[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ56085.1


[Show Plain Result]

## Summary of Sequence Search
   1::399
 173::396  5.5e-86 51.3% 0040190 00401901 1/1   inosuccinate synthetase, C-terminal dom 
 171::400  1.3e-83 50.9% 0044855 00448551 1/1   inosuccinate synthetase, C-terminal dom 
 173::394  2.7e-81 51.8% 0039978 00399781 1/1   inosuccinate synthetase, C-terminal dom 
   3::172  1.5e-46 42.0% 0039977 00399771 1/1   ne nucleotide alpha hydrolases-like     
   2::166  3.1e-46 44.8% 0050233 00502331 1/1   ne nucleotide alpha hydrolases-like     
   3::166  5.8e-45 44.8% 0047848 00478481 1/1   ne nucleotide alpha hydrolases-like     
   1::195  2.3e-34 34.3% 0043381 00433811 1/1   ne nucleotide alpha hydrolases-like     
   3::218  2.6e-27 30.9% 0048369 00483691 1/1   ne nucleotide alpha hydrolases-like     
   3::174    7e-24 30.4% 0047035 00470351 1/1   ne nucleotide alpha hydrolases-like     
   1::174    1e-23 31.4% 0051038 00510381 1/1   ne nucleotide alpha hydrolases-like     
   3::193  3.2e-22 33.0% 0046213 00462131 1/1   ne nucleotide alpha hydrolases-like     
   3::229  6.2e-20 23.9% 0048858 00488581 1/1   ne nucleotide alpha hydrolases-like     
   1::204  8.9e-17 28.2% 0052117 00521171 1/1   ne nucleotide alpha hydrolases-like     
   3::175  1.1e-16 32.5% 0049476 00494761 1/1   ne nucleotide alpha hydrolases-like     
   3::177  4.6e-15 32.7% 0050746 00507461 1/1   ne nucleotide alpha hydrolases-like     
   1::195  6.9e-10 26.5% 0052363 00523631 1/1   ne nucleotide alpha hydrolases-like     
   1::164  6.2e-07 24.4% 0050128 00501281 1/1   ne nucleotide alpha hydrolases-like     
   1::173  0.00011 25.2% 0045391 00453911 1/1   ne nucleotide alpha hydrolases-like     
   1::399


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTERVVLAYSGGLDTSVAIGWIAEETGAEVIAVAIDCGQGGEDMEVIRQRALACGAVEAVIADAKEEFAN
00401901   1/1  ----------------------------------------------------------------------
00448551   1/1  ----------------------------------------------------------------------
00399781   1/1  ----------------------------------------------------------------------
00399771   1/1  --iavlrrlmsgkkvvvalSGGlDSsvllallkel.gyeviavtvdlgqrhsedleaarevaeklgikeh
00502331   1/1  -kkkvvvalSGGlDSsvalallkea.gyeviavtvdlgqre.dleaarevakklgivplyvvdlseefae
00478481   1/1  --kkvvvalSGGlDSsvllallkealgyeviavtvdygq.reeleaarelakklgikphivvdldeefls
00433811   1/1  lkkkvvvlySGGkDSslaLywllkk.gyeVvalltlvg.....................seldsymfhtv
00483691   1/1  --eeaiklfrllkkgdkvlvalSGGkDStvllhlllelarrllgfevvavhvdhglrgesdeelefvrel
00470351   1/1  --eellerlveairdylllvgdkkvvvglSGGvDSsvlaallkkalgyevlavtvdtgllrseeeledae
00510381   1/1  idleelieelvellrdyvlkrggkkvvvalSGGvDSsvllallakalglevlavtvdtglrseeeledar
00462131   1/1  --rrywdlpfvpdleellealvellrdavrkrlvgdkkvvvalSGGlDSsvlaallkeaggaegllfmkn
00488581   1/1  --rrYwdlpfldleeavealrellrdavrkrlvsdvpvgvlLSGGlDSslvaalaaralg.nvlaftvgf
00521171   1/1  lgggkkvvvllSGGvDSsvaaallkka.gyeviavhfdyglrtdelcvseeeledakklaeklg.ipliv
00494761   1/1  --skltldallllpalllalcleklnelledlvaeeilrealeefgdkvvvalSGGkDSsvllhlllka.
00507461   1/1  --ekllkkllkkvekaikdykllvggdkvlvalSGGvDSsvllallkkllkrlpgyelvavhvdhglrge
00523631   1/1  lklmkvvvlfSGGkDStlalylale.lghevvalltllpeeldsymfhtvnlelaklqAealg.lplivi
00501281   1/1  gtsgkvlvllSGGiDSpvaayllmkr.Gvevialhfdlgpltl..eealevvklllkll...........
00453911   1/1  vlknpildillvkldfdleeiiealveflrdyllksgakkvvlglSGGvDStvaaalakkalgrlplell


                         -         -         *         -         -         -         -:140
query           DYCVPAIQANALYMDRYPLVSALSRPLIVKHLAEAARYHGATMVAHGCTGKGNDQVRFEAGLAALFPELK
00401901   1/1  ----------------------------------------------------------------------
00448551   1/1  ----------------------------------------------------------------------
00399781   1/1  ----------------------------------------------------------------------
00399771   1/1  hvvdvdlefvedvvltlideykagatpegdypltcalarnliflllaelaeelgadviatGhtlkgadel
00502331   1/1  evldpalkayalgegpypltvvlarnlifkalleiakelgadaiatGhtlddndevrfelyflallpglk
00478481   1/1  elvdpaipagalyegnypltcvlcrnlifklllevaeelgadavatGhtaddlddvrferlflallpelg
00433811   1/1  nlelaelqaealglplyllstslarelevedlvellkelgadavvfGailsgyqrvrvelvaerl..glk
00483691   1/1  aeklgi.plivvdldelf.................kglnpcalarrlryaallevar..gadalatGhhl
00470351   1/1  klaeklg.iplivvdideeflealaelf........gptpnpcnlcnrlrlelllelakelgadvlatGt
00510381   1/1  elaeklg.iplhvvdidelf..dalldllgag.....dtpnpcnicrrlrlrllyelakelgadvl...l
00462131   1/1  wdlddevlavtvdygq.sdeledarevaeklGi.phhvvdideeevldalkdvidagetpn.....pcvl
00488581   1/1  gq.sdeleyarevaehlgi.ehhvvdideeelldalpdvlaaldtp.epvnlrsrirlylla....rlar
00521171   1/1  vdldeifleilkk..........getpnpcvlcrrirlrillelaeelgadviatGhnaddvadqtllnl
00494761   1/1  glevlavhvdtgllfpetlefaeelaerlg.iplivvdldeefaeflall....gglsegdppnpcalcr
00507461   1/1  sdeelefvrelaeklgi.plivvdvdelf.............laagngpnpcalcrrlrygallelakel
00523631   1/1  eisg...........................eyedevedllellkelgveavvtGdilsdyqrlrvegvc
00501281   1/1  .................ekylcilckrlmlriaeklalklgadaivtGeslgqvasqtlenlllidalnl
00453911   1/1  gdellavtvdhglss.deedalelakklgidhelvidivdavdaflaal......egvtgpepkdktign


                         +         -         -         -         -         *         -:210
query           VLAPVRDSGMTRDKAIAFAEEKGLPIDVTKKSPYSIDQNLFGRAVETGFLEDIWNGPIEDIYDYTQNPAE
00401901   1/1  --------------------------------pysiDenllgisieagiledpsleppedvylltvdpee
00448551   1/1  ------------------------------ekpysiDenllgisieagiledpsveppedvylltvdped
00399781   1/1  --------------------------------pySiDenllgisieagiledpdleppedaylltvspwe
00399771   1/1  rfgylrlallpglelraplldllfPllglska--------------------------------------
00502331   1/1  iiaPlldlgllellrskeeirelake--------------------------------------------
00478481   1/1  viaplrpllglskaeirelakelglp--------------------------------------------
00433811   1/1  vlapl..wgrdreellremielgfeaiivkvaaygLdenllGrsleaelledlla---------------
00483691   1/1  ..dDqaetvllnllrgsglkglagikelaldgglrlirPLle..lskeeirayakelglpyie.dpsnyd
00470351   1/1  gaddeietgyltllgddgikdlsyvlglpeelll------------------------------------
00510381   1/1  tG.hadelfegylllrg.dglkgirPll..dlsk------------------------------------
00462131   1/1  crrlrlyllyelarelgadvvl...tGhgaDelfg..Gytkygdllkglaplg-----------------
00488581   1/1  k.gakvvltGegaDelfgGyptyrpdplarlllldlltlllgvlllrvdrmsmahglevrvPfldhrlve
00521171   1/1  yalnallglkilrPL..lgldKeeirelakelglpe.iskypsggcgscflprnpftkallell------
00494761   1/1  rlklepllraakelgadaiatGh..rrddsaeral-----------------------------------
00507461   1/1  gadvlatGhha..dDqaetvllnllrgsglkglqgil---------------------------------
00523631   1/1  arlg..lkvlaPL..wgldqeellrelielgleaiivkvaalgldeellGrelda---------------
00501281   1/1  pvlrPL..igldkeeiielareig----------------------------------------------
00453911   1/1  iqarlrmvalyalanklgalvlgtg......dv-------------------------------------


                         -         -         -         +         -         -         -:280
query           PREPDEVVITFTAGVPTALDGKELSPLEIIQELNRRAGAQGVGRIDMVEDRLVGIKSREVYEAPGAITLI
00401901   1/1  apdepelveieFekGvpvalngeklsplelllelneiagkhGvGridivenrlvglKsrgvYeaPgatvl
00448551   1/1  apdepelveieFekGvpvalngekdgktllsplelllelneiagkhGvGridivenrlvglKsrevYetP
00399781   1/1  edapdepelveieFekGvPvalngeeledplelllelneiagkhGvGridivenrlvglKsRgvYeaPga
00399771   1/1  ----------------------------------------------------------------------
00502331   1/1  ----------------------------------------------------------------------
00478481   1/1  ----------------------------------------------------------------------
00433811   1/1  ----------------------------------------------------------------------
00483691   1/1  ldfrrnri--------------------------------------------------------------
00470351   1/1  ----------------------------------------------------------------------
00510381   1/1  ----------------------------------------------------------------------
00462131   1/1  ----------------------------------------------------------------------
00488581   1/1  falslppelkpiggltKtl---------------------------------------------------
00521171   1/1  ----------------------------------------------------------------------
00494761   1/1  ----------------------------------------------------------------------
00507461   1/1  ----------------------------------------------------------------------
00523631   1/1  ----------------------------------------------------------------------
00501281   1/1  ----------------------------------------------------------------------
00453911   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           TAHQELENVTVERELARFKRWVDQRWGELVYDGLWFSPLKNALDKFILEANKHVTGDIRMVLHGGRAVVT
00401901   1/1  llAhrdlesltldrevlklkdlldlkyaelvYnGlwfsPlrealeafidksqervtGevrlklykGnviv
00448551   1/1  gatvLllAhrdLesltldrevlklkdllelkyaelvynGlwfsPlrealdafidssqervtGevrlklyk
00399781   1/1  tvLlaAhrdLesltldrevlrlkdlldlkyaelvYnGlwfsPlrealeafidewtqelvtGevrlklykG
00399771   1/1  ----------------------------------------------------------------------
00502331   1/1  ----------------------------------------------------------------------
00478481   1/1  ----------------------------------------------------------------------
00433811   1/1  ----------------------------------------------------------------------
00483691   1/1  ----------------------------------------------------------------------
00470351   1/1  ----------------------------------------------------------------------
00510381   1/1  ----------------------------------------------------------------------
00462131   1/1  ----------------------------------------------------------------------
00488581   1/1  ----------------------------------------------------------------------
00521171   1/1  ----------------------------------------------------------------------
00494761   1/1  ----------------------------------------------------------------------
00507461   1/1  ----------------------------------------------------------------------
00523631   1/1  ----------------------------------------------------------------------
00501281   1/1  ----------------------------------------------------------------------
00453911   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           GRRSEASLYDYHLATYDSGDTYDQSLARGFIDIWSMPAKIANMRDRRLS---------------------
00401901   1/1  lgrespnslyseelatydeddvfdqkdaeGfikllglrlklyalvk------------------------
00448551   1/1  gnvivlgrespnslyseelatydegdvfdqkdaeGfikllglrlklaalv--------------------
00399781   1/1  nvivvgresspnslYseelatyeeldgafdqkdaeGfikllglr--------------------------
00399771   1/1  ----------------------------------------------------------------------
00502331   1/1  ----------------------------------------------------------------------
00478481   1/1  ----------------------------------------------------------------------
00433811   1/1  ----------------------------------------------------------------------
00483691   1/1  ----------------------------------------------------------------------
00470351   1/1  ----------------------------------------------------------------------
00510381   1/1  ----------------------------------------------------------------------
00462131   1/1  ----------------------------------------------------------------------
00488581   1/1  ----------------------------------------------------------------------
00521171   1/1  ----------------------------------------------------------------------
00494761   1/1  ----------------------------------------------------------------------
00507461   1/1  ----------------------------------------------------------------------
00523631   1/1  ----------------------------------------------------------------------
00501281   1/1  ----------------------------------------------------------------------
00453911   1/1  ----------------------------------------------------------------------