[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ56050.1


[Show Plain Result]

## Summary of Sequence Search
   1::335
 154::315  4.7e-79 63.0% 0051902 00519021 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 154::315  8.7e-77 65.4% 0047176 00471761 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 154::315  4.8e-76 69.1% 0047635 00476351 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 154::315  1.8e-73 63.0% 0039315 00393151 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 154::315  3.5e-72 68.5% 0047085 00470851 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 154::315  1.3e-71 69.1% 0046978 00469781 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 153::314  1.3e-69 61.1% 0041771 00417711 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 153::314    2e-69 63.0% 0039896 00398961 1/1   raldehyde-3-phosphate dehydrogenase-lik 
   1::192  3.5e-64 55.3% 0047742 00477421 1/1   )-binding Rossmann-fold domains         
   3::175  1.4e-63 49.4% 0044691 00446911 1/1   )-binding Rossmann-fold domains         
   1::176  1.7e-63 60.1% 0051901 00519011 1/1   )-binding Rossmann-fold domains         
   3::171  2.9e-63 52.4% 0035945 00359451 1/1   )-binding Rossmann-fold domains         
   2::179  3.2e-58 49.4% 0038087 00380871 1/1   )-binding Rossmann-fold domains         
   2::174  1.6e-57 48.5% 0049820 00498201 1/1   )-binding Rossmann-fold domains         
   1::178  2.8e-57 46.1% 0038853 00388531 1/1   )-binding Rossmann-fold domains         
   2::176  1.1e-56 49.4% 0041770 00417701 1/1   )-binding Rossmann-fold domains         
   2::155  1.6e-56 58.9% 0035952 00359521 1/1   )-binding Rossmann-fold domains         
   2::171  3.1e-56 51.2% 0038022 00380221 1/1   )-binding Rossmann-fold domains         
   3::176  3.4e-55 47.9% 0036579 00365791 1/1   )-binding Rossmann-fold domains         
   2::171  1.2e-52 47.6% 0039650 00396501 1/1   )-binding Rossmann-fold domains         
   1::174  1.1e-50 45.3% 0045516 00455161 1/2   )-binding Rossmann-fold domains         
   3::173  2.2e-50 44.7% 0038547 00385471 1/1   )-binding Rossmann-fold domains         
 154::315  3.4e-49 40.7% 0038051 00380511 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 154::315  1.5e-47 38.3% 0035946 00359461 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 154::315  5.6e-47 43.8% 0036580 00365801 1/1   raldehyde-3-phosphate dehydrogenase-lik 
   3::174    7e-47 48.8% 0039314 00393141 1/2   )-binding Rossmann-fold domains         
 154::315  3.4e-45 46.9% 0038023 00380231 1/1   raldehyde-3-phosphate dehydrogenase-lik 
   2::175  3.2e-44 38.4% 0038050 00380501 1/1   )-binding Rossmann-fold domains         
 153::335  4.1e-44 38.3% 0052355 00523551 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 154::315  6.4e-44 41.4% 0045517 00455171 1/1   raldehyde-3-phosphate dehydrogenase-lik 
   1::198  1.3e-34 43.3% 0052415 00524151 1/1   )-binding Rossmann-fold domains         
 152::319  2.1e-34 33.9% 0041597 00415971 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 153::318  1.5e-32 34.4% 0040869 00408691 1/1   raldehyde-3-phosphate dehydrogenase-lik 
   3::170  3.5e-32 32.7% 0035316 00353161 1/1   )-binding Rossmann-fold domains         
 153::318  1.2e-29 26.5% 0035953 00359531 1/1   raldehyde-3-phosphate dehydrogenase-lik 
 154::273  1.4e-29 42.0% 0035390 00353901 1/1   raldehyde-3-phosphate dehydrogenase-lik 
   2::194  2.2e-29 35.6% 0045894 00458941 1/1   )-binding Rossmann-fold domains         
   3::194  1.9e-27 36.0% 0042207 00422071 1/1   )-binding Rossmann-fold domains         
 153::320  1.6e-22 24.2% 0053020 00530201 1/1   raldehyde-3-phosphate dehydrogenase-lik 
   1::179  1.7e-16 28.3% 0048454 00484541 1/1   )-binding Rossmann-fold domains         
   3::168  1.9e-14 22.9% 0040868 00408681 1/1   )-binding Rossmann-fold domains         
   2::125  8.5e-11 36.5% 0051575 00515751 1/1   )-binding Rossmann-fold domains         
   3::182  1.5e-10 23.2% 0052978 00529781 1/1   )-binding Rossmann-fold domains         
 153::268  1.2e-08 26.7% 0046003 00460031 1/1   raldehyde-3-phosphate dehydrogenase-lik 
   2::166  1.4e-08 23.6% 0041596 00415961 1/1   )-binding Rossmann-fold domains         
   2::125  4.5e-07 29.5% 0050914 00509141 1/1   )-binding Rossmann-fold domains         
   2::124  9.8e-07 33.7% 0050938 00509381 1/1   )-binding Rossmann-fold domains         
   1::170  1.1e-06 26.8% 0053019 00530191 1/1   )-binding Rossmann-fold domains         
   1::177  7.2e-05 19.5% 0047516 00475161 1/1   )-binding Rossmann-fold domains         
   2::115  0.00011 24.0% 0036892 00368921 1/1   )-binding Rossmann-fold domains         
   2::125   0.0005 33.3% 0051285 00512851 1/1   )-binding Rossmann-fold domains         
   2::125   0.0006 33.3% 0044044 00440441 1/1   )-binding Rossmann-fold domains         
   1::122  0.00076 32.7% 0036785 00367851 1/1   )-binding Rossmann-fold domains         
 310::335      1.6 34.6% 0045516 00455162 2/2   )-binding Rossmann-fold domains         
 303::335      8.4 27.3% 0039314 00393142 2/2   )-binding Rossmann-fold domains         
   1::335


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTIRVGVNGFGRIGRNFWRAVQAAGGSDVEIVAVNDLTDKATLAHLLKYDTVLGTLPGEVEVGEDSITVG
00519021   1/1  ----------------------------------------------------------------------
00471761   1/1  ----------------------------------------------------------------------
00476351   1/1  ----------------------------------------------------------------------
00393151   1/1  ----------------------------------------------------------------------
00470851   1/1  ----------------------------------------------------------------------
00469781   1/1  ----------------------------------------------------------------------
00417711   1/1  ----------------------------------------------------------------------
00398961   1/1  ----------------------------------------------------------------------
00477421   1/1  mtvkvainGFGriGrlvlrallergllgddlevvaindlsidletlayllkyDsvhgrfdgevevdleel
00446911   1/1  --vkvgingfGriGrlvlraale...gkvevvaindpidlnyavyllkydsthGkfkgtvkaengkLvin
00519011   1/1  m..kvainGfGriGrlvlrallerg..dlevvaindplidleylayllkyDsvhgrfdgevevdddllvv
00359451   1/1  --vkvgingFGriGrlvlraale...gkvevvaindlidlnylayllqydsthgkfngtvkaengklvin
00380871   1/1  -kvkvgingFGriGrlvlraaldrgledgkveivaindpfidlnyavyllkyDsthGkfkgtvkaengkl
00498201   1/1  -likvginGfGriGrlvlrallkqp..dieivavndllpdlealayllkydsvygalddkikfeddalvi
00388531   1/1  mmvkvginGFGriGrlvlraavaqdlgvvdveivaindpfidlnymvymlkydsthgkfkgtvkaengkl
00417701   1/1  -lvkvgingFGriGrlvlraalssgssgkvevvaindpidlnymvymlqydsthgkfngtvkaengklvi
00359521   1/1  -mvkvaInGFGrIGrlvlraalerd..dlevvaindllpdfeallavekgleldaetlayllkydsvhgr
00380221   1/1  -mvkvginGFGrIGrlvaraalaqd..dvevvaindfidleylayllkydsthgkfngtvkaengklvvn
00365791   1/1  --vkvginGFGriGrlvlraals...gkvevvaindpfidlnymvymlkydsthgkfngtvkaedgklvi
00396501   1/1  -mvkvginGfGriGrlvlraalesge.kvevvaindfidlnylvymlkydsthgkfkgtvkaedgklvin
00455161   1/2  mkvkvgiiGfGriGrlvaraalnsp..dvelvaindpfidlnymaymlkydsthgkfdgtvkaedgklvi
00385471   1/1  --vkvainGfGrIGrrvaraalaqddmevevvaindpidlaylaymlkydsthgkfngtvkaedgklvvn
00380511   1/1  ----------------------------------------------------------------------
00359461   1/1  ----------------------------------------------------------------------
00365801   1/1  ----------------------------------------------------------------------
00393141   1/2  --ikvginGfGriGrlvlraalasg..kvelvaindpfidlnymaymlkydsthgkfdgtikaedgklvi
00380231   1/1  ----------------------------------------------------------------------
00380501   1/1  -kikvgiiGaGriGrellrallas..pdvelvavadrddaaalaaalkydsthgkfdgtvkaedgklvvn
00523551   1/1  ----------------------------------------------------------------------
00455171   1/1  ----------------------------------------------------------------------
00524151   1/1  MkkikvgiiGfGriGrlvarallenk..dielvavndrnpd.............................
00415971   1/1  ----------------------------------------------------------------------
00408691   1/1  ----------------------------------------------------------------------
00353161   1/1  --GgshdrseaTaygvvagleealkllgldlkgktvaivGfGniGravarllle..algakvvavsdskg
00359531   1/1  ----------------------------------------------------------------------
00353901   1/1  ----------------------------------------------------------------------
00458941   1/1  -pirvaviGaGriGrrvaealaelp..dvelvavvdrspdaaalaallkyistlgrlgglvkaeelgvpv
00422071   1/1  --mkVgivGAtGrvGrllvrlllahp..gvevvavvsraeaaellkllgadvvvdatppdvlaelaea..
00530201   1/1  ----------------------------------------------------------------------
00484541   1/1  mmkklkvaiiGaGniGlalarallalag..gaevvavadrdpekaglalakelgatttvn..........
00408681   1/1  --mkvaivGatGmvGsvllelLleergfevval......................vrlsssrsagkalvf
00515751   1/1  -akklrvgiiGaGrigrgahlralaalp..gvlelvavadrdpekaealaeelgia..............
00529781   1/1  --glkvaivGatGlvGqellelLeehpfpeltllllasrssagkylefvgk...................
00460031   1/1  ----------------------------------------------------------------------
00415961   1/1  -klkvgivGatGmvGsvllnll..leendFevieivflass....................rsagkkllf
00509141   1/1  -nkkkrvaiiGaGriGsalaralleap..gfevvgvfdvdpekvgraiegl...................
00509381   1/1  -tlkvgiiGlGnigralhlrallklp..gvelv.vadrdperaeklakkl....................
00530191   1/1  kmmkvavtGAtGyiGralvrlLlerg...hpvvalvrlassasa..gkgvevvlg...........dltd
00475161   1/1  hgkkvgiiGlGniGkavakllk...gfgmevlaydrrpke..............................
00368921   1/1  -smkpikvaliGaGtvGsallellleqkeliglrlvavadskkallsedgldldlllellaeaa......
00512851   1/1  -kirvgiiGlgnigrahlrallklp..gvelvavvdrdpekaedfaeklgip..................
00440441   1/1  -plrigivGlGrigqkahlpalaalpg..velvavvdrdpekaealaell....................
00367851   1/1  kgkkvlviGaGgiGralaraLaeaGa.evt.vadrslekaealaael......................g
00455162   2/2  ----------------------------------------------------------------------
00393142   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           GTTMKALAQRDPAQLPWGDLGVDIVVESTGFFTKAEDAKKHLDAGAKKVIISAPAKGEDLTVVMGVNDDK
00519021   1/1  ----------------------------------------------------------------------
00471761   1/1  ----------------------------------------------------------------------
00476351   1/1  ----------------------------------------------------------------------
00393151   1/1  ----------------------------------------------------------------------
00470851   1/1  ----------------------------------------------------------------------
00469781   1/1  ----------------------------------------------------------------------
00417711   1/1  ----------------------------------------------------------------------
00398961   1/1  ----------------------------------------------------------------------
00477421   1/1  slaeddtlvvngkliklvlaerdpaelpwgelgvdlvlestGvfttrekasahlkaGakkViisaPakgd
00446911   1/1  gkaisilqekdPanipwgdagadyvvestgvfttlekagahLkgGakkviisapsadeaptfvmgvnhkt
00519011   1/1  ngklikvlserdpaelpwgelgvdlvlestGvfttlekasahlkagakkvlisaPskddaltiVlGvnde
00359451   1/1  gkpirvlqerdPanikwgdagvdyvvestGvfttlekagahLkggakkviisapsaddaptlvmGvnhek
00380871   1/1  ailkrgrlvingkaisilyaerdPanipWgdlgaeyvvestgvfttlekagahLkgGakkviisapsada
00498201   1/1  ngklidvlserdpedidwgklgvdlvleaTGkfttlenlllhlkggakkvivsapsad.iatvvlgvnde
00388531   1/1  vingkailivagtledlilaerdPanipwgdagadyvvestgvfttmekagahlkggakkviisapsada
00417701   1/1  ngkpikilqerdPanikwgdlgvdyvvestGvfttrekagahlkgGakrviisapsadavaptfvmgvnh
00359521   1/1  fkgtvedlleeddlvvdgkpikvlaerdpaylpwgelgvdlvvEstgvfttsekalleyelhlkagakkv
00380221   1/1  gklidilqerdPanikwgdlgadvvvesTgvftgrekaglhlkagakkviisapsadvaptfvagvNhee
00365791   1/1  ngkaisilaerdPanikwgdagaeyvlectGvfttaekagahlkGGakkviisapsad.aptfvmgvnhe
00396501   1/1  gkaikvvqerdPanikwgelgadyvvectgvfttlekagahlkgGakvViisapsagdaptfvmgvnhek
00455161   1/2  ngkaisvfaeqdPanilwgdagadavlectgvfttaelalahlkgGakhViiskpiad.dptfvmgvnhe
00385471   1/1  gklidllaerdPanikwgdlgadvvvectgvftgaekaglylkggakaviisaesadvaptsvmglnnee
00380511   1/1  ----------------------------------------------------------------------
00359461   1/1  ----------------------------------------------------------------------
00365801   1/1  ----------------------------------------------------------------------
00393141   1/2  ngkaisilaerdPanikwgdlgadyvvectgvfttlekagahlkGGakrviisapsad.aptfvmGvnhe
00380231   1/1  ----------------------------------------------------------------------
00380501   1/1  gkligvlvvtdpaelllgdegvDvvvdatppgahaenalaaleaGvkhvivekPlaadvvellvglnrea
00523551   1/1  ----------------------------------------------------------------------
00455171   1/1  ----------------------------------------------------------------------
00524151   1/1  ngkkigvlaeddpeel.lk..gvDvvvectggfdtakelalaalkag.kkVivsaPlkdap.tivlgvnh
00415971   1/1  ----------------------------------------------------------------------
00408691   1/1  ----------------------------------------------------------------------
00353161   1/1  alydpdgldleellallekydsvhgrfgaevvsldellev...eaDvlvpcatenlinaenlkllkakiv
00359531   1/1  ----------------------------------------------------------------------
00353901   1/1  ----------------------------------------------------------------------
00458941   1/1  ydd............leelledvDvvviatptdthaevakaaleaGvkhVlvekPlaeeaglklmvghnr
00422071   1/1  .................llkagvdaVilsaGfrlsdlllvellydaaggvkvv.................
00530201   1/1  ----------------------------------------------------------------------
00484541   1/1  ...........avddleelladp.gvDvvieatpagahaevalaaleag.khvvvekptaltveeavvpl
00408681   1/1  kgvellvvdlldlealk....gvDvvifaaggdvtlklapalaeagvkrvvidsssalrmdddvplvvpe
00515751   1/1  ..........kvyddleell.adpdiDaVviatpndlhaelalaaleaG.khvlv---------------
00529781   1/1  .......dlkvleldefdfs..dvdivffalgsevarelapkaaeaGvvvidnssafrldpdvPlvvpev
00460031   1/1  ----------------------------------------------------------------------
00415961   1/1  lgkellvlldaldidalsg...vDiiilclGgdvskevapklaeagwkgvvidaasalrmeddvplvlpe
00509141   1/1  ......pvlgvddleell..eggvdvvilavPaeaaqevadelleagvkvillpp---------------
00509381   1/1  .....gipkvyddleell..dpdiDaViiatpnslhaeialaaleag.khvlvE----------------
00530191   1/1  ldllaaala............gvdvvflaagagatlalaeaaaaagvkvidlssafraddvpyglpkvna
00475161   1/1  .....gavyvsldella...esDvvvlcapleaineealaalkkgailintsrgalvdeeallelleagk
00368921   1/1  ....aaelggvlltddvdelladpdidvvvdatgsaehaelylea-------------------------
00512851   1/1  ..k.gvkvyddleellkdp.diDaliiatpnglhaelakkaleag.khvlvEKPl---------------
00440441   1/1  .....gvpvydsldella...dvdaViiatptqlhaelalaaleag.khVlvEkP---------------
00367851   1/1  gveavelDvtdeasldaalgdaDvvinaapvglhaeiveaaleagkhvvden------------------
00455162   2/2  ----------------------------------------------------------------------
00393142   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           YDPANHHILSNASCTTNCVAPMAKTLMENFGIVKGLMTTVHAYTNDQVILDYPHKDLRRARAAAQNIIPT
00519021   1/1  -------------CTTnclapvlkvlhdafgieeglmttvhaytgdqklldgphgkakdlrrgraaalni
00471761   1/1  -------------CTTnclapvlkvLhdafgiekglmttvhaytgdqllldgphkdlrrgraaalniiPt
00476351   1/1  -------------CTTnclapvlkvlddafgieeglmttvhaytndqklldgphkdlrrgraaalniipt
00393151   1/1  -------------CTTnclapllkvlhdnfgieeglvttvhavtgsqktldgphgkdlrrgraaalniiP
00470851   1/1  -------------CTtnclaPlvkvllddnfgieeglmttvhaytndqklldgphgkdlrrgraaalnii
00469781   1/1  -------------CTTnclaPlvkvllddnfgieeglmttvhaytndqklldgphskdlrraraaalnii
00417711   1/1  ------------sCTTnclapllkvLhdafgieeglmttvhavtgdqklldgphkdlrrgraaalniiPt
00398961   1/1  ------------ScTTnclaPlakvllhdnfgiveglmttvhaytadqklvdgphgkdlrrgraaalnii
00477421   1/1  aptiVmGvndelydpsdlkivSnAs.............ddnfghshallvll------------------
00446911   1/1  ydnaelkiisnascttnalvplaavlpelygkldv-----------------------------------
00519011   1/1  lldpe.lkivsnAsc..n...........kfgieeg----------------------------------
00359451   1/1  ydnsklkivsnAscgelgttnalapllkvld---------------------------------------
00380871   1/1  aptfvmGvnhkkydnaelkivsnascttnalvplaadlv-------------------------------
00498201   1/1  elda.kldiisvasctttalapllklldkkygve------------------------------------
00388531   1/1  aptfvmgvnfeeykgaslgvvsvaSctttalvpllavl--------------------------------
00417701   1/1  ekldn.slkivsnascttnalap..kllhdsfglle----------------------------------
00359521   1/1  visaPekidaitavl-------------------------------------------------------
00380221   1/1  llgkd..ivsvasctttalaplllkvldeef---------------------------------------
00365791   1/1  kydns.lkvvsnascttnvlaplakvlakklevvda----------------------------------
00396501   1/1  ydsl.ltvvsnaslttnalservvpladlla---------------------------------------
00455161   1/2  kydnfl.kivsnaydtendlspraldladllavv------------------------------------
00385471   1/1  lal.glkivrvascnttalarllvvlkellgve-------------------------------------
00380511   1/1  -------------CttiqlvvalkplheefgleevlvttyqavsgagklldglskllvfgrpiaqnviPa
00359461   1/1  -------------CstiqlvvalkplldafglervlvstyqavsgaGklvdgpskllvkgrgiafniiPa
00365801   1/1  -------------CstiilvpalkplhdkfglkevlvttyqavsgagktldglsgkllvygrgiaqnviP
00393141   1/2  kydna.lkvvsnascntnalvpllvaLakllaie------------------------------------
00380231   1/1  -------------CstaqlvvalkplhdafglkevlvttyqavsgagktldglsgkllvfgrgiaqniiP
00380501   1/1  dkslgvvivpnfscgvnlllrllkelakvggigev-----------------------------------
00523551   1/1  ------------sCnTtglaralkpLhdafgiervllttrqa............dpkrfgrgianniiPs
00455171   1/1  -------------CttillvpalkplhdafglkrvlvttyqavsgaGktldglsgklgvfgrgiafnviP
00524151   1/1  ekldkelkivieaslsnpsftanvlvalaravlklleeg.llgaitvldiaplllslt------------
00415971   1/1  -----------PnCttillvvalkpLhdafgiervlvsTyqAvsGaGakgveelleqlgallngveleld
00408691   1/1  ------------NCttilllvalkpLhdafgiervlvsTyqAvsGaGakgveeLlsqlgallngveleld
00353161   1/1  veganlpttpeailinlerg..vlvipdal----------------------------------------
00359531   1/1  ------------nCstiqlvvaLkPlhdafgikrvvvstyqavsGagkfpgpiafnl......lpniipf
00353901   1/1  -------------CtTngLapllkvlndkfgieevlvttvrratdpqkvkkgpi......naivpnpiti
00458941   1/1  rfdpa..lklielviisrdplaplldylrrsggifpvldllihdidllrlllgm----------------
00422071   1/1  ........iaanascgvnllvplaklladafgi..........etldlellelh----------------
00530201   1/1  ------------ncttiqlvlaLkpLhdafgiervvvstyqavSgaGaegvdeLagqtaellngkplepe
00484541   1/1  ..velvelaeekgvvlgvgfgvrflppvvkalellasgy-------------------------------
00408681   1/1  vnreaikdalakgggiianpncttilll------------------------------------------
00515751   1/1  ----------------------------------------------------------------------
00529781   1/1  npehldll.gfivanPnctttalalalapLlelfgieevlvt----------------------------
00460031   1/1  ------------NCttilmvvaLkpLheafglervvvsTyqAvSGaGakgveelleqlgallngvesela
00415961   1/1  vnlevikdllarglkiianpnCttsl--------------------------------------------
00509141   1/1  ----------------------------------------------------------------------
00509381   1/1  ----------------------------------------------------------------------
00530191   1/1  ealllasglniiarpgcyttplvlalapll----------------------------------------
00475161   1/1  iagagldvlsgeplgld...plleldnviltphialg---------------------------------
00368921   1/1  ----------------------------------------------------------------------
00512851   1/1  ----------------------------------------------------------------------
00440441   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00455162   2/2  ----------------------------------------------------------------------
00393142   2/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           TTGAAKATALVLPELKGKLDGLAMRVPVPDGSVTDLVVTLEREVTKEEVNAAFKAAAEGALKDILVYTED
00519021   1/1  iPtstgaakavgkvlpelngkltglavrVPtpnvslvdltvelekevsveeinealkeasegplkgilgy
00471761   1/1  stgaakavgkvlpelkgkltgtavrVPtpnvslvdltvelekevtveevnealkeasegllkgilgytee
00476351   1/1  stgaakavgkvlPelkgkltglavrVPtpnvsvvdltvelekevtveevnaalkeasegplkgilgyted
00393151   1/1  tstgaakavgkvipelngkltgtavrVPtpnvsvvdltvelekpvtveeikealkeasegplkgilgyte
00470851   1/1  PtstgaakavgkvlPelkgkltglalrVPtpnvsvvdltvllekevtveevnealkeaaegplkgilgyt
00469781   1/1  PtstgaakavgkvlPelkgkltglalrVPtpnvsvvdltvllekevtveeinkalkeaaegplkgilgyt
00417711   1/1  stgaakavgkvlpelngkltgtavrVPtpnvsvvdltvelekeasveeinealkeasegplkgilgytee
00398961   1/1  PtsTgaakAvgkvlPelngkltgmafrvPtpnvsvvdltvllekaakyeeinkvlkeasegplkgilgyt
00477421   1/1  ----------------------------------------------------------------------
00446911   1/1  ----------------------------------------------------------------------
00519011   1/1  ----------------------------------------------------------------------
00359451   1/1  ----------------------------------------------------------------------
00380871   1/1  ----------------------------------------------------------------------
00498201   1/1  ----------------------------------------------------------------------
00388531   1/1  ----------------------------------------------------------------------
00417701   1/1  ----------------------------------------------------------------------
00359521   1/1  ----------------------------------------------------------------------
00380221   1/1  ----------------------------------------------------------------------
00365791   1/1  ----------------------------------------------------------------------
00396501   1/1  ----------------------------------------------------------------------
00455161   1/2  ----------------------------------------------------------------------
00385471   1/1  ----------------------------------------------------------------------
00380511   1/1  idkaakevgkilpelnlkltgtavrVPvlnvhvvdltvelekpakveeikevlkqasevplkgilgyged
00359461   1/1  idkaakevgkilpelnlkvtgtavrVPvlnvhvvdltvelekpasveeikevlkqasevvlkgilgyted
00365801   1/1  aitgaakevgkilpelngkltgtavrVPvlngsvvdltvelekpasydeikealkkasggplkgilgyte
00393141   1/2  ----------------------------------------------------------------------
00380231   1/1  aitgaakevgkvlpelnlkltgtavrVPvlnvhvvdltvelekpasyeeikkalkqasggplkdilgyte
00380501   1/1  ----------------------------------------------------------------------
00523551   1/1  itgashhggkvlpvldlklttmAvrVPttlvhvvdltvelekpataeevlealkna.....pgillided
00455171   1/1  hitgaakevgkvlpelnlkvtgtavrvPvlnghvvdltvelekpakydeikevlkkasgvplkdilgyte
00524151   1/1  ----------------------------------------------------------------------
00415971   1/1  dlasaildidqlvldllhsdllrarvfpvpiafnliPlidgllkdngytkEelkmvaEtrKilglpdldl
00408691   1/1  dllldildidlrvaraaalsiiptstfaaplafnviPlidvfldngytkeelkmvaEtrKilglldpdlk
00353161   1/1  ----------------------------------------------------------------------
00359531   1/1  idg...etkkilgvldlkvsatavrVPvllgHsesvlvelekkvsveeilevlkkapgvvllddlelply
00353901   1/1  pshhgkdvkkvlpdlk..vtatavrVPvtlvhveslnvelekevsaeevkealkeapgivlid-------
00458941   1/1  ----------------------------------------------------------------------
00422071   1/1  ----------------------------------------------------------------------
00530201   1/1  vfprplafnviPlidvflengytkeElklvaetrkilgdldlkvsatcvrvPvfrghsesvtvelekdvd
00484541   1/1  ----------------------------------------------------------------------
00408681   1/1  ----------------------------------------------------------------------
00515751   1/1  ----------------------------------------------------------------------
00529781   1/1  ----------------------------------------------------------------------
00460031   1/1  dpasaildidrkvlellrleeleldvfpvplafnviPlidvfldngytkEElklvnEt------------
00415961   1/1  ----------------------------------------------------------------------
00509141   1/1  ----------------------------------------------------------------------
00509381   1/1  ----------------------------------------------------------------------
00530191   1/1  ----------------------------------------------------------------------
00475161   1/1  ----------------------------------------------------------------------
00368921   1/1  ----------------------------------------------------------------------
00512851   1/1  ----------------------------------------------------------------------
00440441   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00455162   2/2  ----------------------------------------------------------------------
00393142   2/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           PIVSSDIVGTPASCTFDASLTMAFGTQVKVVGWYDNEWGYSNRLVDLVKLVGSNL---------------
00519021   1/1  teeplvsvdfigddlssifdalativlgdnlvkll-----------------------------------
00471761   1/1  plvsvdfigdphssifdalativlgdnlvkllawy-----------------------------------
00476351   1/1  plvssdfvgdphssifdalativlgdnlvkllaWy-----------------------------------
00393151   1/1  dplvssdfvgrprssifdalativlgdnlvklaaw-----------------------------------
00470851   1/1  edplvssdfigdphssivdatativleladggnlv-----------------------------------
00469781   1/1  edplvSsDfigdphssifdatativleldengnlv-----------------------------------
00417711   1/1  dlvsvdfigddlssifdagltivldnlvklaawy------------------------------------
00398961   1/1  edplVssdfngdshssifdagatlvlgialndnl------------------------------------
00477421   1/1  ----------------------------------------------------------------------
00446911   1/1  ----------------------------------------------------------------------
00519011   1/1  ----------------------------------------------------------------------
00359451   1/1  ----------------------------------------------------------------------
00380871   1/1  ----------------------------------------------------------------------
00498201   1/1  ----------------------------------------------------------------------
00388531   1/1  ----------------------------------------------------------------------
00417701   1/1  ----------------------------------------------------------------------
00359521   1/1  ----------------------------------------------------------------------
00380221   1/1  ----------------------------------------------------------------------
00365791   1/1  ----------------------------------------------------------------------
00396501   1/1  ----------------------------------------------------------------------
00455161   1/2  ----------------------------------------------------------------------
00385471   1/1  ----------------------------------------------------------------------
00380511   1/1  evvvgdirsdslssifdalalivlgdnlvkgaaln-----------------------------------
00359461   1/1  dvvsvgrirddlssifdaglvilsdnlvkgaalnd-----------------------------------
00365801   1/1  devvsgdfrsdsyssifdalalialndnlvklaal-----------------------------------
00393141   1/2  ----------------------------------------------------------------------
00380231   1/1  dpvvssdfvgrirssifdalalialsdnlvKlaaw-----------------------------------
00380501   1/1  ----------------------------------------------------------------------
00523551   1/1  e....dltstaelgefdvdvgrirndlvelvvwgdslwvvgdnlrklaalnaesi---------------
00455171   1/1  devvsgrirsdslssifdalalivlndnlvklaal-----------------------------------
00524151   1/1  ----------------------------------------------------------------------
00415971   1/1  kvdatcvRvPvlrghsealtvelkkdvsveeirellkea-------------------------------
00408691   1/1  vsatcvRvPvlrghsealtvelekdvsleeirellkea--------------------------------
00353161   1/1  ----------------------------------------------------------------------
00359531   1/1  pkpllavged..vgrirpdldrdagldeglwvvadnlr--------------------------------
00353901   1/1  ----------------------------------------------------------------------
00458941   1/1  ----------------------------------------------------------------------
00422071   1/1  ----------------------------------------------------------------------
00530201   1/1  veevrelladapgvvvlddp...llpptpldavgkdevlv------------------------------
00484541   1/1  ----------------------------------------------------------------------
00408681   1/1  ----------------------------------------------------------------------
00515751   1/1  ----------------------------------------------------------------------
00529781   1/1  ----------------------------------------------------------------------
00460031   1/1  ----------------------------------------------------------------------
00415961   1/1  ----------------------------------------------------------------------
00509141   1/1  ----------------------------------------------------------------------
00509381   1/1  ----------------------------------------------------------------------
00530191   1/1  ----------------------------------------------------------------------
00475161   1/1  ----------------------------------------------------------------------
00368921   1/1  ----------------------------------------------------------------------
00512851   1/1  ----------------------------------------------------------------------
00440441   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00455162   2/2  -----------------------------vsnaydtendlspraldladllavvd---------------
00393142   2/2  ----------------------kydnalkvvsnascntnalvpllvaLakllaie---------------