[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ56165.1


[Show Plain Result]

## Summary of Sequence Search
   1::167
   4::169  9.5e-39 33.7% 0037944 00379441 1/1   carbonic anhydrase, cab                 
   5::166  1.2e-32 30.4% 0036375 00363751 1/1   carbonic anhydrase, cab                 
   3::167  2.3e-31 28.5% 0037055 00370551 1/1   carbonic anhydrase, cab                 
   3::167  5.5e-31 29.1% 0038893 00388931 1/1   carbonic anhydrase, cab                 
   1::167  1.4e-30 30.1% 0036374 00363741 1/1   carbonic anhydrase, cab                 
   1::167


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNGVFDDVLAANEDYVRTFTLAGLQPVAARGLALVTCMDSRIEPLEMLGLKPGDAKILRNAGARVTDDTL
00379441   1/1  ---aleellegnrrfv...lfellakgqsPkalvitCsDsRvppelekilglgpGdlfvvRnaGnlvpdd
00363751   1/1  ----llllllllllelllllllltleeltaltpdealellmdglerllegnrafaeevlaedpelfeela
00370551   1/1  --daleellegnlrfveelleedpelfeelakgqsPkalviaCsDsRvppelilglgpGdlfvvRnaGnl
00388931   1/1  --saleellegnlrfveellaedpelfeelakgqsPkalvigCsDsRvppelilglgpGdlfvvRnaGnl
00363741   1/1  llllllelllllllslllllalspmsalerllegnlrfveeklaedpelfeelakgqsPkalvigCsDSR


                         -         -         *         -         -         -         -:140
query           RTLVLAVYLLGVNRVIVLPHTGCKMASVSGDEEVHDTIAARYGVDTRSLEFHTDSDQIGALHRDVERIRH
00379441   1/1  vlasleyavlvlgvkeivVlgHtdCGavkaalgliddwlklirpalelllalldlalllfrlvelnvleq
00363751   1/1  kgqsPkalvigCsDSRvppelilglgpGdlfvvRnaGnlvppydlsvlasleyAvlvlgvklivVlGHsd
00370551   1/1  vppydplsdlgvlasleyAvlvlgvklivVlGHsdCGavkaaldlllegllelgliddwlrlllpalllv
00388931   1/1  vppydlsvlasleyAvlvlgvkhivVlGHsdCGavkaaldllelgliddwlelirpalllvlalldglde
00363741   1/1  vppelilglgpGdlfvvRnaGnlvppydlsvlasleyAvlvlgvkhivVlGHsdCGavkaaldllelgli


                         +         -         -         -         -         *         -:210
query           HPLLPPDLPVMGAIYDVDTGRVTPVDM-------------------------------------------
00379441   1/1  venlrshplvpgdlkvhglvydvetgkll-----------------------------------------
00363751   1/1  CGavkaaldlldlgliddwlelirpa--------------------------------------------
00370551   1/1  ldlldgldelelvdllvelnVleqven-------------------------------------------
00388931   1/1  aelvdllvelnVleqvenlrthplvle-------------------------------------------
00363741   1/1  ddwlrlirpallkvleelgvdl.dlal-------------------------------------------