[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ56286.1


[Show Plain Result]

## Summary of Sequence Search
   1::430
   1::376  3.9e-73 30.5% 0038952 00389521 1/1   ependent transferases                   
   1::375    1e-71 31.6% 0035401 00354011 1/1   ependent transferases                   
   2::376  4.2e-67 33.8% 0045639 00456391 1/1   ependent transferases                   
   6::395  5.1e-66 30.5% 0050977 00509771 1/1   ependent transferases                   
   2::377  9.2e-66 30.3% 0052862 00528621 1/1   ependent transferases                   
  24::392  1.6e-63 30.3% 0045231 00452311 1/1   ependent transferases                   
  25::378  1.8e-63 31.8% 0046255 00462551 1/1   ependent transferases                   
  21::415  1.9e-63 30.7% 0050390 00503901 1/1   ependent transferases                   
   6::380    1e-62 33.0% 0046089 00460891 1/1   ependent transferases                   
   2::377  1.5e-62 32.2% 0042806 00428061 1/1   ependent transferases                   
   2::375    3e-62 30.1% 0046024 00460241 1/1   ependent transferases                   
   3::376  1.1e-60 30.7% 0045171 00451711 1/1   ependent transferases                   
  14::375  1.4e-60 31.1% 0051323 00513231 1/1   ependent transferases                   
  22::375  9.2e-60 34.1% 0050768 00507681 1/1   ependent transferases                   
   3::392  1.5e-58 30.3% 0035073 00350731 1/1   ependent transferases                   
   1::375  1.8e-58 32.0% 0039341 00393411 1/1   ependent transferases                   
  10::379  2.6e-58 31.0% 0044523 00445231 1/1   ependent transferases                   
   2::375  2.7e-58 31.0% 0047956 00479561 1/1   ependent transferases                   
  14::375    3e-58 33.1% 0046965 00469651 1/1   ependent transferases                   
   2::392  3.3e-58 30.3% 0045068 00450681 1/1   ependent transferases                   
   5::417    1e-57 31.1% 0053335 00533351 1/1   ependent transferases                   
   5::420  3.4e-57 31.9% 0050696 00506961 1/1   ependent transferases                   
   2::375  8.4e-56 31.4% 0041674 00416741 1/1   ependent transferases                   
  21::377  1.6e-55 32.2% 0044595 00445951 1/1   ependent transferases                   
   1::375  3.6e-54 31.4% 0035589 00355891 1/1   ependent transferases                   
  22::375  7.6e-54 30.4% 0037569 00375691 1/1   ependent transferases                   
  21::375  6.9e-51 29.9% 0049754 00497541 1/1   ependent transferases                   
  21::376  7.4e-51 29.6% 0050261 00502611 1/1   ependent transferases                   
   1::375  9.9e-48 28.2% 0040526 00405261 1/1   ependent transferases                   
   9::419    6e-41 27.4% 0035846 00358461 1/1   ependent transferases                   
  20::394  1.8e-36 29.0% 0050157 00501571 1/1   ependent transferases                   
   4::326  5.9e-36 29.6% 0046165 00461651 1/1   ependent transferases                   
  14::418  2.4e-33 26.5% 0041260 00412601 1/1   ependent transferases                   
  26::375  1.9e-31 26.2% 0049486 00494861 1/1   ependent transferases                   
  18::378  3.7e-31 23.2% 0038034 00380341 1/1   ependent transferases                   
  19::416  1.9e-30 26.1% 0048952 00489521 1/1   ependent transferases                   
  21::376  1.4e-29 28.0% 0051195 00511951 1/1   ependent transferases                   
   8::374  6.9e-29 25.8% 0044807 00448071 1/1   ependent transferases                   
  38::399  7.3e-29 24.9% 0048571 00485711 1/1   ependent transferases                   
  19::280  9.9e-29 26.1% 0046206 00462061 1/1   ependent transferases                   
  26::414    1e-27 24.6% 0040897 00408971 1/1   ependent transferases                   
  38::394  3.4e-27 24.8% 0044083 00440831 1/1   ependent transferases                   
  22::394    5e-27 26.9% 0050754 00507541 1/1   ependent transferases                   
  19::375  1.8e-26 26.5% 0047340 00473401 1/1   ependent transferases                   
  20::394  2.1e-25 24.6% 0052070 00520701 1/1   ependent transferases                   
  36::376  2.4e-25 24.9% 0036780 00367801 1/1   ependent transferases                   
  28::377  4.9e-25 22.7% 0048074 00480741 1/1   ependent transferases                   
  35::414  1.7e-23 23.6% 0041704 00417041 1/1   ependent transferases                   
  36::409  1.8e-22 23.9% 0046087 00460871 1/1   ependent transferases                   
  62::327  2.3e-22 24.5% 0048747 00487471 1/1   ependent transferases                   
  21::403  4.2e-22 24.7% 0046747 00467471 1/1   ependent transferases                   
  24::327  6.5e-22 23.3% 0046547 00465471 1/1   ependent transferases                   
  23::394  3.4e-21 22.5% 0050076 00500761 1/1   ependent transferases                   
  35::326  1.5e-20 25.5% 0035246 00352461 1/1   ependent transferases                   
  25::424  1.3e-19 23.7% 0036406 00364061 1/1   ependent transferases                   
  27::417  1.3e-19 23.6% 0047441 00474411 1/1   ependent transferases                   
  38::399  1.7e-19 22.4% 0045392 00453921 1/1   ependent transferases                   
  39::240  2.7e-19 28.3% 0052302 00523021 1/1   ependent transferases                   
  24::416  5.8e-19 21.3% 0046584 00465841 1/1   ependent transferases                   
   8::375  2.1e-18 23.5% 0051757 00517571 1/1   ependent transferases                   
   9::399  9.2e-18 21.5% 0042809 00428091 1/1   ependent transferases                   
  31::326  1.3e-17 25.7% 0045909 00459091 1/1   ependent transferases                   
  34::394  4.8e-17 25.3% 0046007 00460071 1/1   ependent transferases                   
  23::419  1.9e-16 23.3% 0042144 00421441 1/1   ependent transferases                   
  23::376  2.4e-14 26.5% 0050753 00507531 1/1   ependent transferases                   
   1::419  4.8e-14 24.2% 0040134 00401341 1/1   ependent transferases                   
  47::360    1e-13 23.6% 0049524 00495241 1/1   ependent transferases                   
  28::375  2.6e-13 23.9% 0047670 00476701 1/1   ependent transferases                   
  25::238  1.1e-12 25.0% 0047581 00475811 1/1   ependent transferases                   
  22::386  1.5e-12 23.7% 0045973 00459731 1/1   ependent transferases                   
  96::394  3.3e-12 18.0% 0043583 00435831 1/1   ependent transferases                   
  64::420  2.8e-10 23.6% 0042383 00423831 1/1   ependent transferases                   
  30::322  3.5e-10 21.3% 0047095 00470951 1/1   ependent transferases                   
   9::323  1.3e-09 19.4% 0052164 00521641 1/1   ependent transferases                   
  24::419  4.8e-09 22.8% 0049070 00490701 1/1   ependent transferases                   
   3::399  1.9e-08 21.1% 0052943 00529431 1/1   ependent transferases                   
  37::198  4.4e-08 29.6% 0052731 00527311 1/1   ependent transferases                   
  36::399  4.4e-07 21.3% 0052157 00521571 1/1   ependent transferases                   
  33::316  1.9e-05 25.0% 0046056 00460561 1/1   ependent transferases                   
  33::324  2.7e-05 23.0% 0046154 00461541 1/1   ependent transferases                   
   1::430


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSVAVSATLAVNEALARRRSQGLPVLPLGFGEAGLPVHPVMRDALSTGGDQNGYGPVAGIRELREAAAGY
00389521   1/1  mssflstllsprlkslkpyvigellelaaelgaggpdvidlgigepdlgtpplelllltlvlpavleala
00354011   1/1  Mssflklllssrlkslkpsvilellelaaelgangpdvidlgvgepdfgpplldllgltlplpavleala
00456391   1/1  -mslfsrlkalppspilellelakel..pgpdvinlgigvyrdeepdlptppavkealkealeegltlgY
00509771   1/1  -----smdlserlsrlpsyireilelaaelgadgkdvidlgvgepdlldfppppavlealaealddgllg
00528621   1/1  -ladrlknlppsitlallalalellaggkdvidlsvgepdfppppavlealaealdgllgypppaglpel
00452311   1/1  -----------------------lnsllsslppyppdpilglaaalkadgrpdvinlgigvyrdeepdlp
00462551   1/1  ------------------------vidlsvgepdfppppavlealaealdgllgyypsaglpelreaiae
00503901   1/1  --------------------mllserldrlgpsvidellelaggpdvidlgigepdlppppevlealaea
00460891   1/1  -----mmllsdrlldlkpsvilkllalaaelgaggpdvidlgigepdfppppavlealaealdegllgYp
00428061   1/1  -lfsrlkalppspilklleaakrl..ggpdvidLgvgvyldlepdlppppavlealaealeegllhgYpp
00460241   1/1  -mmdlssrlerlppsvirkllelaar.daggpdvidlgigepdfppppavlealaealdelldgagllgY
00451711   1/1  --lppdpilallalaae..dpgpdvidlgvgvyldlepdlppppavlealaealedgltlgYgppeglpe
00513231   1/1  -------------klllskrldrlgpspirallllaagpdvidlgigepdfppppavlealaealdegga
00507681   1/1  ---------------------llldlslllsdrllglppsvirkllelaagpdvidlgigepdlpppple
00350731   1/1  --lmlslfsrlealppdpilglleaak..kdpgpdkinlgiGvyrdeepdlpvppavkealaealedleg
00393411   1/1  rnlkpyvigpilelaaelgadgpdvidlgvgepdlppppavlealaealesgllgygpspglpelreala
00445231   1/1  ---------llellaaellaggpdvidlsvgepdfppppavlealaealddgvlgyypdpglpelreaia
00479561   1/1  -llppspilsllelaaelgaggkdvidlsvgepdfppppavlealaealdgllrypdp.glpelreaiaa
00469651   1/1  -------------llskrlerlppspilellellaggpdvidlgvgepdlppppavlealaealdsgllg
00450681   1/1  -mlsllsnlkplppdpilglleaakad..pgpdvinLgigvyrdeepdlppppavkealaealedgllll
00533351   1/1  ----lfkrlgrlppspirgllalladld..gkdvidlgvgiyldpepdlppppavlealaealdd.gagl
00506961   1/1  ----pgsgtfvsdrlpdlppspirellelaggpdvidlgigepdlgppplpaviealaealdsggalllg
00416741   1/1  -issrllnlppyvfdeilelaalldadgpdvidlgvgepdlppppavlealaealesgllrygdptglpe
00445951   1/1  --------------------lelssrldglpaslirellelaggpdvidlgvgepdlpppeavlealaea
00355891   1/1  Msllssrllglkpslvleilelaalldadgkdvidlgagepdlppppavlealaealdsgllgygpppgl
00375691   1/1  ---------------------gpdvinlgigdpdfplppavlealalaelidldanenplgpslaaldag
00497541   1/1  --------------------nmllserldrlppsailelleladgpdvidlgsgepdlppppavlealae
00502611   1/1  --------------------lsslplsllldlnlslssrlplvpldlirelladadgpdvidlgsgepdl
00405261   1/1  mslttlrvaelakrlanlvpsgilrv..ladelkaegkdiiklsagepdfgppdeiteaaaealdqgstf
00358461   1/1  --------pplfdalvklaeegpysfhvpghkggvlnfasnlylgfpdfpgpnealealgaalggldlly
00501571   1/1  -------------------leellelleslllsllyrlplvivraegayltdvdgrryldlssglpvnpl
00461651   1/1  ---kldtllvhagrlldlgtggidliilstgeppfpvpeavlealaealasghlygygpgpgveelreal
00412601   1/1  -------------ealellalgtdvihlgsnenplgavappiyqtptfvldalaealdggrygrgpnpgl
00494861   1/1  -------------------------liyldsdattppppavlealaealevgdgnygsdpgleelreala
00380341   1/1  -----------------llalgtdvihlgsgepdylgpvappiylsstftfevleaviealagggtgydy
00489521   1/1  ------------------mdlsklldrletlalhagllpdvllatgadviplgqgepdvppaveeala.l
00511951   1/1  --------------------llkrllkldtlairagfpllartggvivldlsagtppfpvpeavlealae
00448071   1/1  -------plvllrairsllpdgdgviyldsagpgplppavlealaeallghlsygategleelrealael
00485711   1/1  -------------------------------------lelslpllltelpglsselllelllslllslya
00462061   1/1  ------------------rqvggivlilsenappfyvpeavldalteayaegfagyrggygysrlrnpta
00408971   1/1  -------------------------iplplgepdf..peevleaviealdsggytrgpgvaeleealael
00440831   1/1  -------------------------------------lgslpepevgaqgepieliageeyldalvgagl
00507541   1/1  ---------------------ryippteeeiaemldaigvssldelfdpipleirrgeglplpdlserev
00473401   1/1  ------------------ealgkdliylgsgapglgtppvvraaaeaaadlfanplsggeysrganptle
00520701   1/1  -------------------llldsleelldelipeglrrpfplllglplvlvralgrlldvdgkeyldla
00367801   1/1  -----------------------------------kdlsletlaihagsgpdvlnlvgppiyltnefvfe
00480741   1/1  ---------------------------iyldnagptplppavlealleglg..hrsgygytelleelrel
00417041   1/1  ----------------------------------Pevlealaevlesg...wlygtgpgveeleealael
00460871   1/1  -----------------------------------lklllepfrikvvepidptiaeeiekelkraggnl
00487471   1/1  -------------------------------------------------------------deleealae
00467471   1/1  --------------------lllllllllllldeelllllaeelyrlplvivrgegarlldvdgreyidl
00465471   1/1  -----------------------dliyld.naaptplppevleamaealeklygnpssghelgygatell
00500761   1/1  ----------------------gtehidflsdnptgphpavlealaeallgddlgygadplveeleekla
00352461   1/1  ----------------------------------rkfiaeplriksaegvyltdvdgreyldalsgynvl
00364061   1/1  ------------------------lnpalsetellrelldlasnnylglasvillgastt..pvppavle
00474411   1/1  --------------------------iyldgpgptplppevlealarallshrsyeftagleelrealae
00453921   1/1  -------------------------------------ptprskellerakklllggytslplvivraega
00523021   1/1  --------------------------------------mkfetlllhagldpdpltgavnppiylsstpv
00465841   1/1  -----------------------efpllkgliyLdnaalgll.ppavleamaealeelagngssghrlsr
00517571   1/1  -------elirketlrlrgginasenvlslnvlgaqtspevieaaeealggygysrggdplreeleella
00428091   1/1  --------mpkslelldraklllpggvnsyvrlplvieraegaylydvdgnrylDflsgigvlnlGhnhp
00459091   1/1  ------------------------------ksdliPdfptipeeeieavaeald..sgilsytlgpgvke
00460071   1/1  ---------------------------------gghthpevveaaaealdklglgsggsrllygtnplhe
00421441   1/1  ----------------------kgviyldsa.attpvppevlealaealeslllfgnphslghelsrgat
00507531   1/1  ----------------------lryigptegeiaemldalgvesldelfadvpaslrrkgllllpglsel
00401341   1/1  miplgsetrklldlisnd.ylglaeiyllyasetp.vppevlealleallnkygegnpgsryyggtlyvd
00495241   1/1  ----------------------------------------------lldlldirllfpalslfalgkdli
00476701   1/1  ---------------------------lgylpsgplppavladllaaalnqnlltyelspgateleeeva
00475811   1/1  ------------------------midlrsdtvtpptpevleamaeanvgddvygedptvneleerlael
00459731   1/1  ---------------------dkllsellelllaagllrldpeifsalrkelkrgkdlinliasnnyl..
00435831   1/1  ----------------------------------------------------------------------
00423831   1/1  ---------------------------------------------------------------eevvsml
00470951   1/1  -----------------------------llllllfpllllfpllkgliyLdnagptplppevleamlea
00521641   1/1  --------lrllfpirelfpllmdliyldnagptplppevleamlealishrspeftelveearellael
00490701   1/1  -----------------------lllelalaldelellealrklfpllkgliyLdnasttpvppavleam
00529431   1/1  --lklpkskelleellellpggvwhpvrafrlygplplvivraegaylydvdGneylDflsglgvlnlGh
00527311   1/1  ------------------------------------kkiplgspvfdeeeiaavlealdsgvytlgptvd
00521571   1/1  -----------------------------------PlvivraegayltdvdGneylDflsglgvlnlGha
00460561   1/1  --------------------------------lelellRelfplldlnllldgliyldnaattplppavl
00461541   1/1  --------------------------------lselllllleglyevdpeiaeliekelkrqgevlllia


                         -         -         *         -         -         -         -:140
query           WERRGLPTDPDLVVAGPGSKPLLYALLLAIGGDVAIAAPSWVSYAAQSHLSGGQPLFVPTAPAQGGVPEP
00389521   1/1  ealdgllgYpdsaglpelreaiaeylarrygglvgvdpeeilvtnGatealelllralldpGdevlvpdp
00354011   1/1  ealaegllgYpdpaGlpelreaiaellarrygllvgvdpeeilvtnGatealelalralldpGdevlvpd
00456391   1/1  lpiaGlpelreaiaelllrrygldldpdrivlvqtlsttGatealalllrallnpgdevlipdptypnyl
00509771   1/1  YpdpaGlpelreaiaellkrrrgvgvdpeqilvtnGatealalllralldpgdevlvpdptYpgylaaae
00528621   1/1  reaiaeylerrygvgvdpenilvtnGatealflalrallnpGDevlvpdptYpgylaaarlagakvvpvp
00452311   1/1  pppavrealaealedgelllgYppiaGlpelreaiaellfgryglgldpdriatvvtnGatealslalra
00462551   1/1  ylkrrygvgvdpdnilvtnGasealflllralldpgdevlvpsPtYpgylaaarlagakvvpvpldeeng
00503901   1/1  ldsgalllrypdpaglpelreaiaellgrrygvdvdpeeeilvtnGgtealelalralldpGdevlvpdp
00460891   1/1  p..glpelreaiaeylkrrygvgvdpdeilvtnGatealflllrallnpGdevlvptPtYpgylaaarla
00428061   1/1  paGlpelreaiaelllrrygvgldpervaivvtnGgtealalalrllallnpgdevlvpdptypnylaia
00460241   1/1  pdpqGlpelreaiaellgrrygvdvdpallkledeivvtnGgtealllalralldpGdevlvpdptYpgy
00451711   1/1  lreaiaellarygvgvdpeevvvtnGgtealalalrllallnpgdevlvpdptypgylaaarlagaevvp
00513231   1/1  lllgYpdpaGlpelreaiaeylarrygvgvdpeeeilvtnGatealalllralldpGdevlvpsptYpgy
00507681   1/1  avrealaealdelglgllgYpdpaGlpelreaiaeylarrrgvp.dpeqilvtnGatealalllralldp
00350731   1/1  llgYlpiaGlpelreaiakllfgryglaldperiatvvtnGgtealslaaeflkrflrallnpgdevlvp
00393411   1/1  ellgarygvavdpeeivvtnggtealllallallgpGdevlvpdptypaylaalrlaGaevvfvpldpdg
00445231   1/1  ellgrry..vdpeeilvtnGatealalllralgdevlvp.PtYplyaaaarlagaevvevpld..ngfll
00479561   1/1  ll...g..vdpeeilvtnGatealalllralpgdevlvptptYpgylaaarlagaevvpvpl..dndfgl
00469651   1/1  ygppaglpelreaiaeyllrrrgvgvdpeteilvtnGatealalalrallgpGdevlvpsptypayaaaa
00450681   1/1  rYppiaGlpelreaiaelllgeygvgldpervaivvtnGatealllaarflallnpgdevlvpdptypny
00533351   1/1  lgypdpaGlpelrealaellarlfgvevdpeeiaalltnggtealelalralrklgpgdevivpsptypg
00506961   1/1  ygdpaglpelreaiaeylgrrrgvdvdpeqilvtnGatealelalrallgpGdevlvpsptYpaylaaar
00416741   1/1  lreaiaellgrrrgvavdpeevvvtnggtealelalrallgpGdevlvpsptypgylaaarlaGaevvfv
00445951   1/1  lggllgypdppglpelreaiaall.....gvdpeeivvtsGatealnlalrallgpGdevlvpsptypay
00355891   1/1  pelrealaellgarygvavdpeeivvtnggtealelalrallgpGdevivpsptypgylaaarllGaevv
00375691   1/1  llrypdp.glpelreaiaell...g..vdpeeilvtnGatealalllrallnpgdelvlvpdptYpgyla
00497541   1/1  aldngllgyppsqglpelrealaellaellgadldpetevlltsggtealelalrallgpgdevlvpdpt
00502611   1/1  glgpppavlealaealaelgpgllgygppeglpelrealaellaelfgaeaadpeeivltnggteAlela
00405261   1/1  leesleeaaelfallvsgwlrlsyiygyypnpglpeLreaiaallggvyglavdpenivvtaGatealsl
00358461   1/1  gpsggileleealaelfgad....daifvtnGtseanlavilallgpGDevlvdrpsHksilnggarlaG
00501571   1/1  Ghs..ppevlealaealdrlgngssygptpgveelrealaell.....gadpaevlftnggteAlelalk
00461651   1/1  ael.......lgaeevlltsggtealelallallkpGdevlvpdptypsylaaarll.aevvfvpldedg
00412601   1/1  eeleealaellg.......aeevlltsggtaaif.allallgpGdevlvpaplygsylalarlalkrlGa
00494861   1/1  ell.....gaeaaeivftsgGteAnllallalldpgdevlvsepahpsvleagaaellGakvvpvp...d
00380341   1/1  srgpnptvealeealaellg.......aeaalvtssgtaAillallallgpGDevlvpdplygstielfg
00489521   1/1  lgagatgygysrgtgplrealeerlaellga....eevlltsggteAlelallallkpGdevlvpdptyp
00511951   1/1  alaggrygyggnpgveeleealaellg.......aeealvtsggtaaillallallkpGDevlvpapayg
00448071   1/1  l.....gadpayevvftsggtealeaallallkpgdevlvsapghpsvllaeaaerlGaevvvvpvde..
00485711   1/1  plplvivraegaylydvdGnrylDflagigvvnlGhnhpevveaiade.eqldkllhvallsngaphepa
00462061   1/1  ealeralaalegaeevvltssgtaAialallallkpGDevlvsdplyggtltllrllgarggivvtfvdg
00408971   1/1  lg.......aehavatnsgtaAlllallalglgpGDeVivpaltfvstanavllaGakpvfvdvdpd.tf
00440831   1/1  inlghghpdvvidLlsdtltgpvltaqlaellpgdryyggnpgvdeLeerlaell.....gae.havftn
00507541   1/1  ldelsglasknlgvdplfyldgaattpvppavlealaealtagnpysphelsqgaleleeelaerlael.
00473401   1/1  eleealaellg.......aeealltsggtaailaal.allkpGdevivsdpaygstlallrllleraGae
00520701   1/1  snnylglhtppavleavlealekygvgsggsrlsygttelleeleealaell...gae....evlltssG
00367801   1/1  lpeavlealaegltg..ytysrggnplrealeeklael...egaeealvtssgtaAieaallallkpGde
00480741   1/1  laellgadedaeevlltsggtealeaallallkpgdevlvsdpahgstlyakaakllGaevvfvplde..
00417041   1/1  l.......gaeeavftssgteAlnlallalglgpgdevivpspthvatlaailllGakpvfvdvde..tg
00460871   1/1  fllasenvyidlvsdaltgsplpamyaalevgddyygggpt..vdeleervaelf...gaeha.vfthsG
00487471   1/1  llga.......eealvtssgteAlelallallkpGDevivpsptygatleairll.akpvfvdvdedggn
00467471   1/1  .asnnylglghhpavleaaiealdkygvgspgsrllygttplhdeleerlaellga......eaalvfns
00465471   1/1  eelrealaell.....gadpdeiiftsggtealnlallalrrallkpgdeilvsspehpsvlkaaeller
00500761   1/1  ellga.....eaavlftsgGteAnllallaarepgdevivsataHisvleagailglggakvvlvpvd..
00352461   1/1  llghgdpeiDlltDsgtsaasdaqlaallvgdd..ayggdplafeleealaelf...gld...avlftns
00364061   1/1  allealenkygegypgsrlyqgtlsvdpleeeleerlaelfgae...aailltnsGtaAnlaallallkp
00474411   1/1  llg.....adpdvvlltgggtealeaallallgpgdkvlvpapgyfsvrlaelaerlgaevvvvpv..dp
00453921   1/1  ylydvdgnrylDflsgigvlnlGhnhpevvealkeqleklgytssggttelaealaellaellp..ldrv
00523021   1/1  fdtpeeiaaafealesgyiysriggptveeleealaellga.......eealltssgtaAlllallallk
00465841   1/1  gatelveelreklael.lgadpeeviftssgtealnlalkalrlgpgdeilvsalehpsvleaarllaer
00517571   1/1  elfga.......eaalvtssgtaAillallallkpgdeilvsrglyhgslihglklsgakvvfvd.....
00428091   1/1  evvealaeqldrllhgsflggltelavelaerlael.lplgldrvfftnsGseAneaalklarayalakg
00459091   1/1  lEeaiaellgakya......lavssGtaAlllallalglgpgdeVivpsptfvatanaillagakpvfvd
00460071   1/1  eleealaell...gae...aallfnsGteAnlaalkallgpgdivivdeltHgstldglrlsgakvvfvp
00421441   1/1  plleelrellaell.....gadpaeivftsggtealelallalrayglkpgdevlvsslehgsvlraael
00507531   1/1  evlrhltdlagknygddliylglgalghkppavieallealegltaytpyqpelsqgalelleelqerla
00401341   1/1  plveeleerlaelf...gae...aalvftnsGtaAnlaallallkpgdevlvpslahgstlaaarlagak
00495241   1/1  yldnaattplppevleamleallellgnphssgyslsrganplveelrerlakllgad....dpeeivft
00476701   1/1  dwlaellglpvaflllgadpaggvftsGgteAnllallaardralprrkaeglaalgleglpglvilvsd
00475811   1/1  lg....keaavfvpsGtmanllalaallqpgdevlcdelaHilldeagaleflsgaklvplp...gedgk
00459731   1/1  ppavleallealtnkygegypgsrlylgteavgplveeleerlael.....fgaeadelgvavftssGta
00435831   1/1  -------------------------galsltgsgllrapfgpllpgvvhvpapllyrlllleyn......
00423831   1/1  arllgapadnleealGaftsGgteanllallaarnralpkrkaaglgipgpeilvspaHysvlkaarllg
00470951   1/1  l.ihhlgp.eftelveearellaellgadpgeevvftgggtealeaallgllkpgdkvlvssnghfsvll
00521641   1/1  lg....adpyeeivftgggtealeaallnllkpgdkvlvssnghfsvlaaeaaerlGaevvvvpv..dpg
00490701   1/1  lealeelyangpsghelgrgalelveelrerlael.....lgadpaeivftssgtaalnaallalgaall
00529431   1/1  a..hpevvealkeqldrlghvs..gttepavelaelLaell.....pglekvfftnsGseAneaalklar
00527311   1/1  elEealaallgakya......vavssGtaAlllallallglgpdgkeVivpsltfvatanaillagakpv
00521571   1/1  hpevvealkeqldklghvs.gttelavelaekLaellp..glekvfftnsGseAneaalklaraytgrdk
00460561   1/1  eamaealeeyygnphsgghelgrgalelleelrerlael.....lgadspdevvftsggtealnlallal
00461541   1/1  senylspavlealgsaltn...kyaegypgsryyggteyvdpleeeleerlaelfga......ehallfa


                         +         -         -         -         -         *         -:210
query           DALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEIYRDLVHDPTTVVH
00389521   1/1  tYpgylaaarlatgaevvpvpldeeggflldlealeealtealkegpktkalllpnpnNPtGtvlsleel
00354011   1/1  ptYpgylaaarlatgaevvpvpldeeggflldlealeaalteapegglktklvllpnpnNPtGtvlsree
00456391   1/1  aaaklagakvvpvpldeengfgldlealeaaleeate...ktkllllnnphNPtGavlsreelkelaela
00509771   1/1  lagakvvpvpldeeggflldlealeaaltp......ktklvlltnPnNPtGtvlsleeleallelarkhg
00528621   1/1  ld.edgflldlealeaaitp......ktklillpnpnNPtGtvlsleelealaelarkhglllivDeaya
00452311   1/1  lkrflkgklnpgdevlvpdptypnylaiaelagaenvvevplddendfgldldallaalekatp...ktk
00462551   1/1  flflldlleleaaitp......ktkllllcnPnNPtGavlsreelealaelarkhgllvisDEiYadlvf
00503901   1/1  tYpgylaaarlaGakpvfvpldedgllplllglendflldlealeaaitp......rtkaiilpnpnNPt
00460891   1/1  gakvvevpldeegglflldlealeaaite.....pktkllllcnpnNPtGavlsreelealaelarkhdl
00428061   1/1  rlaGaevvevpldeendfgldldaleaalte...apektkllllnnpnNPtGtvlsleelkalaelakeh
00460241   1/1  laaaelaGaevvpvpldeeggflldldaleaaitp......ktklivlpnpnNPtGtvlsreeleelael
00451711   1/1  vpldeengfgldlealeaalaea...tektkllllnnpnNPtGavlsreeleelaelakehglllivDea
00513231   1/1  laalrlagakvvpvpldelltggllseggflldlealeaaitp......ktkliilnnpnNPtGtvlsre
00507681   1/1  GdevlvpsptYpgylaaarlagakvvpvpl...dgfgldlealeaalkeakeatpktkliylvpnpnNPt
00350731   1/1  dptypnylaiarlagaenvvevplddentfgldldallaalesate...ktkllllnsphNPtGtvltpe
00393411   1/1  gflldpealeaaitp......ktklvllvnpnNptGtvldleelealaelarehgllvivDeayaelayd
00445231   1/1  dle...........itpktkllllnnPnNPtGtvlsreelealae....hgllvvsDeaYadlvyd....
00479561   1/1  dldaleaaiktp......ktkllllcnpnNPtGavlsreelealaelarehgillivDeayadlvydga.
00469651   1/1  rlaGakvvfvpldeeggflldlealeaaitp......ktkaillpnpnNPtGavlsleeleelaelareh
00450681   1/1  laiaklagaevvpvplddengfgldleallaalteape...ktkllllnnpnNPtGtvlsreelkelael
00533351   1/1  ylaaarlaGakvvfvpldedgtfgidlealeaaitea....pktkaiilepnpnnPtGvvlpleeleela
00506961   1/1  lagakvvpvpl...defgldlealeaalteakekgpktkaiilvpnpnNPtGavlsleeleallelarkh
00416741   1/1  pldedngfgldlealeaaitp......ktkavilenpnNPtGvvldleelealaelakkhglllivDeay
00445951   1/1  laalrllGakvvfvpldleedgflldlealeaaitp......rtkaillvnpnNPtGavldleelealae
00355891   1/1  fvpldpdgtfgldlealeaaitp......rtkaiilenpnNPtGtvldleelealaelarehglllivDe
00375691   1/1  aarlagaevvpvpl..dedfgldlealeaal.p......ktklvvlpnpnNPtGtvlsleeleelaela.
00497541   1/1  ypgylaaarllGaevvfvplde.dgflldlealeaalte......ktkavileppnnptGvvlpleelee
00502611   1/1  lrallgpGdevlvpdptyhgylaaarllGaevvfvpldedg...ldlealeaalteagadgllpktkavi
00405261   1/1  allalldnltnlllkpgdevvvpdptYpgylrlakllgakvvfvdl........dlealekaitp.....
00358461   1/1  akpvylptdrngfggiggirfkhldpealeealtelkpeglrplpktkavvltnp.nptGtvyp...lee
00501571   1/1  aarllgpgdevlvpepayHgstlaalrlagakvvevtfvpldpdglllpypdlealeaai......tpkt
00461651   1/1  g..ldlealeaait......pktklvvlenpnnptGvvld...leeiaelakelghgallivDeayalgv
00412601   1/1  evvfvd........ldledleaaite......ktklvflespnNptgtvld...leeiaelakkhllnpg
00494861   1/1  edgkldledleaaitedtahgllpklvvltnpnnptGtvyslepleeiaalakehglllhvDgayaggal
00380341   1/1  lalrlaGaevvfvdld.......dlealeaaitp......rtklvvlespsnptgtvad...leaiaela
00489521   1/1  stlaaarll.akvvgvpvdedggl..dlealeaaie.....tpktkavilespnnptGvvld...leeia
00511951   1/1  sylallrlllkrfGaevvfvdld.......dlealeaaitp......ktklvvlespsnptgtvld...l
00448071   1/1  dglldlealeaalee.....hrtklvilehvnnptGvvlp...leeiaelarehgallivDeaqalgalp
00485711   1/1  eelaeklaelapegldkvfftnsgseaveaalklarqyglglggsrlvlgtlelheeleelladtgreki
00462061   1/1  ...ldlealeaaite......ktkliflespsNptgtvld...laaiaelAhevgallvvDntyaapll.
00408971   1/1  nidpealeaaitp......rtkaiv...pvnptGava...dleaiaelarehgllvivDaahalgalygg
00440831   1/1  sGteAnllalkallkpgdevivpdlayggtteagllagakpvfvdvde.dg.nldlealekait...evg
00507541   1/1  lgadaa.ivftsggteAnllallaarryhrargelgpgdevlvpdpaHgsnlaaarllGaevvevpvde.
00473401   1/1  vvfvdld.......dlealeaaitp......rtklvllespsnptGtvld...leeiaelahehgalviv
00520701   1/1  teAneaallalralgpgdevlvdelahhsildgarllgaevvvvphn.......dldaleaalteag..p
00367801   1/1  vlvpeplygstlellralakllGaevvfvdld.......dledleaaitp......ktklvllespsnpt
00480741   1/1  dglidlealeaait....egpktklvvlehpsnptGvvld...leeiaelakehgallivDaayaagalp
00417041   1/1  nidlealeaaieeh...tpktkaii...vvnptGvvad...leeiaeiakehgillieDaaqalgalygg
00460871   1/1  taAnllallallkpGdevivpdhflahggfletggaallsgatpvfvdydlvdpdtgnidlekleaaik.
00487471   1/1  ..dlealeaait......pktkaiilehpsnptGtvld...leeaiaelakkhgillivDeayalgvlgd
00467471   1/1  GteAnlaalrallgpgdivlvdelnHgstldglrlsgaevvfvphn.......Dldaleallkelreegp
00465471   1/1  lgaevvevpvde..dgrldlealeaalde......dtklvvlthpnnptGvilp...leeiaelakehgp
00500761   1/1  edgkldleaLeaairedtahvhgtrpvlveit.gntetGtvysldeleeiaelcrehglllhvDgArlgn
00352461   1/1  GteAnelalkallayhrakgepgdtviisngyhgttlehvslagakvvrvpfdpaldealllpedgnldl
00364061   1/1  gdevlvddlahgstlagarlanasglGaevvfvpvd..edglidledleaalke......ktklivles.
00474411   1/1  gglvdpeale.........tpdtklvllthpenptGvvld...laaiaalarehgpdallvvDaaqslga
00453921   1/1  fftnsGseAnelalklarayylakgrlgtggdkilvfeggYHGrtlgalsltgspsylggfgplgagvvv
00523021   1/1  pGDevivpaptygstaeairlllkrlGakpvfvdlde......dlealeaait......pktkaiilehp
00465841   1/1  lgaevvfvpldeevdglldlealeaaltp......ktklvvlehvsnetGvilp...lkeiaelakehnG
00517571   1/1  ....dledlekaike......ktklvvl..psnptgrilsledlkeiaeiakeygallivDeahgagl.v
00428091   1/1  tprdkilvfegaYHGrtlgalsltgsklyhaslfgpllpgvvgvpapylyrteelgyndldaleallae.
00459091   1/1  vdpdt.fnidpedleaaitp......ktkaii...pvnptGnvad...ldaiaeiakkhgllvieDaaya
00460071   1/1  hn.......dlealeaalaea...tprtkavvvesvfsptGdiap...laeiaelarkhgallivDeaha
00421441   1/1  lerlGaevvlvpvdp..dgrldlealeaaidp......ntklvvlehpnnptGvvlp...leeiaelahe
00507531   1/1  el.....lgadaanvvltdggtaaleaallalrltpgdevlvpdgahpsnlaalqtlaallGaevvvvpl
00401341   1/1  rlgievvfvdvdpet.glidlddleaairp......rtklivleh.snptGrvad...leeiaelaheyg
00495241   1/1  sggtealnlallalalaglkpGdevivsapehpstlaawrllaerlGaevvfvdvde..dglidlealea
00476701   1/1  paHysvekaarllGlgvrlvpvde..ngrmdleaLeeaieedtaaglipaavvatagttptGai...dpl
00475811   1/1  ldpedleaairdddvhfprtrlvslentqntegGtvypleeleeiaelArehglllhlDGARlanalval
00459731   1/1  AlllallallkpgdevlvpslahggstlaaarllGagvnfsgllfkvvfvdv.ddetgnidledleaait
00435831   1/1  ..dlealealieellgpdtiaavivePvqgnggvivpppgflkalrelcdehgilliaDEvqtgfgrtgk
00423831   1/1  ievrlvpv.dendgrmdlealeaai......dentalvvatagttptGaidd...ieeiaelaeeyglet
00470951   1/1  aeiaerlGaevvvvpvde..gglvdlealeealke.....pktklvalthvenstGvinp...leeiael
00521641   1/1  glvdlealeaalee.....pdtklvalthvetstGvllp...leeiaelahehgallvvDavqslgalpi
00490701   1/1  splkpgdevlvsalehgsvlaalallaerlGaevvfvdv.......idlealeaaltp......dtklvl
00529431   1/1  aytgrdkiisfeggYHGrtlgalsltgsgayrlgfaplpgvprlpapdtyrvpyndlealeallae...h
00527311   1/1  fvdvdpdt..nidpedleaaitp......ktkaii...pvnllGqvad...ldeiaei------------
00521571   1/1  iisfeggYhGrtlgalsltgspadrlgfapllggvrlpapdtyrvpyndlealealleel...gddiaav
00460561   1/1  aaahlkpgdevlvsalehpsnlaalrllaerlGaevvvvpvdp..dglldlealeaal......dprtkl
00461541   1/1  nvqpssGtaAnlaallallkpgdevltpslehgGhlthgstfdatalalsglgaepvfydvdpe.tglid


                         -         -         -         +         -         -         -:280
query           SPAEFAPERTVITTGLSKNLALGGWRIGVARLPDSDTGRHIHAALLGIASEIWSSPSGPVQRAAAYAFQE
00389521   1/1  ealaelarkhgillivDeayaelvfdgp.pfpslasldgallllpldlgrvivlgSfSKtlglpGlRlGy
00354011   1/1  leellelarehglllivDeayaelvfdga.pfpslaslllelglrllpdaygrvivlgsfsKtlglpGlR
00456391   1/1  kehdlllisDeaYqgfvydgleedavsiaslaelgdrvivlnsfSKtfglpGlRvGylvapnkdaelake
00509771   1/1  llvisDeayaelvydg..pfpslasldgydrvivlgsfSKtfglpGlRlGylvavgppelieallkllll
00528621   1/1  elvfdgepppsl..ldalgrvivlgsfSKtlglpGlRlGylvapp.....eliealrklkspltlgvssl
00452311   1/1  llllnnpnNPtGtvltpeelkelaelakehgllvivDeaYqgfayggldedapsllalleagenvivlrS
00462551   1/1  dgepppsl.lldaydrvivlrslSKtfglaGlRlGylvapn.....elirallklrspltlgvsslaqaa
00503901   1/1  GavlsreelealaelarkhglllieDeayaelvydgk.pfpslasldgeygrvivlgSfsKtlglpGlRl
00460891   1/1  lvisDeaYadlvfdga.pfpslasllpdlydrvivlrslSKtfglpGlRlGylvapn....pelieallk
00428061   1/1  gillvvDeaYagfafggeedapsilelagagpnvivlgSfsKtfglaGlRvGylvapa.....elieala
00460241   1/1  arehgillivDeayaelvydgepkdalppslasldglgrvivlgsfSKtfglpGlRlGylvapeelieal
00451711   1/1  yaglvyggeedapsllaladalprvivlgSfsKtfglpGlRvGylva.....ppeliealakvksqllll
00513231   1/1  elealaelakkhglllisDeayaelvydga.pftsllslpdaldrvivlrSfSKtfglpGlRvGylvapp
00507681   1/1  GavlsleeleallelarkhdllvieDeayaelvyd.gapfpslasldapdrvivlgsfSKtl.lpGlRlG
00350731   1/1  elkelaelakehgllvivDeaYqgfayggleedatsirslvelgenvivlnSfSKnfglaGlRvGylva.
00393411   1/1  .grpapsllsldpdalgrdivvfSfsKtlglpglrvGylvadpe.....liealrklrsgggstpsplaq
00445231   1/1  salllleaydnlivlrsfSKafglaGlRlGylianpe.....liealrklrsp..lnvstlaqaaaaaal
00479561   1/1  sfvslasll.dnvivlrSlsKafglaGlRlGylvappe....elieallklrs..plgvstlaqaaaaaa
00469651   1/1  gllvieDeayaelvyd.gkpapslasldglldrvivlgSfsKtfglpGlRlGylvappe.....liealr
00450681   1/1  akehglllivDeaYqgfaydgldedalavrsflelldagdnvivlrSfSKtfglaGlRvGylvappevvl
00533351   1/1  elakkhgillivDeayagfaydlggkgpsllelldlgpdvivlgSfsKalglpGlrvGalvgpdeellll
00506961   1/1  dllvieDeayaelvydgkpfpslaslde..pdrvivlgSfsKtl.lpGlRlGylvappe.....liealr
00416741   1/1  aglvydgkplsalalldalgrvivlgSfsKalglpGlrlGylvadpe.....liealrklrsggtfgpsp
00445951   1/1  larehgllvieDeayaelvydg..pfpsladldagrvivlfSfsKtlglpGlrvGylva.ppeliealrk
00355891   1/1  ayaglvydgkl.pgslaeld.gvdivlgsfsKalglpGlrlGylvadpe.....liealrklrsggtlgp
00375691   1/1  khgalvivDeayaelvygg..pllslldllg.rvivlgslsKtlglaGlRvGylvappe.....liealr
00497541   1/1  laelarehgillivDeayagfvytgklpvslaellgvag.adivvgSfsKalglpGlrlGalvgde....
00502611   1/1  lepnpnnptGvvlppeelealaelarehgallivDeayagfvytgkpagslaaldelgvdivlgslsKtl
00405261   1/1  .ktklvflesPnNPtgtvld..........akehgilvivDeaYaepvydp.......lplaydndivlr
00358461   1/1  iaelakkhglyllvDeAhgagayggpgrglaehlglpplaleagadivvgslhKtlgaltqtGwlhvrgg
00501571   1/1  aavileppqnptGvvlpspeyleelaelarehgallivDeayagfgrtglpfap....ealgvdivigsl
00461651   1/1  lgdplel.........gadivvgslsKtlngpgGlrgGalvgnde.....liealrkvrrglggtlspla
00412601   1/1  alvvvDeayatpvlgd........plelgadivvhSlsKalggagdlriGyvvgnde.....lidalrkl
00494861   1/1  pg..lgvsvaeldgaegadvvsfslhKtlggpg..gGallvrdelaealpllrgggg...etgrrsglla
00380341   1/1  hkhgalvivDeayatgvlgd........plalgadivvgslsKalggpgdrlgGyvvgsde.....liea
00489521   1/1  elakehgallivDeayaggal..gdplel......gadivvgslsKalggpaGlrgGalvgnd.elieal
00511951   1/1  eaiaelahehgallivDeayaagvlgd......plel..gadivvgslsKalggpgdlrgGylvgs.eel
00448071   1/1  gd.....ldal..gvdivvfslhKalg.gglglGallvse.....ellerlrpllsggtslyldlllllk
00485711   1/1  lvfsggyhgntlallaltgpgdevlvpdplypgylhaallagarvvfvpldvdedghldlealeaaleel
00462061   1/1  .....ldpldlg.advvvhsttKklgghggvrgGylvgnpel.....laallkvlprllggplspfqaal
00408971   1/1  rhpgsl.....gadivsfsasKt..ltggggGavvtndeelaerlrklrnhglsrgllllvlaalllrye
00440831   1/1  aektkaiileppanptGvlplspadlkaireiadkhgillivDeahaaglaytgklfgseyagvaigelv
00507541   1/1  .dgridlealeaaide......rtaavvltnpnnptGviep...leeiaelahehgallivDeayagglg
00473401   1/1  Deayaagllgd......plel..gadivvgslsKylgghgdlraGylagre.elidklrgllvg...lgg
00520701   1/1  prtklvvlesvnnptGtiap...lkeiaeladeygallivDeahaggvlgrtgrglaehlgvepdadivv
00367801   1/1  gtvld...leeiaelahenhgalvivDeayaagvlld......plel..gadivvgslsKylggpgdlrg
00480741   1/1  l.....dplel..gaDivvfslhKalg.gppgvGallvr.kelieklrpllpgglldlvlalkylgavlg
00417041   1/1  lk.......aggfggadifsfslsKtl..gggggGalltndeelaerlrplrlggisidlkylvqelgfn
00460871   1/1  ..evgapktkliilenpvnpaGgsvysladlkaireiAdkyglllivDaAraagalyaggvtgspyafrs
00487471   1/1  p........lelgadivvfSfsKalgGptGlrgGalvgndelieallkllrgggg......ggtlsplaa
00467471   1/1  kpkliivegvfsmtGdiap...lkelreladkygallivDeahaggvlgatGrgl.lehlgvlpdadivt
00465471   1/1  dallivDaaqaagvlpld.......ldelgvDfvvfsghKal..gppgiGalyvrkelllrpllvgggqe
00500761   1/1  algalgvdlaeldgaegaDsvsfslhKglgapg..ggallgrdeliekarllrkrlgg...llrqaglla
00352461   1/1  edLeklikeh...gadniaavileptqnptGgqvpsleylkelreiakkhgillilDearlaenayfgfg
00364061   1/1  snptGvvad...lkeiaelaheygallivDeahaagllgld..grppgel..gaDivtgslhKtl..gGp
00474411   1/1  lp.....ldldel..gvdvvvgslqKalg.gppglGflavspellerlep.lsgylglallldlqekrfe
00453921   1/1  vpyp.......dlealeaaie.....pdtvaavivepvqgegGvivpppeflkalrelcrkhgillivDE
00523021   1/1  snptGtvad...leaiaelakkhgilvivD----------------------------------------
00465841   1/1  dlsallivDaaq.avgalg....ldlagl..gvDivvfslhKalg.gpggiGalyvrk....elldrlrp
00517571   1/1  ggpllpsplel..gaDivvgSlhKtl..gGprgGyiagk.kelieklrkvfpglg....gspsplvaaal
00428091   1/1  ..hgekiaavivepvvqgegGvivpppeflkalrelcdkhgilliaDEvqtgfgrtgklfafehagvt..
00459091   1/1  lgalykgkkvgsf.......gdivvfSfsktKnltggegGaivtndkelaeklrllrnhgtsksyhglky
00460071   1/1  ggvlgrtgrgl.lellgl..gadivvgtlsKal..Gg.rgGavlg.seelidalrplargg...tfsgsl
00421441   1/1  hgallivDaaqaagalpl.....dlgel..gaDivvfsahKyl..ggpglGallvrd.ellerlrpllhg
00507531   1/1  d.......dlealeaalde......dtaavllehp.nptGvvld...laalaelahaaGallivDaaqaa
00401341   1/1  allivDeAhaagl.lalglhglple...gadivvgslhKtl..gGprgGailvrd.elaeklrsllfgg.
00495241   1/1  ai......tpkTklvalvhpsnptGvvlp...leeiaelahehgalvivDaaqaagalpid........l
00476701   1/1  eeiaeicrehgiwlhvDaAygggalpfpeyrll.ldgiegaDsitfslhKwlgvp.lgcgallvrdkell
00475811   1/1  g....vslaelaglvdsvsvglsKgl..------------------------------------------
00459731   1/1  e.....pktkaiiv..vasnp.Gviad...leeiaeiakkhgallivDaAh.algavgldvlp..gplg.
00435831   1/1  lfafehagvvPDivt....laKglg.gGlPlgavlgsaeimdalap......llhggtfggnplacaaal
00423831   1/1  glgiwlhvDaAyggfllpfleklrpldfglpgvdsisvsghK.yglaplgcGvvlvrdkellrealsvna
00470951   1/1  ahehgallivDavqs........lgalpidvdelgvDflvssshKgl.ggppGlGflyvsekalerlknr
00521641   1/1  d.....vdelg..vDllvasahKgl.ggppGlGflyvse.dllerleplllgggslyldlkllldyllay
00490701   1/1  lthvsnptGvlld...ieaiaalahehGallivDaaq........aagllpldvgelgaDfvvfsghKtl
00529431   1/1  gdeiaavivepvqgegGvivpppgflealrelcdehgallivDEvqtGfgrtg.lfafehfgvtpdiv..
00527311   1/1  ----------------------------------------------------------------------
00521571   1/1  ivepvqgegGvippppgylkalrelcdkygallivDEvqtgfrtgk....lfafehfgvvpdiv.tlgKa
00460561   1/1  valthvsnvtGvilp...laeiaalahehgalvlvDaaqaagalpl.....dlgel..gaDfvvfsghKl
00461541   1/1  pdaleealr......ertpaiivag.vsaygrlad...lkelreiadevgallivDaAhaaGlvaagvlp


                         -         *         -         -         -         -         +:350
query           PAEIVDLVARSRRLHGLVARAVAERFRAAGVPVIAPQAAFYLYPDFGVWREWLGEAHGVTTGPELTRMLL
00389521   1/1  lvakpp.....eliealrklrsp..lsvsslaqaaaaaaledggfleehleelrerlrerrdllleaLee
00354011   1/1  lGylvappe.....liealrklksa.tlsvstlaqaaaaaaledgelleehleelrerlrerrdllleaL
00456391   1/1  lisalkklkrpltsnpptlaqaaaaaalsdpelreewleeleelrerlkerrdllveaLkklptpggldv
00509771   1/1  kslltlgvstlaqaaaaaaledg...eehleelrarlrerrdllvealeelpglevlkpsggfflwldlp
00528621   1/1  aqaaaaaaledg...eehleelrerlrerrdlllealkelgglsvvkpsggfflwldlpell......ll
00452311   1/1  fSKafglaGlRvGylvappelieallkvlsqlklliralpsnpptlgqaaaaaalsdpelralwleelee
00462551   1/1  aaaallaygggeehleelrarlrerrdlllealeellpgllvvkpeggfflwldlpell.........ld
00503901   1/1  Gyvvappe.....liealrklrsaltlgvsplaqaaaaaaledgelrlerleehleelrarlrerrdlla
00460891   1/1  lkspltlglvstlaqaaaaaaledg...eeyleelrarlrerrdlllealkellpglkvlppegafflwl
00428061   1/1  kvlsqlklliraltsnppalaqaaaaaalsdgellelwleeleelrerlaerrdllveaLaelggpgdld
00460241   1/1  rklkgggllraltlsvstlaqaaaaaaledg..leehleelrerlrerrdllaealeelpglevvppegg
00451711   1/1  irgltlnpptlaqaaaaaaledgalreeweeeleelrarlrerrdllvealaelplpgglevvvpqggmf
00513231   1/1  e.....liealrklksalglgvstlaqaaaaaaledgllglegdeehleelrerlrerrdllaeaLeelg
00507681   1/1  ylvappe.....liealrklrslltlgvsslaqaaaaaaled.glydehleelrallrerrdllleaLee
00350731   1/1  ....ppelieallrvksqlkllirslysnpptlgqaaaaaaLsdpelraewleeleemrarlkerrdllv
00393411   1/1  aalaaaledg...eehleelrerlrerrdllaeaLaelpgvevvgppggfflwvdlpgl.........gl
00445231   1/1  s....dldyleelrerlrerrdllveaLaelglevlppeggfylfldls............ldaeelaer
00479561   1/1  ledg....eyleelrarlrerrdllaealeelglkvlkpsggfflwldlp............ldaeelae
00469651   1/1  klrspgnssvstlaqaaaaaaledge.flehleelrerlrerrdllleaLaelglevlppeggfflwvdl
00450681   1/1  adaellaalisallklkraltsnpsslaqaaaaaalsdgellaewleeleemrerlkerrdllveaLrel
00533351   1/1  alliealrklrrpgtgspsplaqaaaaaaledlelrghwlaeleelrerlrerrdllleaLkellpllgv
00506961   1/1  klrsgltlgvstlaqaaaaaaledgg.yeehleelrarlrerrdlllealkellppglevvppeggfflw
00416741   1/1  laqaaaaaaled......eleelrerlrerrdllaeaLeelglevvgpsggfflwldl........p..g
00445951   1/1  lrslg....glgvstlaqaaaaaaledglflehleelrarlrerrdllleaLael....glrvlkpeggf
00355891   1/1  splaqaaaaaaledlelleehleelrerlrerrdrlaealaelglevvgpggglflwvdl..........
00375691   1/1  klrsp..lgvstlaqaaaaaaledg..llehleelrerlaerrdllleaLeelglvsvvgpsgglflwvd
00497541   1/1  .elidalrklrrggtftlsplaqaaalaaledl...eehleelrerlrelrdrlaeaLeelglevlvpgg
00502611   1/1  .ggglrlGalvgde.....eliealrklrhggtftgnplaqaaalaaledla.leehleelrarlrerrd
00405261   1/1  SfSKyfglaGlrlGwavvpde....elidklrklklpltigvsslaqlaalaalkdpldaylllrgesle
00358461   1/1  yiagpkelidalrfnraysllyst...spsyplqaallaalellageegeelrerlieladylrkaLkkl
00501571   1/1  sKalg.gglglGavlgsde.....ladalrplrrgltfggnplaaaaalaalellee.....eelrerlr
00461651   1/1  aaallaal...egleerrerlrenadrlaeaLaelpgvervlypgl------------------------
00412601   1/1  rgp..ltgstlspaaaaaalrg....letlelrrerlaenaallaeaLeelgpgvevvlypglppegahy
00494861   1/1  aaalaalg.....legleelaarlreladylaegLaelglelvgppganivfvdlp...gvdaee.....
00380341   1/1  lrklrlgggfg.gtlspaaaaallrgl....etlelrrarlrenadllaeaLaelpgvvlvlypglpshp
00489521   1/1  rklrsggg....gtlsplaaaallaale...gleerrerlrenadylaeaLaelggvelvlppglpshpg
00511951   1/1  iealrklllgg.....glggtlspaaaaaalagle....tleerrarlrenadrlaeaLaelggvalvgy
00448071   1/1  yeqerrfragtpnplaaaallaalellle..eglealrarlaeladylaegLeelglelvgppgrrsgll
00485711   1/1  daggdrtaavilepvqnptGvvlppeeylkelrelarkhgillivDeayagfgrtgkpf..alellgvdd
00462061   1/1  ----------------------------------------------------------------------
00408971   1/1  vlllgynyrlspiqaaallaale.......tlderlerrrenadrlaelLaelpgvelvkppglsshafy
00440831   1/1  pdlfggadivsfslsKtlg.gp.rgGailtndeeladklrklrfpgegfplgggyrgspiaaaaallal.
00507541   1/1  lgvdpgdl......gaDivtlslhKtlggpkgggGprlGallvrde.....laealplrlggggergfvl
00473401   1/1  gtlspaaaaallaale.......tlelrreralenadylaelLaelpgvylvgypglpshpghelakkvl
00520701   1/1  gtlhKal...GprgGalags.eelidalrplargg..tfsgtlnplaaaaalaalellgee..gleelre
00367801   1/1  Gyvagsee.liealrklrpggglg..gtlspaaaaallrgle.......tlelrreraqenadylaelLe
00480741   1/1  fftgtpnilgiaalaaalellgeeg.gleeilerlreladylyeglkelglellgpdgrgrggivsfrlp
00417041   1/1  sgtspiaaaaglaal.......egleeilerrreladylaeaLkelpglelvgppglsaphlfpvllplp
00460871   1/1  igeivdeifgyadivsfslsKglg..gprgGaivtndeelakkarklrfpgegfllgggprqhgiaaaaa
00487471   1/1  aallaaletleerlerlrenadllaeaLeelpgvtlvlypglpshpg-----------------------
00467471   1/1  gtlsKalg.gg.rgGailgs.kelidklrslarpg...ifstslnplaaaaalaalelle...egeelre
00465471   1/1  rrfeagtpnvlaiaalaaalellge...gleairarlleladylleg-----------------------
00500761   1/1  aaalaalge.....egleellaranalarrlaegLaalpglelvgppetnivffrlpg............
00352461   1/1  rtgslfaleiagivpdiltladvvtfslsKgggapg...Ggvlatg------------------------
00364061   1/1  rgGyiagkdelqelieklrrlkap..lgfgtalspliaaaalaalelleegl...eelaerlvenaayla
00474411   1/1  pgtppvlaiaallaalelllee..gle.rrarlaeladalraglealglell.pegrsggvvsfrlpdgi
00453921   1/1  vqtgfgrtgklfafehlgvt....pdivtlsKalgggglplgavlgseeiadal......gpllhggtfg
00523021   1/1  ----------------------------------------------------------------------
00465841   1/1  llhgggslilvvrfdsltlqelglrfefgtppvaaaaalgaalelleee.glleairerlreladylreg
00517571   1/1  laalktlllrgfkryleealklakalaeylyeglkklpglegfkvvspgggnilsfilpvd...lgd...
00428091   1/1  ..pdivtlsKalgggglplgavlg.seeiadalapgalgaflhggtfggnplacaaalaalelleeedll
00459091   1/1  vhlllgynyrlseiqAalglaqleklderlerrrenaklyaelLkk------------------------
00460071   1/1  nplaaaaalaalelleeegleelrerlaelaarlregLael....glevvpglglivpvel.........
00421441   1/1  gglekrfeagtpnplaiaallaalellg.e..glealraralelaeylregleelpglelvgppgrrlgg
00507531   1/1  l.....gllvdpgal..gadivvgslhKllgPhglggpgaGalavre.ellralpgrlvgvtgdadgkra
00401341   1/1  ..gfggtlspllaaallaalelleeglkerrerlvenaarlaeaLeel...gfvvvvgppdghlvsvdlp
00495241   1/1  delgaDfvvfsahKwlgppG..iGalyvrkelldkllpllrggggivlvslfgltaaeqerrfeagtpnv
00476701   1/1  rralsvdadylgslddggdgvrdlrdftlegsrrfralklwaalralgreglrelierlielarylaegL
00475811   1/1  ----------------------------------------------------------------------
00459731   1/1  gaDivsfslhKtl..ggppGGallvnd.elieklrplrvgglfdlekligrarryffsgtppgarlaala
00435831   1/1  aaldvleeegllerlaalgeylrdgllellakhplvgdvrglGlmlgielvddkltkepla...elaaal
00423831   1/1  dylggdlgsftlegsrpgaralalwaallslgregyeelverilel....arylaelLeklggfellsdg
00470951   1/1  klpplsgggdlllllkfmladqerrfeagTppvaliaalaaa----------------------------
00521641   1/1  qergf.eagTppvaliyalgaalelllee..gleairarhrel---------------------------
00490701   1/1  gggppglGflyvreellerlppllfgggtvadsfyldltlqpaeqerrfeagtpnvaliaalaaalellg
00529431   1/1  ..tlgKalg.gGlplgavlgs....aeimdalapggpglhggtfsgnplacaaalaalelleeedllerl
00527311   1/1  ----------------------------------------------------------------------
00521571   1/1  lg.gGlplgavlgseeiadalrplgpglhgstfsgnp..lacaaalaalellee.egllerlaelgaylr
00460561   1/1  ..lGppGvGflyvrk.ellerlppllvgggqvaavs----------------------------------
00461541   1/1  .spfg...gadivtftthKt..lrGprgGailtrdelldellrl--------------------------


                         -         -         -         -         *         -         -:420
query           DRYGMGVLPAVEFGESTHALRVRVATSLLYGESEAQRYSALAAEDPTALPWIRAHLDRISEVLDEVRQEQ
00389521   1/1  pglevlppegglflwvdlpalllk..--------------------------------------------
00354011   1/1  eelglevlppegglflwvdlpelll---------------------------------------------
00456391   1/1  ikpqggfflfldlpd...........--------------------------------------------
00509771   1/1  el........gledaeelaealleeagvlvrpgsafgllgpgylR-------------------------
00528621   1/1  ggddaeflarllleagvlvrpgsafgl-------------------------------------------
00452311   1/1  mrerlaerrdllveaLkelggpgdldvilpqggfflfldlpd----------------------------
00462551   1/1  daefllrllleagvavvpgsafglggeg------------------------------------------
00503901   1/1  ealeelglkvvppeggfflwvdlpelllkalalllllggldaeelaealleeagvlvrpgsafgv-----
00460891   1/1  dlpel.........gldseelaerlleeag----------------------------------------
00428061   1/1  vikpqggfflfldlpd...........-------------------------------------------
00460241   1/1  fflwvdlpelllk.....tgldaee---------------------------------------------
00451711   1/1  lwldl...............pdefvl--------------------------------------------
00513231   1/1  lkvlppeggfylwvdlpelllalkl---------------------------------------------
00507681   1/1  llppglkvlppeggfflwldl....---------------------------------------------
00350731   1/1  eaLeklggpgdldvilpqggmflfvglp..............----------------------------
00393411   1/1  daeelaeaLleeagvavrpgsafg.---------------------------------------------
00445231   1/1  llee.gvlvrpg......pgylRislatp-----------------------------------------
00479561   1/1  rllee.gvlvrpgsafgllgegylR---------------------------------------------
00469651   1/1  ..........pelgldaeelaerll---------------------------------------------
00450681   1/1  glpgdlsvikpqggfflwvglpe...............dfva----------------------------
00533351   1/1  svvlpsgglflfvdlp...............aealakllleagvlvrpgsafgvpgegylRl.....---
00506961   1/1  ldl..........pegldaeelaeallee.gvlvrpgsafgal...........................
00416741   1/1  .ldaeelaeal.leagvlvrpgsaf---------------------------------------------
00445951   1/1  flwldlp..............daela.-------------------------------------------
00355891   1/1  pdlgldaeelaeal.leagvlvrpg---------------------------------------------
00375691   1/1  lp.............daeelaeall---------------------------------------------
00497541   1/1  glflwvdlpdl........lgvdae---------------------------------------------
00502611   1/1  rlaeaLeellpdlpglevvgpggglf--------------------------------------------
00405261   1/1  tlelrrerlrerrellaeaLeelgg---------------------------------------------
00358461   1/1  ....gflflpsdspivpvilpegafylfakid................dfalllleeagvavvpgsafg-
00501571   1/1  eladylaegLaelglelvgpvrggglflfvel..........pg--------------------------
00461651   1/1  ----------------------------------------------------------------------
00412601   1/1  lalrvlklpgaggivsfelkgdaealaalldelgiavrpgslggveslii..hpastthaqlglelra--
00494861   1/1  ....laaalleagiavspg.....g---------------------------------------------
00380341   1/1  ghelakrqlpggggivsfelkgdgedae------------------------------------------
00489521   1/1  hylavrlprglglllsfelpg.daelakalldelgl.agiavsfgsapslilhpasttgshlllal----
00511951   1/1  pglpshpghelakkvlpgrggfv.sf--------------------------------------------
00448071   1/1  vsfdlpd..gvdaee........l----------------------------------------------
00485711   1/1  rpdivtlshKalg.G....Gav.gsee.....lidalrplhggt.fsgn---------------------
00462061   1/1  ----------------------------------------------------------------------
00408971   1/1  lfailvlllglg......ldrdelaeaL.eeagiavvpgyaplhlqpayttglrlgdlpvaegl------
00440831   1/1  elleellerrven....akylaeaLeelgvpvvgpvgghgvfld--------------------------
00507541   1/1  tldreqairrglagtgnalaiaaaaaalrllgee..glkelaer--------------------------
00473401   1/1  pgrggfvsf........dlkg..gv---------------------------------------------
00520701   1/1  rlralaaylaegLaelglpvvgglgaivlvdlgd...gvdaka.--------------------------
00367801   1/1  elglvvlvyypglpsgafyllaklp.--------------------------------------------
00480741   1/1  .........dgidaaakalakalleag-------------------------------------------
00417041   1/1  eltelllplgglllwlfllegidreelakalleagiavrpgsaplhplpaylgyvlgalpvaer------
00460871   1/1  llala.eleeylerrhe....narylaeaLkelgipvvgptgghlvfvdlrkllphipg-----------
00487471   1/1  ----------------------------------------------------------------------
00467471   1/1  rlrenaeylregLeelglpvgpsdghivlvdl...........gdgllakala-----------------
00465471   1/1  ----------------------------------------------------------------------
00500761   1/1  ...ellerller.giavspg.....sagpgvlRlvtslatteed--------------------------
00352461   1/1  ----------------------------------------------------------------------
00364061   1/1  egLkelgfvvvvgppgghivlvdlpg.........dgidakalakaL.eeagiavrpgsfptvpegsgvt
00474411   1/1  daaalakal.eeagiavspgsafl....................................aggtlRi---
00453921   1/1  gnplacaaalaalelleeeellerlrelgdyllegleell.lplvgdvr---------------------
00523021   1/1  ----------------------------------------------------------------------
00465841   1/1  Leelpglelvgppggrgpivsfelpg.........gvdaeelakaLdeagiavragsap.......----
00517571   1/1  gidalelaklllelygiavspgshp---------------------------------------------
00428091   1/1  erlaelgarlregleelaahplvgdvrglglmlgielvdd.........---------------------
00459091   1/1  ----------------------------------------------------------------------
00460071   1/1  ..gdgldalalaeall.erGilvrpisypavplgegrlRlslgl--------------------------
00421441   1/1  ivsfel..............pgvdaedllllergiavspgsacslgllppslvll..............-
00507531   1/1  lrlalqtreqhirrekgtsnictpng--------------------------------------------
00401341   1/1  gl.........gidaldlakaL.eeagiavrlgshPavptgar......................apgr-
00495241   1/1  aaiaalaaal------------------------------------------------------------
00476701   1/1  relpgfellgepelglvvfrlkpa.---------------------------------------------
00475811   1/1  ----------------------------------------------------------------------
00459731   1/1  aalgllglegleerlerrrelakylaegLkelglev----------------------------------
00435831   1/1  lrlllerGvllrpgglfg.....nvlrlrppliiteeeldeale--------------------------
00423831   1/1  epalpvvafrlkpg..................dallplldaad........lserllergwvvpayllpt
00470951   1/1  ----------------------------------------------------------------------
00521641   1/1  ----------------------------------------------------------------------
00490701   1/1  legleaiaarhleladylaegLaalpavpglellgppdaarrgglvsfrlp..g........aealaka-
00529431   1/1  aelgeylregleellakhplvgdvrglGlmlglelvkdkgtnilfvllp---------------------
00527311   1/1  ----------------------------------------------------------------------
00521571   1/1  egleellakhplvgdvrglGlmlglelvadkgtnivfvllp........---------------------
00460561   1/1  ----------------------------------------------------------------------
00461541   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           PAVAVPAMAS------------------------------------------------------------
00389521   1/1  ----------------------------------------------------------------------
00354011   1/1  ----------------------------------------------------------------------
00456391   1/1  ----------------------------------------------------------------------
00509771   1/1  ----------------------------------------------------------------------
00528621   1/1  ----------------------------------------------------------------------
00452311   1/1  ----------------------------------------------------------------------
00462551   1/1  ----------------------------------------------------------------------
00503901   1/1  ----------------------------------------------------------------------
00460891   1/1  ----------------------------------------------------------------------
00428061   1/1  ----------------------------------------------------------------------
00460241   1/1  ----------------------------------------------------------------------
00451711   1/1  ----------------------------------------------------------------------
00513231   1/1  ----------------------------------------------------------------------
00507681   1/1  ----------------------------------------------------------------------
00350731   1/1  ----------------------------------------------------------------------
00393411   1/1  ----------------------------------------------------------------------
00445231   1/1  ----------------------------------------------------------------------
00479561   1/1  ----------------------------------------------------------------------
00469651   1/1  ----------------------------------------------------------------------
00450681   1/1  ----------------------------------------------------------------------
00533351   1/1  ----------------------------------------------------------------------
00506961   1/1  ----------------------------------------------------------------------
00416741   1/1  ----------------------------------------------------------------------
00445951   1/1  ----------------------------------------------------------------------
00355891   1/1  ----------------------------------------------------------------------
00375691   1/1  ----------------------------------------------------------------------
00497541   1/1  ----------------------------------------------------------------------
00502611   1/1  ----------------------------------------------------------------------
00405261   1/1  ----------------------------------------------------------------------
00358461   1/1  ----------------------------------------------------------------------
00501571   1/1  ----------------------------------------------------------------------
00461651   1/1  ----------------------------------------------------------------------
00412601   1/1  ----------------------------------------------------------------------
00494861   1/1  ----------------------------------------------------------------------
00380341   1/1  ----------------------------------------------------------------------
00489521   1/1  ----------------------------------------------------------------------
00511951   1/1  ----------------------------------------------------------------------
00448071   1/1  ----------------------------------------------------------------------
00485711   1/1  ----------------------------------------------------------------------
00462061   1/1  ----------------------------------------------------------------------
00408971   1/1  ----------------------------------------------------------------------
00440831   1/1  ----------------------------------------------------------------------
00507541   1/1  ----------------------------------------------------------------------
00473401   1/1  ----------------------------------------------------------------------
00520701   1/1  ----------------------------------------------------------------------
00367801   1/1  ----------------------------------------------------------------------
00480741   1/1  ----------------------------------------------------------------------
00417041   1/1  ----------------------------------------------------------------------
00460871   1/1  ----------------------------------------------------------------------
00487471   1/1  ----------------------------------------------------------------------
00467471   1/1  ----------------------------------------------------------------------
00465471   1/1  ----------------------------------------------------------------------
00500761   1/1  ----------------------------------------------------------------------
00352461   1/1  ----------------------------------------------------------------------
00364061   1/1  sglr------------------------------------------------------------------
00474411   1/1  ----------------------------------------------------------------------
00453921   1/1  ----------------------------------------------------------------------
00523021   1/1  ----------------------------------------------------------------------
00465841   1/1  ----------------------------------------------------------------------
00517571   1/1  ----------------------------------------------------------------------
00428091   1/1  ----------------------------------------------------------------------
00459091   1/1  ----------------------------------------------------------------------
00460071   1/1  ----------------------------------------------------------------------
00421441   1/1  ----------------------------------------------------------------------
00507531   1/1  ----------------------------------------------------------------------
00401341   1/1  ----------------------------------------------------------------------
00495241   1/1  ----------------------------------------------------------------------
00476701   1/1  ----------------------------------------------------------------------
00475811   1/1  ----------------------------------------------------------------------
00459731   1/1  ----------------------------------------------------------------------
00435831   1/1  ----------------------------------------------------------------------
00423831   1/1  ----------------------------------------------------------------------
00470951   1/1  ----------------------------------------------------------------------
00521641   1/1  ----------------------------------------------------------------------
00490701   1/1  ----------------------------------------------------------------------
00529431   1/1  ----------------------------------------------------------------------
00527311   1/1  ----------------------------------------------------------------------
00521571   1/1  ----------------------------------------------------------------------
00460561   1/1  ----------------------------------------------------------------------
00461541   1/1  ----------------------------------------------------------------------