1/1  -----------------qviyelf.......vwdsngdgggdlaglie..kldylkdlGvtavwllPife
00523761   1/1  ------------------iYqvhvdsFadsng....dgggdlkgiaek..ldyLkdlGvtaiwlsPvfes
00482421   1/1  -----------lalpwwpdsevhvrsftwdsngd....ggdlagla..ekldylkdlGvtavwllPifes
00472361   1/1  ---------------daviYelhvrsf.......pgdgggdlaglae..kldylkdlGvtavwlsPifes
00491241   1/1  -------------wengviyelfvdsf........pg..gtlkgla.eklldylkdl.ftavwllPifes
00442811   1/1  -----------------AviYqvlvdrFadgdgdg....ggdlkgiiek..ldyLkdlGvtaiwlsPvye
00459451   1/1  aldlg.....------------------------------------------------------------
00525851   1/1  --------------------edvlkqytlltgkpplpprwalgiyqswrsfydgdlegile..kldylke
00500041   1/1  ----------------------------egtvevdgggfvlnGkpvflrGvnihpgsflsgegaggdyeg
00459461   1/1  ----------------------------------------------------------------------
00481161   1/1  ----------------------------------------------------------------------
00465581   1/1  ----------------------------------------------------------------------
00519731   1/1  ----------------------------------------------------------------------
00517371   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           LPEHALVARGLTNYWGYNTLAFFAPHSGYAATGTRGHQVQEFKTMVKALHQAGIEVILDVVYNHTAEGDH
00459471   1/1  plvdndpwlldkglygswGYdpvdyfavdpryGtdpdplsrledfkeLvdaaHkrGikVilDvVyNHtsd
00381231   1/1  aiwLlPifespsdds....kganywGYditdyfavdpryasnpldpfGtpedfkaLvdaaHarGikVilD
00392181   1/1  p.........ggsdhGYdvvdyyavdpry...Gtpe....dfkeLvdaaHarGikVilDvVpNHtsddhh
00474911   1/1  dlGvtaiwllPifesp...........sdhGYdpvdyfavdpry...Gt....ledfkaLvdaahkrGik
00469631   1/1  al.vgllsvgggayhgYdpvdyf.vdpry...Gtee....elkalvdalhaaGikVilDvVpNHtagggp
00461521   1/1  dlGvtaiwlsPifesplvnelgllnlggpsyhGYdptdyyaidpry...Gt....ledfkeLvdaaharG
00461391   1/1  lGvtaiwlsPifesplvdrkllnvggpsdhGYdptdyyaidpry...Gt....ledfkeLvdaaharGik
00463361   1/1  spsddsp...glpwyhgYdpvdy.avdpry...Gt....ledfkaLvdaahkrGikvilDvVpNHtsadh
00507601   1/1  ifesp...........sdhGYdvvdyyavdpry...Gt....ledfkaLvdaaharGikvilDvVpNHts
00469241   1/1  vdsfa...........Gdlkglie..kLdyLkdlGvtavwlsPife........spggpsdwGYdpvdyy
00361981   1/1  lGvtavwlsPifesplgnrllgngslsdwgYdpvdyyaidpry...Gt....ledfkeLvdaahkrGikv
00444691   1/1  .........pl.sdhGYdvtdyyavdpry...Gt....ledfkaLvdaahkrGikvilDvVpNHtsddhp
00464551   1/1  p.........ggsdhgYdpvdyyavgefyakgpvdpryGtledlkeLvdaaharGikvilDvVlNHtsde
00475911   1/1  ife...........spsdwGYdpvdyfaidpry...Gtpe....dfkaLvdaahkelrGikalvilDvVp
00460231   1/1  kdlGvtaiwllPifesp...........sdhGYdvvdyyavdpry...Gt....ledfkaLvdaahkrGi
00494241   1/1  dlGvtavwllPifes...........psdhgYdpvdyfaidpry...Gtle....dlkaLvdaaherGik
00422241   1/1  kdlGvtavwlsPifesplvdrkllnvggpsdhGYdpvdyyaidpryGt.......ledfkaLvdaaharG
00519751   1/1  .........pgddnwgYdvtdyfaidpry...Gtpe....dlkalvdaahkrGikvilDvVpNHt.....
00407891   1/1  .........pg.sdhGYdvtdyyavdpry...Gt....ledfkeLvdaahkrGikvilDvVpNHtsddhp
00465051   1/1  dlGvtaiwllPifes...........psdhgYdvvdyfavdpry...Gtle....dfkaLvdaaherGik
00462661   1/1  ylkdlGvtavwllPifespsdlrklgnkglpdswgYdpvdyyaidpry...Gt....ledfkaLvdaahe
00481171   1/1  .........pgddnwgYdvvdyfavdpry...Gtld....dlkalvdaahkrGikvilDvVpNHtsddhp
00514811   1/1  psgd...svglpwyhgYdpvdy.aidpry...Gtee....dfkeLvdaahkrGikVilDvVlNHtagdhp
00475451   1/1  spsdds.....spwywgYdpvd.yaidpry...Gt....ledfkalvdaahkrGikvilDvVpNHtsddh
00498361   1/1  psvdslldvglpwywgYdpvdyyaidpry...Gtle....dfkeLvdaaherGikvilDvVlNHtaddhp
00465591   1/1  s.........pgddnwgYdvtdyfavdpry...Gtp....ddlkalvdaahkrGikvilDvVpNHtsddh
00407001   1/1  sp...........sdwGYdpvdyyaidpry...Gt....ledfkeLvdaahkrGikvilDvVpNHtsddh
00489591   1/1  lkdlGvtavwllPifespsdds..dgglpwywgYdvvdyyaidpry...Gtpe....dlkaLvdaahkrG
00469481   1/1  sps.......gdswyhgYdpvd.yaidpry...Gtle....dfkalvdaaherGikvilDvVpNHtsddh
00517331   1/1  vwllPifespsddslggl...wyhgYdpvdyyavdprl...Gt....ledlkalvdaaherGikvilDvV
00529621   1/1  vwllPifespsdtnlkgp...adwgYdpvdyyaidpry...Gt....ledlkalvdaahkrGikvilDvV
00529131   1/1  ........spgddswgYdvtdyyapgsyyakglvdprlG.tledlkalvdaahkrGikvilDvVpNHtag
00472461   1/1  psd.........gswGYdvtdyyapgsydqkgtvdprl...Gt....ledlkalvdaahkrGikvilDvV
00471171   1/1  dlGvtaiwlsPifesplgds.......syhGYdvtdyyaidpry...Gtle....dfkeLvdaaherGik
00485301   1/1  p.........gladhgYdpvdyydlgefdqkgavdpry...Gt....ledlkeLvdaaharGikvilDvV
00458281   1/1  s...........psdhgYdvvdyyaidepry...Gtle....dlkalvdaahkrGikvilDvVpNHtsad
00523761   1/1  p.........gladhgYdpvdyyavgeflakgtvdpryGtledlkeLvdaaharGikvilDvVlNHtsgd
00482421   1/1  psgsa........dwgYdpvdyyaigesygkgavdprlGtledlkalvdaahkrGikvilDvVpNHrtsa
00472361   1/1  p...........sdhgYdpvdyyaidpsrf...Gtle....dlkalvdaaherGikvilDvVpNHtsadh
00491241   1/1  sggsd.........wgYdptdyyaldprl...Gt....eedlkaL.....arGirvilDvVpNHtaadsp
00442811   1/1  ns.........pladhGYdvvdyydigefdqkgsvdpry...Gt....ledlkeLvdaahkrGikvilDv
00459451   1/1  ----------------------------------------------------------------------
00525851   1/1  lGipldaiwldpiwe...............dgydvgdyt.vdperfg..........dfkalvdelharG
00500041   1/1  i..eedldllkelGfnavRlspiweriepdgggyigdyly.....................pgtyneegl
00459461   1/1  ----------------------------------------------------------------------
00481161   1/1  ----------------------------------------------------------------------
00465581   1/1  ----------------------------------------------------------------------
00519731   1/1  ----------------------------------------------------------------------
00517371   1/1  ---pfwallpvtwryyyggiplmaile..lpydvvvydidyfdgglgrfppelidelhekGlkviayldv


                         -         *         -         -         -         -         +:350
query           MGPALSLRGIDNLAYYRVREDNPRYYLDYTGCGNSLNVRHPHSLQLIMDSLRYWVLDMHVDGFRFDLAAA
00459471   1/1  dhpwfkeapedgpglsdfdgpyrdyyhwddgrg.vpnnwlgglpdlnyenpevrdflldvlrywldeygv
00381231   1/1  vVpNHtsddhpwfqehpewfyvladgsrssedspyrdwyiwrdldldllalilelvdlklsldyaelppn
00392181   1/1  npwfqdglelgfdspyadyyywrdpdgglllplppnnwgswfggsawtydgdtgqyylhlflpggpdlny
00474911   1/1  vilDvVpNHtsddhpwfkeflgsgldsyrdyyfaadppdiwdeddgnyylhlflgglpdlnyenpevrey
00469631   1/1  dgptllglglpnyfhyrgwitdydddnevgncdlgglpdlntenpeVrdylldwlrywleeygvDGFRfD
00461521   1/1  ikvilDvVpNHtsddhpwfkeflgggldyyddyylgapnnwfslfggsawiwdeddgnyylhlflgglpd
00461391   1/1  vilDvVpNHtaddhpwfkefpgggldyyddyylgapnnwlsyfggsawiwdyddgnyylhlflgglpdln
00463361   1/1  pwfldvlevgssfdgfyrdyygwpdgdldppnnwisrlggsatgwgdltqvryldlfglpdlnyenpevr
00507601   1/1  ddhpwfkdflgsgddsyddyyfdadadlnwlsdfglsawiwdeddgnyvlhfflgglpdlnyenpevree
00469241   1/1  avdpry...Gt....ledlkaLvdaahkrGikvilDvVpNHtsddspwfqdvlngrgsdypdyyhwrddd
00361981   1/1  ilDvVpNHtsddhpwfldalergspypdyyvlrddg.gppnnftgigngsdwddatgvyyldlfglpdln
00444691   1/1  wfkeflsgrdspyrdyyiwrdgfdgtppnnwlspflgsawdwddltgnyylhlfllglpdlnyenpevre
00464551   1/1  hpwfqeallrvldngrdspyrdyyiiadgtgflfpgvpylysdfnllhllgditdyddappvnwisvfgg
00475911   1/1  NHtsadhpwfkehpd.wyifpgvpngyadffggsawengdgryyl.htfwgdlpdlnyenllpevrefll
00460231   1/1  kvilDvVpNHtsddhpwfkdlleggddsyydyyfdadpdpltyddddgnyylhlflgglpdlnyenpevr
00494241   1/1  vilDvVpNHtsddhpwfldvlfngpdspyadyyffdddwiydyedgnyvlhlflgdlpdlnyenpevref
00422241   1/1  ikvilDvVpNHtsddhpwfldaldggslyrdyyifdgedpdpnnylsafgisawdddnevyyldlfg.lp
00519751   1/1  ........spdgpwfkdh..pdwyywrdgflgdlpdlnyenpevreflldvlrywldeygvDGfRlDaak
00407891   1/1  wflealsgrdspypdyyiwrdpgtdlppnnwlspfggsawgddedvgnyylhlfsgdlpdlnyenpevre
00465051   1/1  vilDvVpNHtsddhpwfldflfngldspypdyfhwrddgwlyddatgnyvlhlflgdlpdlnyenpevre
00462661   1/1  rGikvilDvVpNHtsadspwfldvldggspyedyylfpdvpldpsdfvlpgpitnwddvvnvrylhlfgl
00481171   1/1  w.....lsdfdgsafyedpdg.evyyldffglpd.lnyenpevreflldvlrywldeygvDGfRlDaakh
00514811   1/1  wfqdalsggdspyrdyyifpdvgdgyspfnwgsyffdggdiwdyddatgvgnldlfglpdlntenpeVrd
00475451   1/1  pwfqdhplrgsdyrdyyiwrdgdldfhppnsawdwddignvryldlfglpdlnyenpevreelldvlryw
00498361   1/1  wfkea...dspypdyyhwrd.ppnnysddfgvgnwdllglpdlnyenpevreylldvlrywl.eygvdGF
00465591   1/1  pwf.....kefpgwdyylwddp.......wgglpdllnyenpevreylldvlrywldeygvDGfRlDaak
00407001   1/1  pwfkdaleggspyrdyyilydypdppndwhsyfggsawtayedgnyylhlfllglpdlntenpevreell
00489591   1/1  irvilDvVpNHtsadhpwfkdflesgdspyadyfvwvdpdgipnnwyrpr..dgilnyddfwgvyylhlf
00469481   1/1  pwfldhldggdspyrdyyild.frsgflgsawgydndliqyylhflvdlpdlnyenpevreelldvllyw
00517331   1/1  pNHtspdspwfkehldwyvwfdgpgyfh.sedpisdweddtgvgnyylhlfllglpdlnyenpevreell
00529621   1/1  pNHtspdhpwfpevpeglnpfddayyfh.sedpgsdwsddtgvgnyylhlflldlpdlnyenpevreyll
00529131   1/1  sddhpwfqdvlengddllvllspypdyfvwrdldypgvpggypdfnwlsvlfdgtdwgdyadvtgcyylh
00472461   1/1  pNHtaesddhpwfqdvlengdnllvllspyadwfiwrdpkfdgsgvvlppnnwlsllfdgsalyefpdpg
00471171   1/1  vilDvVpNHtsadhpwfkdaperdgyswydgnfp..ndwhsffggsawtndsgvgnyylhlfasglpdln
00485301   1/1  lNHtsdehpwfqeallrvldnsrdspyrdyyiwadgglfdfpgvpllysdfllelllfsgvdglppnnwl
00458281   1/1  hpwfkdvlesfdgsyndyyydlnwfslfggitnwddltglyylntfllglpdlnyenpevreelldvlly
00523761   1/1  hpwfqealvlvdlssrdspyrdyyiwrdgtgfdfpllgdlyssllgtllsfagldyllypgvppnnglfh
00482421   1/1  dhpwgpfpdwfvwgdgsyylapyppndwllfglsllldgsiwnydtftgvlnllnyenpevreelldvll
00472361   1/1  pwfkdalepfdgtylfrgppnnwyyflggi..tnyddgtgqyylntfllglpdlnyenpevreelldvll
00491241   1/1  wfldvlangrgleypdyfyivddftlpgvpysdldlvvrprdgpllnysdffngihrvwgtflsdlpdln
00442811   1/1  VpNHmtsddhpwfvdalssddnglllelspyrdyyiwtdfdfdgrldlysppnnwlsffggsawdldelt
00459451   1/1  ----------------------------------------------------------------------
00525851   1/1  ikvil.wvdnhtspdspw....flehldpdwfvwrpdggqyylhlwpgdqpdldftnpevreylldvlrf
00500041   1/1  ddldelvdaahkrGikvildlv.nhtdlpgdqggl..pawlgdalyskdnpyrdwyvwrdgkpgg.....
00459461   1/1  ----------------------------------------------------------------------
00481161   1/1  ----------------------------------------------------------------------
00465581   1/1  ----------------------------------------------------------------------
00519731   1/1  ----------------------------------------------------------------------
00517371   1/1  gesedsrpdwdglllldnpdwllkrldg................Wpgs.vwldytnpevreflldv----


                         -         -         -         -         *         -         -:420
query           LAREFHDVDRLSTFFDIVQQDPVISQVKLIAEPWDVGPGGYQVGNFPPLWTEWNGKYRDTVRDFWRGYPV
00459471   1/1  DGFRfDaakhllkddllrdlpllgdlngyllpnvlgganlpeaheflrelreavdavlpdvfligEvwdg
00381231   1/1  nwlsifggsawyllldldghglnyfdggnllefadgldgyhppwgdllfldllllfldlelsliewdevr
00392181   1/1  enpgllevreflldvlryWldinyrrnfdllgladLrvedpeVrealhrllaeygvDGFRlDavkhllk.
00474911   1/1  lldvlrywldeygvDGfRlDaakhlp.....heflrelreavrel..ypdvfligEvwdggpevlayygf
00469631   1/1  aakhldpd..........flkefldavgpdvflvgEvwdggpellqdyeyggggfgygwaegndslfdfv
00461521   1/1  lnyenpevreylldvllywl.elgvDGFRlDaakhlpkd.....flkelrdavr...elpdvflvgEvwd
00461391   1/1  yenpevreylldvlrywl.eygvDGFRlDaakhlpkd.....flkelrdavr...vgpdvflvgEvwdgg
00463361   1/1  eelldvllywl.eygvdGfRlDaakhl.....paeflpelldalrelnalvdpvkpdvflvaEvwdggpe
00507601   1/1  lldvllywl.eygvDGFRlDaakhlpkeflpeliealrelnalvdavgpdvfligEvwdggpevlsyygy
00469241   1/1  ldavppnnwdsvfrprdgsawdwdgtgnyvlhlflsglpdLnyenpeVreylldvllywl.eygvDGfRl
00361981   1/1  tenpevreflldvllywl.elgvdGFRlDavkhl.....pvdflrelrdavke...gpdvfligEvwdgg
00444691   1/1  elldvlrywl.eygvDGfRlDavkhllkdlllldyplpegllypnklggldnpepheflrelreavrel.
00464551   1/1  sawewdedvgqyylhlfllglpdlntenpevrdelldvlrywleelgvdGFRlDaakhl.....dpdflk
00475911   1/1  dllesvllywldleygvdGfRlDaakhlpneggglenleaheflrelrdavrellpdvfliaEvwdggpe
00460231   1/1  eylldvlrywl.eygvDGFRlDaakhlpke.......flkelreavrevypdvflvgEvwdggpevlayy
00494241   1/1  lldvllywldeygvdGfRlDaakhl.....pveflrelrdavral..gpdvflvgEvwdggpevlgylgf
00422241   1/1  dlntenpevreflldvllywld.ygvDGFRlDavkhl.....ppeflrelrdavkelap....vfligEv
00519751   1/1  hlyrde.plefleelrdav..revlpdvflvgEvwd...gnelllsflpgipeindeytdaprvfllgdl
00407891   1/1  elldvlrfwlde.gvDGFRlDavkhllkdlglrdlpllglyneyggltnlpepheflrelreavralapv
00465051   1/1  flldvllywldeygvdGfRlDaakhl.....pveflrelreavrel..npdvflvgEvwdggpellgyl.
00462661   1/1  pdlnyenpevreylldvllywl.eygvdGfRlDaakhl.....pheflrelrdavrel...pdvflvgEv
00481171   1/1  llpddggrdfgelllnaiggdvlleaheflkelrda.vkalkpdvfl..vgEvwtgfpevlrpylrgglg
00514811   1/1  flldvlrywl.elgvdGFRlDaakhm.....ppdflkeilealkelnelvfpvgpdvflvgEvwdggpev
00475451   1/1  l.eygvdGfRlDaakhlp.....leflkelldalrelrallgdpvgpdvflvaEvwdggpellrylgglg
00498361   1/1  RlDaakhl.....ppeflkelldalkelvlvgpdvflvgEvwd..ggpellleylgldsvfnfplrdall
00465591   1/1  hllkd.vpldflkelreavrnl....nvflvgEvwlgllnallfgeypgilliaewndafrdvlryflrg
00407001   1/1  dvllywl.elgvDGFRlDavkhl.....phdflrelrdavkela.gpdvflvgEvwdggpellll..glg
00489591   1/1  gtflldlpdlnyenpevreelldvllywl.eygvdGfRlDaakhl.....pheflkelrdavre..v.pd
00469481   1/1  l.eygvdGfRlDaakhl.....pveflrelrdavr.....pdvflvaEvwdggpellaylgglgfdavfn
00517331   1/1  dvllywleeygvdGfRlDaakhl.....pveflrelrdav.......dvflvaEvwd.gdpevlagylng
00529621   1/1  dvllywldeygvdGfRlDaakhl.....pveflrelrdav.......dvflvaEvwd.gdeevllyflgg
00529131   1/1  lfdldawgvavdnyrrlfdllglpdlnyenpevreelldvllywldeygvDGfRlDaakhl.....ppef
00472461   1/1  eyylhlgditdwgdfsgdevrncdllglpdlnyenpevreelldvllywldeygvdGfRlDaakhl....
00471171   1/1  yenpevreflldvllfwldeygvDGfRlDavkhl.....pveflkelreavrel..gpdvflvgEvwdgd
00485301   1/1  sifggsgwiwdyndgqyylhlflgglpdlntenpevrdylldvlrywleelgvdGFRlDaakhi.....p
00458281   1/1  wleeygvdGfRlDaakhlpkdflrelldalpelhgllellrallvlpdvfliaEvwdagpellrylgylg
00523761   1/1  fdgsawdyddgqyylhlfllglpdlntenpevreelldwllywleelgvdGFRlDaakhi.....dpdfl
00482421   1/1  ywl.eygvdGfRlDaakhlpkd.....flrelrdavra.......flvaEvwdggp.evlrpygglgfda
00472361   1/1  ywleeygvdGfRlDaakhl.....pkdflrelldalr......eahlilellnelvealgpdvylvgEvw
00491241   1/1  yenpevreelidvllywl.elgvdGfRlDaakhlpkdygtscenleflaeilkalrelllgpdffivgEv
00442811   1/1  gnyylhlgditdygvgnevggyfllglpdlntenpeVreelldwlrywldelgvdGfRlDavkhv.....
00459451   1/1  ----------------------------------------------------------------------
00525851   1/1  wl.eygvDgfrlDavep...............................lpldfglmggllgafvhnlygl
00500041   1/1  ...............wtnpevreafldyarylaeryadlrlknykdgprvdawevgNEpnlg........
00459461   1/1  ----------------------------------------------------------------------
00481161   1/1  ----------------------------------------------------------------------
00465581   1/1  ----------------------------------------------------------------------
00519731   1/1  ----------------------------------------------------------------------
00517371   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           LPELASRISGSSDLYQADGRRPVASINFVTCHDGFTLADLVSYDRKHNEANGEDNRDGTDDNRSWNHGTE
00459471   1/1  gpgllqpygglgldavfnfglrdalrgalkgdnglrldlgdlaklltgsldlypeggllplaavnflenH
00381231   1/1  gqyylhlflkglpdnyenpevreflldvllyWleeygvDGFRlDavhsl.....pleflrelreavrei.
00392181   1/1  ..ppdflrelrdal......pdvflvgEvwdgggeglp....ggldgpenydfldelrdalkgeapdvlt
00474911   1/1  g...glgndsvfdfllmfllldalsggelallllillllf.lllapsravnfldnHDtprladllgl...
00469631   1/1  lkfalgdafsggeladlllns.ltglggldpskavtfvdnHDtqrladllsynl................
00461521   1/1  ggpevlayyqlggglgfdsvfnfplrddlldafrgdnglrlllalrllgsllly....ldparavnfvdn
00461391   1/1  pevllyyqlggglgfdsvfnfplrddlldalkggngsrlllalrllgsllly....ldparavnfvdnHD
00463361   1/1  llryleeggldsvfnfplrdalrdalrggnl..ellrrllnsldlt..gyldpenavnfldnHDtpr...
00507601   1/1  g.fdavynfplrddlldallgglggrlllallllasllyllllldplalvnfldnHDtprlasllggd..
00469241   1/1  DaakhlykdlgrndgnlpepheflrelrdavrelgpdvflvgEvw.tgpgellsylgglg.fdsvfnfpl
00361981   1/1  pealaaylnagglgfdsvfnfdlrdallgalrgeplslsdlanlltgslvly....pdperavnfldnHD
00444691   1/1  ..pdvfligEvwdgdpellryyqlggrlgfdavfnfplrdallealakllgdpgsleeladiltgsllly
00464551   1/1  elrdalrela.gpdvflvgEvwdggpellayylgggggldavfnfplrdalrdalrgd.dlldladilag
00475911   1/1  lllylgelglvfdfpl.frdllrdalrgeslgylldggdlselanrltglpdgl..lgafpenavnfldn
00460231   1/1  ...gfdgewnyafydfllalllgdallrgllallltlsllla.laldpalavnflenHDtprladllgl.
00494241   1/1  ...davfnfplrdallgalrgddgslsdladlltgslallg..aldptlavnfldnHDtprladllggde
00422241   1/1  wdggpellrgyeeggglgfdsvfnfplrdallealrggglsladlaniltgsllly....rdpsravnfl
00519751   1/1  gglgfdsvfnfpalsddllealkysgeapdlrdilvnlltasdglaptnlvnflenHDevrlr.......
00407891   1/1  flvgEvwtgdpellaayvnagglgldavfnfplrdallealakwrggdgdlsdladiltgslalyad...
00465051   1/1  ..gfdavfnfplrdalldalrgddgslsdladlltgslvlyg..ardpalavnflenHDtprladllggd
00462661   1/1  wdggpeglsrygnagglgfdsvfnfplrdalldalrgeggslselanrltgsldlypd....ptravnfl
00481171   1/1  fdsvfnfplygllllalkggl.....vdlltaldgltlglllapseavnflenHDeprlg...srsgngl
00514811   1/1  lapyldggldsvfnfplrdalldafrgdnlgdladlanrltgllyly......penavtfldnHDtqrla
00475451   1/1  fdavfnfplrdllldalrggell.dlldrlggslgly.....dpsaavnfvdnHDtprlgdrlgltlkdg
00498361   1/1  dafrgdn..gdlkdlldrll......lldpelavnfldnHDtvrladllgtlld................
00465591   1/1  gelgsvfdfallgllldalalfllldgdlrdlrdillglaldyltpedlvtflenHDeprla........
00407001   1/1  ldavfnfplrdllldalrgg.sladladilegsl......llapsravnfldnHDtprladllgl.....
00489591   1/1  vfliaEvwdggpevlryylkgggfdllllsvfnfplrdllldalrgeggslsdlanrltgsldlalppe.
00469481   1/1  fplrdllldalrggel.....arlkdildltl..aldparavnfvdnHDnprladllglll.........
00517331   1/1  ldavfnfplrdalldalrggkgdlsdlaniltgsldly....pdperavnfldnHDtprladllgl....
00529621   1/1  fdsvfnfplrdllldalrgdplslsdlanrltgsldlypd....peravnfldnHDtprlasllgdld..
00529131   1/1  lrelrdavre..lygpdvflvgEvwdggpelllpylggglgfdsvfnfplrdalldalrggelad.ladl
00472461   1/1  .pheflkelrdavrely.gpdvflvgEvwdggpellrgylgg.glgfdsvfnfplrdalldalkgge.ls
00471171   1/1  pelllyygrgalrdllaglgfdsvfnfplrdallgalkgdgdlreladllltllgly..aglepfrlvnf
00485301   1/1  pdflkelrealrela.gpdvflvgEvwdggpellayyldggggldavfnfplrdalrdalrggdlld.la
00458281   1/1  glgfdsvfnfplrdalldalrgepgdlrdlanrltgllyly......peravnfldnHDtprlasllggd
00523761   1/1  kelrdavrela.gpdvflvgEvwdggpellayylgggggldsvfnfplrdalrealkg.gdlldladila
00482421   1/1  vynfplrdllldalrggd.lsrladilggtpgllp...rdperavnfldnHDtprl..............
00472361   1/1  sgdpgelldylegglgfdavfdfplldllldalrgslldlrdllnrllsllylppenavnfldnHDtprl
00491241   1/1  w..tggeealsyfnggglgfdfplrgllldalkgg...........dldrlkdwlggwperavtfvdnHD
00442811   1/1  dadflkefldalrela.gpdvflvgEvwdgdpevllyyvgggdgldsvfdfplldalldalagg.dlldl
00459451   1/1  ----------------------------------------------------------------------
00525851   1/1  lylralydalrellpgkrpflltrsgnhgsqry.....................................
00500041   1/1  ...............................gwfgggvdaddlaeflreaadairaadpdapvivegagg
00459461   1/1  ----------------------------------------------------------------------
00481161   1/1  ----------------------------------------------------------------------
00465581   1/1  ----------------------------------------------------------------------
00519731   1/1  ----------------------------------------------------------------------
00517371   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           GPTTDSAIATLRRRQMRNMLTTLMLSQGVPMLSHGDEIGRTQHGNNNAYCQDNPISWVDWELARRNADLL
00459471   1/1  Deprladllvvngkhslangepgdnrdglndnlslgngaeg...drlllelrlallklalallltlpGip
00381231   1/1  .npdvlliaEawtadpel.ylgglg.fdavwnfafrddlldflagg...............ltlsllrap
00392181   1/1  laealtgspdlfeelvleaklpvllgglgfdykllmgllddllralaellaadpvyryylggrlelsmaf
00474911   1/1  ...................................rlarlklaaallltlpGipliyyGdElgltgdgdp
00469631   1/1  ................ilaldlrllkaaaallltspGiPmiyyGdefgrtgggdpnny------------
00461521   1/1  HDtprlasllg........................................aarlklaaallltlpGipl
00461391   1/1  tprlasllg.......................................dlallklaaallltlpGipliy
00463361   1/1  .............................llsalggsvdtaldlallrlalallltlpyGipliyssyGd
00507601   1/1  ....................................larlklaaallltlpGipliyyGdElgltglgdp
00469241   1/1  rdllrealdggn.lsdlanlltgslgylp.....penavnfldnHDeitlgdlprllsllggdnvetwsl
00361981   1/1  tvrlldllg.......................................rlallklalallltlpGipliy
00444691   1/1  ....pdperavnflenHDtprlldllg..................................gdlelrrar
00464551   1/1  slgllp.....peravtfldnHDtqrlasllsygdp..................................
00475911   1/1  HDtprladllggd......................................lallklalallltlpGipl
00460231   1/1  .....................................glarlllalallltlpGipliyyGdElgltglg
00494241   1/1  ......................................rllklalallltlpGipliyyGdelgltglgd
00422241   1/1  dnHDtprlgdllg.......................................raallklalallltlpGi
00519751   1/1  .........sllsrlasllelrlallklalallltlpGipliyyGdelgltnglnnnaygrddartpmdw
00407891   1/1  .peravnflenHDtprladllgglsvl.................................lrarrlklaa
00465051   1/1  ......................................lallklalallltlpGipliyyGdelgltglg
00462661   1/1  dnHDtprlasllgdl.......................................arlklalallltlpGi
00481171   1/1  legdty......lrlarlklalallltlpGipliyyGdel.....gltnaydpdnrrdwmlwdllldddk
00514811   1/1  sll................................gdplltlldlallklalallltlpyGipliyssyG
00475451   1/1  ...................................allrlalallltlpyGipliyyGdelgltgqgdpg
00498361   1/1  ....................lallklalallltlpyGipliyyGdefgltgggdpnart......pldwd
00465591   1/1  ..........sllgglltylrlarlklalallltlpGipliyyGdelgltndgdpnddlgdpelinavre
00407001   1/1  ................................ldlallklalallltlpGipliyyGdefglt..glldp
00489591   1/1  ...ravnfldnHDtprladllgd.......................................larlklal
00469481   1/1  ........................lelddrllklalallltlpyGipliyyGdelagltgqgdp.nrldl
00517331   1/1  ...................................larlklalallltlpGipliyyGdelglt..glgd
00529621   1/1  .....................................rlklalallltlpGipliyyGdelgltglgd..
00529131   1/1  lggslgll.....ppeaavnfvdnHDtprlasllglpddallkla...................------
00472461   1/1  dladrlggslgyl.....ppenavnfldnHDtqrladl.......................---------
00471171   1/1  ldnHDtvrlasllggd......................................larlklalallltlpG
00485301   1/1  dilagslgllp.....peravtfldnHDtqrlasllglgdp.............................
00458281   1/1  ......................................lallklalallltlpGipliyyGdelglt...
00523761   1/1  gslgllp.....pelavtfldnHDtqrlasllglgdp.................................
00482421   1/1  ................................arlrlalallltlpGipliyyGdelgltgpg.......
00472361   1/1  adllg......................................lrlallklalallltl-----------
00491241   1/1  tqrladlegglldeeiktl................................ddalplalllaa......i
00442811   1/1  ldilggtlvllpp.....slavtfldnHDtprllsllglvgd.---------------------------
00459451   1/1  ----------------------------------------------------------------------
00525851   1/1  .............................aslwtgDntsawdrlklaiallltlpgsgipyygsdig...
00500041   1/1  lpgstdpedfdlelladnvDfigvhyYPygftlfdddgsglsl...........................
00459461   1/1  ----------------------------------------------------------------------
00481161   1/1  ----------------------------------------------------------------------
00465581   1/1  ----------------------------------------------------------------------
00519731   1/1  ----------------------------------------------------------------------
00517371   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           DFVRTLSRLRREHPVFRRRRFFQGALPGRGKQRDIAWLRPDGTLMEDADWGRGWRALGVFLNGDAITEPD
00459471   1/1  liyyGdEfgmtgegnnnaygr-------------------------------------------------
00381231   1/1  srsvnflenHDevrlad-----------------------------------------------------
00392181   1/1  nfsllallllalalldfqq---------------------------------------------------
00474911   1/1  nnrl......aldwllld----------------------------------------------------
00469631   1/1  ----------------------------------------------------------------------
00461521   1/1  iyyGdEigltgggdpnnr----------------------------------------------------
00461391   1/1  yGdElgltgggdpnnrlq----------------------------------------------------
00463361   1/1  elgltgdgd.....rdnrrdw-------------------------------------------------
00507601   1/1  dnrrtpdllsrldnagfs----------------------------------------------------
00469241   1/1  ladllllldegslarglpfeenpk----------------------------------------------
00361981   1/1  yGdEfgltglgdpnnrr.----------------------------------------------------
00444691   1/1  lklaaallltlpGipl------------------------------------------------------
00464551   1/1  ...rllklalal----------------------------------------------------------
00475911   1/1  iyyGdElglt..glldpyn---------------------------------------------------
00460231   1/1  dpdnrr......pldwll----------------------------------------------------
00494241   1/1  pnnrr......pldwdql----------------------------------------------------
00422241   1/1  pliyyGdEfgltg...------------------------------------------------------
00519751   1/1  dllslnagfsnalsgelvd---------------------------------------------------
00407891   1/1  allltlpGipliyyGd------------------------------------------------------
00465051   1/1  dpnnrr......pldwdl----------------------------------------------------
00462661   1/1  pliyyGdelgltglgdpdnrr-------------------------------------------------
00481171   1/1  sllnfyrklialrkehpalrrgd-----------------------------------------------
00514811   1/1  dEigmtgggddnart-------------------------------------------------------
00475451   1/1  .yregndrspldwdlld-----------------------------------------------------
00498361   1/1  ...ddesllrfirkL-------------------------------------------------------
00465591   1/1  glgleglllllplllrd-----------------------------------------------------
00407001   1/1  dnrdnvrtpmqwdlslna----------------------------------------------------
00489591   1/1  allltlpGipliyyGdel----------------------------------------------------
00469481   1/1  rlinrldwdg......llalik------------------------------------------------
00517331   1/1  pdnre....pldwdlldddasl------------------------------------------------
00529621   1/1  ....dnnrtpmdwddlddeasl------------------------------------------------
00529131   1/1  ----------------------------------------------------------------------
00472461   1/1  ----------------------------------------------------------------------
00471171   1/1  ipliyyGdElgltgggnn----------------------------------------------------
00485301   1/1  ........rrlk----------------------------------------------------------
00458281   1/1  ...............-------------------------------------------------------
00523761   1/1  ....rrlklayalll-------------------------------------------------------
00482421   1/1  ....................firklialRk...alagggfellla-------------------------
00472361   1/1  ----------------------------------------------------------------------
00491241   1/1  pliyyGdefgl..tgdgnpyndpydinpldwsaldldagllr----------------------------
00442811   1/1  ----------------------------------------------------------------------
00459451   1/1  ----------------------------------------------------------------------
00525851   1/1  .Gftggpdpellrrwmqlgaflpffrnhs-----------------------------------------
00500041   1/1  .esgw-----------------------------------------------------------------
00459461   1/1  -----------------------------lglkdiaWlrpdGvemteedWsdpssralavllngeaige.
00481161   1/1  ----------------------------------------------------------------------
00465581   1/1  ----------------------------------------------------------------------
00519731   1/1  ----------------------------------------------------------------------
00517371   1/1  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           RMGRRIRDDSFLLLLNAGINDVQFTLPGPSYSAAWETVVDTADPEVAGRPYLPAGSDVTVIDRSFLVLKG
00459471   1/1  ----------------------------------------------------------------------
00381231   1/1  ----------------------------------------------------------------------
00392181   1/1  ----------------------------------------------------------------------
00474911   1/1  ----------------------------------------------------------------------
00469631   1/1  ----------------------------------------------------------------------
00461521   1/1  ----------------------------------------------------------------------
00461391   1/1  ----------------------------------------------------------------------
00463361   1/1  ----------------------------------------------------------------------
00507601   1/1  ----------------------------------------------------------------------
00469241   1/1  ----------------------------------------------------------------------
00361981   1/1  ----------------------------------------------------------------------
00444691   1/1  ----------------------------------------------------------------------
00464551   1/1  ----------------------------------------------------------------------
00475911   1/1  ----------------------------------------------------------------------
00460231   1/1  ----------------------------------------------------------------------
00494241   1/1  ----------------------------------------------------------------------
00422241   1/1  ----------------------------------------------------------------------
00519751   1/1  ----------------------------------------------------------------------
00407891   1/1  ----------------------------------------------------------------------
00465051   1/1  ----------------------------------------------------------------------
00462661   1/1  ----------------------------------------------------------------------
00481171   1/1  ----------------------------------------------------------------------
00514811   1/1  ----------------------------------------------------------------------
00475451   1/1  ----------------------------------------------------------------------
00498361   1/1  ----------------------------------------------------------------------
00465591   1/1  ----------------------------------------------------------------------
00407001   1/1  ----------------------------------------------------------------------
00489591   1/1  ----------------------------------------------------------------------
00469481   1/1  ----------------------------------------------------------------------
00517331   1/1  ----------------------------------------------------------------------
00529621   1/1  ----------------------------------------------------------------------
00529131   1/1  ----------------------------------------------------------------------
00472461   1/1  ----------------------------------------------------------------------
00471171   1/1  ----------------------------------------------------------------------
00485301   1/1  ----------------------------------------------------------------------
00458281   1/1  ----------------------------------------------------------------------
00523761   1/1  ----------------------------------------------------------------------
00482421   1/1  ----------------------------------------------------------------------
00472361   1/1  ----------------------------------------------------------------------
00491241   1/1  ----------------------------------------------------------------------
00442811   1/1  ----------------------------------------------------------------------
00459451   1/1  ----------------------------------------------------------------------
00525851   1/1  ----------------------------------------------------------------------
00500041   1/1  ----------------------------------------------------------------------
00459461   1/1  ........dddllllfNahdepveftLPalpgglkWllvldTalpspedfllealllelevllagstylv
00481161   1/1  ----------------------------------------------------------------------
00465581   1/1  ----------------------------------------------------------------------
00519731   1/1  ----------------------------------------------------------------------
00517371   1/1  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           VTKALPS---------------------------------------------------------------
00459471   1/1  ----------------------------------------------------------------------
00381231   1/1  ----------------------------------------------------------------------
00392181   1/1  ----------------------------------------------------------------------
00474911   1/1  ----------------------------------------------------------------------
00469631   1/1  ----------------------------------------------------------------------
00461521   1/1  ----------------------------------------------------------------------
00461391   1/1  ----------------------------------------------------------------------
00463361   1/1  ----------------------------------------------------------------------
00507601   1/1  ----------------------------------------------------------------------
00469241   1/1  ----------------------------------------------------------------------
00361981   1/1  ----------------------------------------------------------------------
00444691   1/1  ----------------------------------------------------------------------
00464551   1/1  ----------------------------------------------------------------------
00475911   1/1  ----------------------------------------------------------------------
00460231   1/1  ----------------------------------------------------------------------
00494241   1/1  ----------------------------------------------------------------------
00422241   1/1  ----------------------------------------------------------------------
00519751   1/1  ----------------------------------------------------------------------
00407891   1/1  ----------------------------------------------------------------------
00465051   1/1  ----------------------------------------------------------------------
00462661   1/1  ----------------------------------------------------------------------
00481171   1/1  ----------------------------------------------------------------------
00514811   1/1  ----------------------------------------------------------------------
00475451   1/1  ----------------------------------------------------------------------
00498361   1/1  ----------------------------------------------------------------------
00465591   1/1  ----------------------------------------------------------------------
00407001   1/1  ----------------------------------------------------------------------
00489591   1/1  ----------------------------------------------------------------------
00469481   1/1  ----------------------------------------------------------------------
00517331   1/1  ----------------------------------------------------------------------
00529621   1/1  ----------------------------------------------------------------------
00529131   1/1  ----------------------------------------------------------------------
00472461   1/1  ----------------------------------------------------------------------
00471171   1/1  ----------------------------------------------------------------------
00485301   1/1  ----------------------------------------------------------------------
00458281   1/1  ----------------------------------------------------------------------
00523761   1/1  ----------------------------------------------------------------------
00482421   1/1  ----------------------------------------------------------------------
00472361   1/1  ----------------------------------------------------------------------
00491241   1/1  ----------------------------------------------------------------------
00442811   1/1  ----------------------------------------------------------------------
00459451   1/1  ----------------------------------------------------------------------
00525851   1/1  ----------------------------------------------------------------------
00500041   1/1  ----------------------------------------------------------------------
00459461   1/1  ----------------------------------------------------------------------
00481161   1/1  ----------------------------------------------------------------------
00465581   1/1  ----------------------------------------------------------------------
00519731   1/1  ----------------------------------------------------------------------
00517371   1/1  ----------------------------------------------------------------------