[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ55977.1


[Show Plain Result]

## Summary of Sequence Search
   1::398
  61::370  6.5e-22 22.9% 0051516 00515161 1/1   side hydrolase/deacetylase              
  66::366  1.4e-09 24.1% 0052143 00521431 1/1   side hydrolase/deacetylase              
  52::365  2.3e-08 18.6% 0048464 00484641 1/1   side hydrolase/deacetylase              
  70::368  6.9e-07 21.2% 0052123 00521231 1/1   side hydrolase/deacetylase              
  54::363  7.2e-07 19.9% 0053151 00531511 1/1   side hydrolase/deacetylase              
  85::366  2.3e-05 21.1% 0047723 00477231 1/1   side hydrolase/deacetylase              
  57::370  0.00029 18.2% 0053130 00531301 1/1   side hydrolase/deacetylase              
   1::398


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGKISRRTFLSATALTALGTVGCSTTQAGTGPEAAPRRVRVIGDGSTSDTGPQPNQPTVDQLDRRSGPPQ
00515161   1/1  ------------------------------------------------------------dlprllygyg
00521431   1/1  -----------------------------------------------------------------atppk
00484641   1/1  ---------------------------------------------------vlsldelpdalyggplpkk
00521231   1/1  ---------------------------------------------------------------------k
00531511   1/1  -----------------------------------------------------sldelpdaliggplpkk
00477231   1/1  ----------------------------------------------------------------------
00531301   1/1  --------------------------------------------------------lpgglillgdtpkk


                         -         -         *         -         -         -         -:140
query           FVVVSWDGAGELSDRLFSRFREVARRNNAHMTFFLSGIYLLPEHRKHLYHPPKHPVGASDIGYLSEESIH
00515161   1/1  sdrpdllwPggarlavslvvdveegaellvllgdglsevflsdlpgalllgdlpdkvvaltfDdGp..rv
00521431   1/1  svaLtfDdgp...rdgtprlldllkkygvkaTffvvgsal.......ernp...................
00484641   1/1  vvaLTfDDgps..dnytprlldlLkkygvkaTfFvigsnaer............................
00521231   1/1  vvaLTfDdgpr..pegtprlldlLkkygvkaTfFvigsnaerh...........................
00531511   1/1  avaLTfDdgps..svytprlldlLkkygvkaTfFvvgsnier............................
00477231   1/1  --------------Mkklkvalvphshlpvgwlpttfddgvrrgydrlldllekypgikatffvsgslle
00531301   1/1  vvaLTFD...dgpspytprlldlLkeygvkaTfFvigsnagkgg........................de


                         +         -         -         -         -         *         -:210
query           RTIRQLDLAWREGHEIGTHFNGHFCGPNGVSTWSPADWESEIQQAIKFVMTWKTNTGFTDLPPLPFDYRK
00515161   1/1  gtprlldlLkkygikaTfFvvge.............................naernpelvreivaaGhe
00521431   1/1  ...ellralvaaGheigsHtysHpdl....stlspeelreelersrealeeltGv...............
00484641   1/1  .npellrrivaeGheignHtysHpnlt....tlspeelreelerskealeel...............tGv
00521231   1/1  .spellrrlvaaGheignHtysHpd....lttlspeelreelerakealekitG...............v
00531511   1/1  .npellkrivaeGheignHtysHpdl....ttlspeeireeiekskealeel...............tGv
00477231   1/1  wl......................eerypelveaikelveeGhlEiaghgysHpdlpll.......sped
00531301   1/1  lnpellkrivaeGheignHtysHpdlt....tlspeeireellrteealeeitg...............v


                         -         -         -         +         -         -         -:280
query           ELVGGRTPCLQGRDQLLPTAAKLGWRYDASSPGWLQVWPVRRHGLWDFPLQSLPMAGEDFEVLSMDYNIM
00515161   1/1  ignHtysHpdltk....lspeeireeiekaiealekit...............GkkpkgfrpPyg..spn
00521431   1/1  pprgfrpPygrysprtlellaelGyryvdssvdgddwpyps.............................
00484641   1/1  kplrlfrpPygsynprvlellkelGyky................vlwsvdgddwlrl.............
00521231   1/1  kprgfrpPygsyn....ellaelGyry.....................................vpwtvd
00531511   1/1  klprlfrpPygsyndrvlallkelGyky..............................vlwtvdtldwll
00477231   1/1  irrqilkgie.leelfG............vrprgfwlPdggyspelpdllaelGfkyfitdrldwndddk
00531301   1/1  pprlfrpPygsynprvlallaelGyry.....................................vlwsvd


                         -         *         -         -         -         -         +:350
query           VNQSKTPQGDRSKYGRWRAQARDTYLKGFERAYFSNRAPLFIGNHFQRWNGGIYMDAVEQFMDEIGGEPD
00515161   1/1  tldllaelGyflydwsvd............sddwPy.lpwlntgaggileipltlilngsiillhdgfvs
00521431   1/1  ..........................pdalldrvlrlrggliillhd...glpgtvealpelldylkak.
00484641   1/1  ......gllspeaildrvldald...............pgaiillHd...grpqtvealprlidylkek.
00521231   1/1  tddwllplspeaildrlldald...............ggliillHdlligrpqtvealerlleylkar.g
00531511   1/1  .....dglpsperildrvldald...............pgaiillHd...grpqtvealprlldylkak.
00477231   1/1  dpkalfrpwrgpdgseillvfprnlylsdligfrf.................................ae
00531301   1/1  tldwlip.........speaildrvldlldalllgrlkpgaiillHd.igrpttvealprlieylka.rg


                         -         -         -         -         *         -         -:420
query           VRMVSFRQLADWLDAQDPGVLTKLARLNVGQAPPGGWEEYLNSDAPLP----------------------
00515161   1/1  gddtlealpdlidylkeegy--------------------------------------------------
00521431   1/1  gyrfvtlsellgdpll------------------------------------------------------
00484641   1/1  gyefvtlselledpk-------------------------------------------------------
00521231   1/1  yrfvtlsellgdllallp----------------------------------------------------
00531511   1/1  gyrfvtlselleh---------------------------------------------------------
00477231   1/1  efldylkdlfdk...g------------------------------------------------------
00531301   1/1  yrfvtlselledpkanlplk--------------------------------------------------