[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ56082.1


[Show Plain Result]

## Summary of Sequence Search
   1::140
   1::129  2.5e-34 43.8% 0047508 00475081 1/1   lock/LC7 domain                         
   2::122  6.3e-25 34.2% 0050164 00501641 1/1   lock/LC7 domain                         
   5::128    4e-06 17.2% 0050163 00501631 1/1   lock/LC7 domain                         
   1::140


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSNASENLNWLLDDLVDRVVGADHAIVLSADGLLIGRSRGLTDEEGEHLSAVASAFQSLARGTSRQFKGG
00475081   1/1  lvlteeelekldwlLddll.rvpgvraallvsrdGlliassgdlllpsdldaellaAlaAgllslaegaa
00501641   1/1  -mlkakaldsvLsqll..vpgveaalllsadGlllass.glgdvdaevlAAlaagllslaerlanlllge
00501631   1/1  ----vdelkdvLekllkkvdGvlaivvtdrdGvpiasvaeddapelalrasllatfa.laleqlskLglg


                         -         -         *         -         -         -         -:140
query           RVLQTVVEMEHAYLFVTAAGEGACMAVLAAEDADVGMIAYEMNSRIKRVGQFLTSAPRHPEAAGRVSTGS
00475081   1/1  kllgegelrqllvegegglllltaagegalLvvladedadlGlvrlemrraaeelgell-----------
00501641   1/1  geleqvlieledgkilitpvg.dalLavladeevnlGllrlearelverlgd------------------
00501631   1/1  klksiivvyesyqivllnls.dlvltviassnanlglilallkklkeilselksavee------------