[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ56054.1


[Show Plain Result]

## Summary of Sequence Search
   1::656
 522::639  4.5e-27 37.3% 0036422 00364221 1/1   domain 2-like                           
  16::101  2.1e-23 38.4% 0040970 00409701 1/1   IG endonuclease                         
 560::653  6.9e-21 50.6% 0051452 00514521 1/1   domain 2-like                           
 568::639  1.1e-20 48.6% 0051684 00516841 1/1   domain 2-like                           
 574::639  3.4e-17 50.0% 0051966 00519661 1/1   domain 2-like                           
 577::639  5.5e-15 47.6% 0050778 00507781 1/1   domain 2-like                           
 585::640  1.4e-13 51.8% 0047794 00477941 1/1   domain 2-like                           
 583::638  2.4e-13 49.1% 0052275 00522751 1/1   domain 2-like                           
 193::248  1.3e-12 41.1% 0036773 00367731 1/1   minal UvrC-binding domain of UvrB       
 588::640  4.3e-10 41.5% 0049536 00495361 1/1    N-terminal domain-like                 
 578::638  7.4e-07 27.9% 0036157 00361571 1/1   domain 2-like                           
 577::646  1.3e-05 27.1% 0039263 00392631 1/1   domain 2-like                           
 586::645  1.9e-05 30.0% 0048851 00488511 1/1    N-terminal domain-like                 
 578::645  0.00011 23.5% 0035731 00357311 1/1   domain 2-like                           
 577::645  0.00024 23.2% 0045865 00458651 1/1    N-terminal domain-like                 
   1::656


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTVRPTLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWT
00364221   1/1  ----------------------------------------------------------------------
00409701   1/1  ---------------nkpgvYlitnkangklYvGkakdLkkRlssyfnglgagftktrllvrailkygen
00514521   1/1  ----------------------------------------------------------------------
00516841   1/1  ----------------------------------------------------------------------
00519661   1/1  ----------------------------------------------------------------------
00507781   1/1  ----------------------------------------------------------------------
00477941   1/1  ----------------------------------------------------------------------
00522751   1/1  ----------------------------------------------------------------------
00367731   1/1  ----------------------------------------------------------------------
00495361   1/1  ----------------------------------------------------------------------
00361571   1/1  ----------------------------------------------------------------------
00392631   1/1  ----------------------------------------------------------------------
00488511   1/1  ----------------------------------------------------------------------
00357311   1/1  ----------------------------------------------------------------------
00458651   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VVNTEVEALQLEYSWIKEYSPRFNVRYRDDKSYPYLAVTLNEEFPRVQVMRGARRRGVRYFGPYSYAWAI
00364221   1/1  ----------------------------------------------------------------------
00409701   1/1  fvllileevtdselealllEnylikllrpri---------------------------------------
00514521   1/1  ----------------------------------------------------------------------
00516841   1/1  ----------------------------------------------------------------------
00519661   1/1  ----------------------------------------------------------------------
00507781   1/1  ----------------------------------------------------------------------
00477941   1/1  ----------------------------------------------------------------------
00522751   1/1  ----------------------------------------------------------------------
00367731   1/1  ----------------------------------------------------------------------
00495361   1/1  ----------------------------------------------------------------------
00361571   1/1  ----------------------------------------------------------------------
00392631   1/1  ----------------------------------------------------------------------
00488511   1/1  ----------------------------------------------------------------------
00357311   1/1  ----------------------------------------------------------------------
00458651   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           RDTVDLLLRVFPVRTCSAGVFKRARSSGRPCLLGYIDKCSAPCVGRIGVEEYRALAEDFCAFMAGETGRF
00364221   1/1  ----------------------------------------------------------------------
00409701   1/1  ----------------------------------------------------------------------
00514521   1/1  ----------------------------------------------------------------------
00516841   1/1  ----------------------------------------------------------------------
00519661   1/1  ----------------------------------------------------------------------
00507781   1/1  ----------------------------------------------------------------------
00477941   1/1  ----------------------------------------------------------------------
00522751   1/1  ----------------------------------------------------------------------
00367731   1/1  ----------------------------------------------------lelveevalllkgeleel
00495361   1/1  ----------------------------------------------------------------------
00361571   1/1  ----------------------------------------------------------------------
00392631   1/1  ----------------------------------------------------------------------
00488511   1/1  ----------------------------------------------------------------------
00357311   1/1  ----------------------------------------------------------------------
00458651   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           LRQLEAEMKQAAAAQEYERAARIRDDIQALRTVMEKQAVVLGDSTDCDVIAIAEDQLEAAVQVFYVRGGR
00364221   1/1  ----------------------------------------------------------------------
00409701   1/1  ----------------------------------------------------------------------
00514521   1/1  ----------------------------------------------------------------------
00516841   1/1  ----------------------------------------------------------------------
00519661   1/1  ----------------------------------------------------------------------
00507781   1/1  ----------------------------------------------------------------------
00477941   1/1  ----------------------------------------------------------------------
00522751   1/1  ----------------------------------------------------------------------
00367731   1/1  ikeLekemleaAeeleFEeAarlRdqilaLkkllekqk--------------------------------
00495361   1/1  ----------------------------------------------------------------------
00361571   1/1  ----------------------------------------------------------------------
00392631   1/1  ----------------------------------------------------------------------
00488511   1/1  ----------------------------------------------------------------------
00357311   1/1  ----------------------------------------------------------------------
00458651   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           IRGERGWVVDKVEDVSTGKLVEQFLAQTYGGADDEESTTAIPREVLVSAEPADRDAVVAWLSKRRGAAVD
00364221   1/1  ----------------------------------------------------------------------
00409701   1/1  ----------------------------------------------------------------------
00514521   1/1  ----------------------------------------------------------------------
00516841   1/1  ----------------------------------------------------------------------
00519661   1/1  ----------------------------------------------------------------------
00507781   1/1  ----------------------------------------------------------------------
00477941   1/1  ----------------------------------------------------------------------
00522751   1/1  ----------------------------------------------------------------------
00367731   1/1  ----------------------------------------------------------------------
00495361   1/1  ----------------------------------------------------------------------
00361571   1/1  ----------------------------------------------------------------------
00392631   1/1  ----------------------------------------------------------------------
00488511   1/1  ----------------------------------------------------------------------
00357311   1/1  ----------------------------------------------------------------------
00458651   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           VRVPQRGDKRALMETVLKNAEQTLARHKSQRASDLTTRSKALAEIAEALGLAEAPLRIECFDISTLQGEH
00364221   1/1  ----------------------------------------------------------------------
00409701   1/1  ----------------------------------------------------------------------
00514521   1/1  ----------------------------------------------------------------------
00516841   1/1  ----------------------------------------------------------------------
00519661   1/1  ----------------------------------------------------------------------
00507781   1/1  ----------------------------------------------------------------------
00477941   1/1  ----------------------------------------------------------------------
00522751   1/1  ----------------------------------------------------------------------
00367731   1/1  ----------------------------------------------------------------------
00495361   1/1  ----------------------------------------------------------------------
00361571   1/1  ----------------------------------------------------------------------
00392631   1/1  ----------------------------------------------------------------------
00488511   1/1  ----------------------------------------------------------------------
00357311   1/1  ----------------------------------------------------------------------
00458651   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           TVASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAE
00364221   1/1  ----------------------------------------------------------------------
00409701   1/1  ----------------------------------------------------------------------
00514521   1/1  ----------------------------------------------------------------------
00516841   1/1  ----------------------------------------------------------------------
00519661   1/1  ----------------------------------------------------------------------
00507781   1/1  ----------------------------------------------------------------------
00477941   1/1  ----------------------------------------------------------------------
00522751   1/1  ----------------------------------------------------------------------
00367731   1/1  ----------------------------------------------------------------------
00495361   1/1  ----------------------------------------------------------------------
00361571   1/1  ----------------------------------------------------------------------
00392631   1/1  ----------------------------------------------------------------------
00488511   1/1  ----------------------------------------------------------------------
00357311   1/1  ----------------------------------------------------------------------
00458651   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           RKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDPIILPRTSEGLYLL
00364221   1/1  -------------------------------vfPtlcPvcgselvrgevalrclnllcpaqllerlihfv
00409701   1/1  ----------------------------------------------------------------------
00514521   1/1  ---------------------------------------------------------------------l
00516841   1/1  ----------------------------------------------------------------------
00519661   1/1  ----------------------------------------------------------------------
00507781   1/1  ----------------------------------------------------------------------
00477941   1/1  ----------------------------------------------------------------------
00522751   1/1  ----------------------------------------------------------------------
00367731   1/1  ----------------------------------------------------------------------
00495361   1/1  ----------------------------------------------------------------------
00361571   1/1  ----------------------------------------------------------------------
00392631   1/1  ----------------------------------------------------------------------
00488511   1/1  ----------------------------------------------------------------------
00357311   1/1  ----------------------------------------------------------------------
00458651   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           QRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERT
00364221   1/1  srdaldieglgeklieqLvllglirdeadlfaltlerllrlkglgeksadnlleaiekskeislerllfa
00409701   1/1  ----------------------------------------------------------------------
00514521   1/1  qrlrdeahrfnitahr..........lllsiPgvgpknakaLlkhfgsleelanasleeLaevlg.geel
00516841   1/1  -------hrlaiighrklrllerllsaLtgipgvgpvlakaLlehfgsleallaasleeLaevpgiGpkk
00519661   1/1  -------------ihrskrskllllllllgipgvGpktakaLlehFgslealleasleeLaevpgigekl
00507781   1/1  ----------------skrtklarlllllgipgvGpktakaLlkhfgslealleasleeLaevegigekl
00477941   1/1  ------------------------lllllgipgvGpkraklLlkhfgslealleAsveeLaevpgigekl
00522751   1/1  ----------------------allslLdeipGigpkrrkkLlkhfgslkkvkeasveel.kveGisekl
00367731   1/1  ----------------------------------------------------------------------
00495361   1/1  ---------------------------LldipgvgeklakkLleaGfgsledlayasveeLleiegigee
00361571   1/1  -----------------tleerelfelLlsvsgiGpklAlailsvlgleelleaiaegdleaLlkvpgiG
00392631   1/1  ----------------ltleerelfllLlsvsGvGpklAlallsalgleelleaiangdiaaLskvpgiG
00488511   1/1  -------------------------idllelpgvgealakkLleaGfltvedlayasveeLleieglsee
00357311   1/1  -----------------tleerelfllLlsvsgvGpklAlailsvldleelleaiangdlkaLlkvpgiG
00458651   1/1  ----------------eeeelaellldllellgvgealakkLaeaGfttvedlayasvdeLleikglsee


                         -         +         -         -         -         -         *:700
query           AQTIYERLTSVEGGQRTQPENSKADE--------------------------------------------
00364221   1/1  lgIpgvGek-------------------------------------------------------------
00409701   1/1  ----------------------------------------------------------------------
00514521   1/1  Akkiyeflhkelleelieelket-----------------------------------------------
00516841   1/1  aesikdfle-------------------------------------------------------------
00519661   1/1  aesiveffs-------------------------------------------------------------
00507781   1/1  aesiveffs-------------------------------------------------------------
00477941   1/1  Aesileflse------------------------------------------------------------
00522751   1/1  aeeiydll--------------------------------------------------------------
00367731   1/1  ----------------------------------------------------------------------
00495361   1/1  laeklieaar------------------------------------------------------------
00361571   1/1  kktaeriv--------------------------------------------------------------
00392631   1/1  kktaerivlelkdkla------------------------------------------------------
00488511   1/1  kaekiieaarkllpl-------------------------------------------------------
00357311   1/1  kktaerivlelkdkl-------------------------------------------------------
00458651   1/1  kaeklieaarkllpl-------------------------------------------------------