[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ56191.1


[Show Plain Result]

## Summary of Sequence Search
   1::515
   3::517   1e-173 42.4% 0042298 00422981 1/1   l-CoA synthetase-like                   
   7::516 3.1e-164 41.7% 0043409 00434091 1/1   l-CoA synthetase-like                   
   1::517 2.5e-146 42.5% 0043886 00438861 1/1   l-CoA synthetase-like                   
   2::517 3.3e-146 42.4% 0040895 00408951 1/1   l-CoA synthetase-like                   
   2::517 1.1e-144 42.4% 0040451 00404511 1/1   l-CoA synthetase-like                   
   2::517 9.1e-144 44.4% 0044590 00445901 1/1   l-CoA synthetase-like                   
   2::517   2e-141 42.9% 0035109 00351091 1/1   l-CoA synthetase-like                   
   1::515


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLNLSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYF
00422981   1/1  --lladpdlllsdldllslaeyelllewnvtdpelfwdelaelldwlklldlvlvldlllllpllrwflg
00434091   1/1  ------adylalpelslsdlellweeeaelllvllnltavlllldlldlelllplakwflggllntlhdl
00438861   1/1  dltlldlleraaartpdrvaliflgegrrlTyaellervnrlaaaLlalgvkpgdrVaillpnspelvva
00408951   1/1  -llllsaellalllplnrtflplplltlhdllerqaartpdavalifegrrlTYaellervnrlaaaLla
00404511   1/1  -erllllllllltelllpgpltlhdllerqaartpdrvalifegegrrlTYaellervnrlaaaLlalgv
00445901   1/1  -pntelllpgpltlhdlleraaartpdrvalvfedegelrrlTyaellervnrlaaaLlalgvkpgdrVa
00351091   1/1  -llseldlllllllltlllllllltlhdlleraaartpdavalvfegrtlTYaeldervnrlaaaLlalg


                         -         -         *         -         -         -         -:140
query           GALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGA
00422981   1/1  grlntlhdllerqaartpdrpalifeddgdgelrtlTYaeldervnrlAaaLralGvkpgdrVaillpns
00434091   1/1  lerqaartpdrpalifedgldgelrrlTYaeldervnrlAaaLrsalGvkpgdrVaillpnspefvvall
00438861   1/1  llAvlkaGavyvplnpalpaerlayiledsgakllltdd.....ellelllel..alpslklvivld...
00408951   1/1  lGvkpgdrVaillpnspelvvallAvlkaGavyvplnpalpaeelayiledsgakllltddellellkll
00404511   1/1  kpgdrValllpnspelvvallAvlkaGavyvplnptlpaerlayiledsgakllltdd.....dlldlll
00445901   1/1  lllpnspelvvallAvlkaGavyvplnpalpaerlayiledsgakllltdd.....dllelllellaelp
00351091   1/1  vkpgdrValllpnspelvvallAvlkaGavyvplnpalpaerlayiledsgakllltdd.....dllell


                         +         -         -         -         -         *         -:210
query           TTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAP
00422981   1/1  pelvvallAvlkaGavyvplnptlpaerlayiledsgakllltddellellkeldlkelvdealelaelp
00434091   1/1  AvlkaGavyvplnpglpaerlayiledsgakllltddellrggklidllelllealallpllklvvvldd
00438861   1/1  .........llslddllaagsaalpavpvdpddlayilyTSGTTGkPKgvvlthrnllanalalaralll
00408951   1/1  lllelldelpslklvivldd........llgvlsledlla...aplplvpvdpddlayilyTSGTTGkPK
00404511   1/1  ellaelpslklvivlddlllalllldglgvlslddllalgasaplplvpvdpddlayilyTSGTTGkPKg
00445901   1/1  slklvivld......dlallgllsledllaagp...plvpvdpddlayilyTSGTTGlPKgvvlthrnll
00351091   1/1  lelladlpvl....................lsleellaagsaalplvpvdpddlayilyTSGTTGlPKgv


                         -         -         -         +         -         -         -:280
query           DSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQG
00422981   1/1  slktvivlddlglladlallgvlslddllaagsaelpavpvdpddlayilyTSGTTGkPKgvvlthrnll
00434091   1/1  lllllllllllgllsleellaaasaalppvpvdpddlayilyTSGTTGkPKgVvlthrnlllalalalal
00438861   1/1  gltpgdrvlsflplfhdaglllellgalllGatlvllsgfdperllelieeykvtvlflvPtllrlllka
00408951   1/1  gvvlthrnllanalalalal..gltpgdrvlsflplfhvfglsvlellgallaGatlvllsgfdperlle
00404511   1/1  vvlthrnllanalalaeallllg..ltpgdrvlsflplfhdagl.lellgallaGatlvllsgfdperll
00445901   1/1  analalllalalgltpg..dvvlsflplfhdaglle.llgallaGatlvllsgrfdperlleliekykvt
00351091   1/1  vlthrnllalalalalalg..ltpgdrvlsflplahdagl.lellaallaGatlvllsgpllfdperlle


                         -         *         -         -         -         -         +:350
query           DHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG
00422981   1/1  anaaallalalgltpg..drvlsflplahdaglllellgallaGatlvllsgapllfdperllelieeyk
00434091   1/1  alg..ltpgdvvlsflplfhdaglvlellgpllaGatlvllpglplrfdperlleliekyrvtvlflvPt
00438861   1/1  peellaaldlsslrlllsgGeplppellerlrelfgvrllngYGlTEttgvvtlllp....kpgsigrpl
00408951   1/1  lieeykvtvlflvPtllrlllkapelagldls....slrlllsgGeplppellerlrelfgvrllngYGl
00404511   1/1  elieeykvtvlflvPtllrlllkape..lagldlsslrlllsgGeplppellerlrelfpgvrllngYGl
00445901   1/1  vlflvPtllrlllkape.lagldls.slrlllsgGeplppellerlre.lgvrllngYGlTEttvvvtll
00351091   1/1  lieeykvtvlflvPtllrlllka........dlsslrlllsgGeplppellerlre..gvrllngYGlTE


                         -         -         -         -         *         -         -:420
query           VEMKLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKD
00422981   1/1  vtvlflvPtllrlllkapeellapldlsslrlllsgGeplppellerlrelfpdlgvpllngYGlTEttg
00434091   1/1  llrlllkapeellakldlsslrlllsgGeplppellerfrelfglsgvrllngYGlTEttvvvtlnppgl
00438861   1/1  pgvevrivdpdeetgepvppgevGelvvrgppgvargYlndpeltaeafvdgwyrTGDlgrldedgylyi
00408951   1/1  TEttvvvtlllpgldvkpgsiGrplpgvlevrivdpdgepvppgevGelvirgpgvargYlndpeltaea
00404511   1/1  TEttvvvtllppg.dvkpgsigrplpgvevrivdpedgepvppgevGelvvrgpgvargYlndpeltaea
00445901   1/1  lpglllllllldllalkpgsiGrplpgvevrivdpdgrpvppggeevGelvvrgpgvargYlndpeltae
00351091   1/1  ttvvvtlllpgdllpvkpgsigrplpgvevrivdedgrpvppgevGellvrgpgvargYlndpeltaeaf


                         -         -         +         -         -         -         -:490
query           MIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYK
00422981   1/1  vvtlnppgalpvkpgsiGrplpgvevrivdpdgrpvppgevGeLvvrgplpgvarGYlndpeltaeafva
00434091   1/1  alpvkpgsiGrplpgvevrivdedtgepvpplgevGeLvirgplpgvarGYlndpeltaeafvadpdgwy
00438861   1/1  lGRlddqikigGeriepgeiEavllshpavaeaavvgvpdedggerlvafvvlkpgaeldaeelraflre
00408951   1/1  fvedgwyrTGDlgrldedGylyilGRlddqikigGeriepgeiEavllshpavaeaavvgvpdedggerl
00404511   1/1  fvedgwyrTGDlgrldedGylyilGRlddqikigGeriepgeiEavllshpavaeaaVvgvpdedggerl
00445901   1/1  afvedgwyrTGDlgrldedGylyilGRlddqikigGeriepgeiEavllshpavaeaavvgvpdedgger
00351091   1/1  vedpfspgdgwyrTGDlgrldedGylyilGRlddqikigGeriepgeiEavllshpavaeaaVvgvpdel


                         *         -         -         -         -         +         -:560
query           YPRIVEFRTELPMTATGKILKRELR---------------------------------------------
00422981   1/1  dpdgwyrTGDlgrldedGyleilGRkd-------------------------------------------
00434091   1/1  rTGDlgrldedGyleilGRkddqiki--------------------------------------------
00438861   1/1  lrlppykvPrrivfvdelpltasgKid-------------------------------------------
00408951   1/1  vafvvlkpg.ellaeelraflrerllp-------------------------------------------
00404511   1/1  vafvvlkpgaeldeeelraflrerlpp-------------------------------------------
00445901   1/1  lvafvvlkpgaeldaeelraflrerlp-------------------------------------------
00351091   1/1  ggerlvafvvlkpg..llaeelraflr-------------------------------------------