[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ56010.1


[Show Plain Result]

## Summary of Sequence Search
   1::389
  19::231  3.5e-15 28.2% 0051946 00519461 1/1   omain-like                              
   1::389


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQGRSGDHGAVSPQTSFSDDTRVGVLPTASLSVVLRPIIDLDSGAVLAVEAVVPVDRRSGADVAVLTELL
00519461   1/1  ------------------eddLrralengelvlyyQPivdlrtgrvvgyEallRwrhpegglispdefip


                         -         -         *         -         -         -         -:140
query           GRVARETAARESFLPLVLPFPARLLTAGQEPLGFLRDTLQRSGRQPRDVTLMVDADLCFLPRDHLVAALA
00519461   1/1  laeetgliveldrwvleqalrqlaawgldlrlsvNlsarqlldpdfvegllllelleelglppsrlvlEi


                         +         -         -         -         -         *         -:210
query           RVREMGFRYAFDTARVSPDLLVETAPFLFRIEGSLTSGLPDQEQCAAIVDGMTRIARGAGTFPLASGVTS
00519461   1/1  tEsallddlelllellerlrelGvrialDdfgtgysslsylkrlpvdilKiDrsfvrdiltdpldlaivr


                         -         -         -         +         -         -         -:280
query           IAQLTALRTVGVRMAQGPLFAGDDWAPGDRVTQIPALSLEPLAPDSGAGLRVSEFMVPAVTMTVEATSEE
00519461   1/1  aiialakslglkvvaEgVEte-------------------------------------------------


                         -         *         -         -         -         -         +:350
query           VLEAFSADSALNSVILLDHRERPVAALDRARFLLSITGPYGHALYAKRPAQKLADPPRTVPLTAPALAAL
00519461   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           RIAGTDQDRVYDDLIAVNEFGQCRGVVHISDIIRGLSAR-------------------------------
00519461   1/1  ----------------------------------------------------------------------