[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ56387.1


[Show Plain Result]

## Summary of Sequence Search
   1::134
   1::129  1.1e-19 25.9% 0048855 00488551 1/1   alase/Bleomycin resistance protein/Dihy 
   1::129  1.9e-18 26.0% 0047830 00478301 1/1   alase/Bleomycin resistance protein/Dihy 
   1::129  3.9e-18 25.4% 0043737 00437371 1/1   alase/Bleomycin resistance protein/Dihy 
   1::128  5.6e-18 28.0% 0049683 00496831 1/1   alase/Bleomycin resistance protein/Dihy 
   1::130  1.2e-17 25.6% 0046683 00466831 1/1   alase/Bleomycin resistance protein/Dihy 
   2::129  2.9e-17 25.9% 0046521 00465211 1/1   alase/Bleomycin resistance protein/Dihy 
   1::129  1.1e-16 27.4% 0048208 00482081 1/1   alase/Bleomycin resistance protein/Dihy 
   1::130  1.6e-16 25.4% 0048209 00482091 1/1   alase/Bleomycin resistance protein/Dihy 
   2::129  3.2e-16 29.9% 0049725 00497251 1/1   alase/Bleomycin resistance protein/Dihy 
   1::128  6.9e-16 27.6% 0048412 00484121 1/1   alase/Bleomycin resistance protein/Dihy 
   1::129    9e-16 24.0% 0051634 00516341 1/1   alase/Bleomycin resistance protein/Dihy 
   1::129  9.9e-16 30.4% 0049133 00491331 1/1   alase/Bleomycin resistance protein/Dihy 
   1::128  1.1e-15 23.7% 0049036 00490361 1/1   alase/Bleomycin resistance protein/Dihy 
   1::130    5e-15 22.7% 0047894 00478941 1/1   alase/Bleomycin resistance protein/Dihy 
   1::129  7.3e-15 22.8% 0047893 00478931 1/1   alase/Bleomycin resistance protein/Dihy 
   1::130  7.3e-15 27.0% 0048964 00489641 1/1   alase/Bleomycin resistance protein/Dihy 
   1::129  2.4e-14 26.1% 0047984 00479841 1/1   alase/Bleomycin resistance protein/Dihy 
   1::130  3.2e-14 23.1% 0046682 00466821 1/1   alase/Bleomycin resistance protein/Dihy 
   1::126  4.3e-14 25.9% 0051065 00510651 1/1   alase/Bleomycin resistance protein/Dihy 
   1::131  8.1e-14 25.2% 0049803 00498031 1/1   alase/Bleomycin resistance protein/Dihy 
   2::129  1.7e-13 24.3% 0046737 00467371 1/1   alase/Bleomycin resistance protein/Dihy 
   1::127  4.9e-13 24.5% 0046043 00460431 1/1   alase/Bleomycin resistance protein/Dihy 
   1::128  6.5e-13 18.6% 0044219 00442191 1/1   alase/Bleomycin resistance protein/Dihy 
   7::126  2.2e-12 26.7% 0046684 00466841 1/1   alase/Bleomycin resistance protein/Dihy 
   7::126  2.3e-12 26.7% 0048015 00480151 1/1   alase/Bleomycin resistance protein/Dihy 
   1::130  2.5e-12 26.4% 0047558 00475581 1/1   alase/Bleomycin resistance protein/Dihy 
   1::126    5e-12 24.8% 0051145 00511451 1/1   alase/Bleomycin resistance protein/Dihy 
   2::126  2.1e-11 25.0% 0052095 00520951 1/1   alase/Bleomycin resistance protein/Dihy 
   1::129  1.4e-09 26.2% 0049443 00494431 1/1   alase/Bleomycin resistance protein/Dihy 
   2::127  4.7e-09 22.3% 0053079 00530791 1/1   alase/Bleomycin resistance protein/Dihy 
   7::126  2.9e-08 26.2% 0047985 00479851 1/1   alase/Bleomycin resistance protein/Dihy 
   2::127  1.5e-07 28.5% 0049535 00495351 1/1   alase/Bleomycin resistance protein/Dihy 
   7::130  3.3e-06 21.4% 0051635 00516351 1/1   alase/Bleomycin resistance protein/Dihy 
   1::128  0.00013 20.5% 0049800 00498001 1/1   alase/Bleomycin resistance protein/Dihy 
   1::126   0.0003 29.6% 0049436 00494361 1/1   alase/Bleomycin resistance protein/Dihy 
   1::127  0.00061 25.0% 0049435 00494351 1/1   alase/Bleomycin resistance protein/Dihy 
   6::126  0.00071 26.7% 0049534 00495341 1/1   alase/Bleomycin resistance protein/Dihy 
   1::134


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTRKIFVNVAVQDLQKSQEFFTALGFRFDPRFTDTNAACMVINDDCAVMLLTRDFFRRFTRKELVDAAKN
00488551   1/1  mmimgldhvvlpvpDleaalaFYtdLGfevverfpdpdggvyyaflrl.ggahlelalap..........
00478301   1/1  M.gldhvalpvsDleaalaFYtdLGfelvdrtddggyaflrlgggavlelllppdgespiakf.lpaggg
00437371   1/1  MknpvmllrldhvalavsdleraiaFYedLGfevvaredddgeltllllglpgggvrvaflrlgggeirl
00496831   1/1  MkmkllhiaLrvdgdleealaFYtdvLgfelvrrvpdpggaflglgggvllalltlgglalmasdggpda
00466831   1/1  GmimgldhvvlpvsDleaalaFYtdLGfelvertpdpdggvtyaflrl.ggthlelalap..........
00465211   1/1  -mkllhvvlpvkdleaslaFYelLGfevvfrfdd...yaflrlgglvlelleapg..........dppgg
00482081   1/1  mmmgitglghvvlrvsDleaalaFYtdvLGfelvdr.gddgvaflrlgdgglvlalvlp...........
00482091   1/1  MgitgldhvvlrvsDleaalaFYtdvLGfelvertddpdggvtyaflrlggggielalfegp........
00497251   1/1  -kmmsvmglmgihvalrvsDleaalaFYtdvLGfelvdrfddpdgfgyaflrlggggivlalteapdgap
00484121   1/1  milgldhvvlpvsDleaalaFYtdvLGfelvdrgdd..yaflrlggthlelalapg.......pdppdag
00516341   1/1  MtgilgldhvalrvsDleaalaFYtdvLGfelvdrvpdlddggvtlaflglggggiglaltlppgpeapp
00491331   1/1  MilgldhvvlavsdleaaaafytdvLGfelvervddetggtalsaflrlggtrlelllpedpepp.....
00490361   1/1  MikilglhvalpvsDleaalaFYtdvLGfelvergdd...yaflrlggavlelalapgpepaaa......
00478941   1/1  msgppmgimgldhvvlrvsDleaalaFYtdvLGfelvdrfvleglddggvrlaflrlggghlelalapg.
00478931   1/1  pimglghvvlrvsDleaalaFYtdvLGfelvdrdd..gyaflrlggghlelalvpgp.............
00489641   1/1  nglllellldlllpasepmmilgidhvalpvsDleaaaaFYtdvLGfelvervdfpdggfrlaflrlggg
00479841   1/1  SimglghvalrvsDleaalaFYtdvLGfelvdrtd..glaflrlgggglelalt.............pap
00466821   1/1  lplpaspvpapmgimglghvvlrvsDleaalaFYtdvLGfelvdr.gggyaflrlgdggavlelalppgp
00510651   1/1  mmglghvvlrvsdleaalaFYtdvLGfelvdrdd..glaflrlgdgglvlalv..........ppapagg
00498031   1/1  ll.iihvaLrvdgdleealaFYtdvLGfellrrldfpeagaftlvflglgggvlhaeltlggtlllllda
00467371   1/1  -mgldhvvlrvsDleaalaFYtdvLGfelverfdledggvgyaflrlgggahglvlelfeppdgap....
00460431   1/1  vmmilgldhvalpvsDleaalaFYtdvLGfelvdrgdd...yaflrlggtvlelalapgpepp.......
00442191   1/1  mmmmkitpylvfngadaeeAlaFYksvfgasevlrltrygdapegpagkvmhaeltlggqllmaldagpe
00466841   1/1  ------vlprpllpmmgilrlghvvlrvsDlekaraFYtdvLGlevvdr..deglvflrlggggdhhsla
00480151   1/1  ------mitgldHvvlrVsDleaslaFYrdvLGfrlvertd..glaflrlggghlllllllleapg....
00475581   1/1  mkpmilgldhvalavsDleaalaFYtdvLGfelvarvdledggvrlaflglavlaglggirlelleppgp
00511451   1/1  gmmltkigrmlhvg..vldvedalaFYtdvLGfelvrrfdfpdappgglaggvtlaflglggstlallea
00520951   1/1  -pmgldhvvlrvsDleaalaFYtdvLGfelvervddpdggvgyaflrlgggadghvlelteppdpapp..
00494431   1/1  gplpnpmgllgidhvalavsDleaalaFYtdvLGfelvarvdledggfglaflalgdggirlelteplge
00530791   1/1  -MklihvalavsdleaaiaFYedvlgfevlre..lggyaelrlggatlalvlakd.......apvppggg
00479851   1/1  ------rvslrvmgilglghvvlrvpDldkalaFYtdvLGfelvdrvddlllpgggfrlaflrlggdhhs
00495351   1/1  -pmgllgidhvvlalavgdldaalafYtdvLGfelvarfrdldvegpeggfrsaflrlpdggirleLtep
00516351   1/1  ------lplllalmmitglghvtlrVsdleealaFYtdvLGlelvkrtdn..yhlflgaggghhglalfe
00498001   1/1  m..kitpyLvfdgdaeeAleFYksvFgaelvlrvlrygedlppgpdgkvmhaeltlggqvlmasdggpdf
00494361   1/1  mslpalpnpmgilgldhvglavpDleaalafYtdvLGfelvarveledggtslaflglglgdirlellap
00494351   1/1  manpmgllgidHvalaVpDleaalaFYtdvLGfelvayfdskdvetpeggfrsaflrlpgggirleLtep
00495341   1/1  -----nplgllgldhvvlavgdleaaaafYtdvlGfelvarhdsedgkvalavlllrqgg..ivlelnep


                         -         -         *         -         -         -         -:140
query           TESIISVSADRKEEVDELVNRAFEAGARPSIDPIENEGMYAWGFQDLDGHLWEVVWMDPRALEA------
00488551   1/1  ..agggglhhlafevdsredldaalarlkaaGvpaevlgepgdhgpgggrsayfrDPdG-----------
00478301   1/1  glvhlafevdsrddldaavarlkaaGvevlgepgdrpgggrsayfrDPdGnlielvepg-----------
00437371   1/1  elleppdpdsaiaeflakphggglvhlafevdD...idaavarlraaGvevlgeptdgp-----------
00496831   1/1  gg..gvhlalevddreevdalyerllaaG.tvvmpptdtpwggrfayvrDpdGnlwel------------
00466831   1/1  ..gpepglhhlafevdsredldaavarlkaaGvrlevlrgpgdhpggggrsayfrDPdGn----------
00465211   1/1  ggvhlafevdd...vdaayarlkaaGvevllepvlrltepvdepwggreayvrDPdGnl-----------
00482081   1/1  pagggglhhlafevpsrddldaavarlkaaGvevlrepgdrpygsgrsayfrDPdGnli-----------
00482091   1/1  ....gggglhhlafevddldaldaavarlraaGvevlgepgdhpggggrsayfrDPdGnl----------
00497251   1/1  aaa......gpglhhlafevddreeldaavarlkaaGvevvgepgdpgggrsayfrDPd-----------
00484121   1/1  ggglhhlafevds.edldaavarlkaaGvevleep..pgggrsayfrDPdGnlielve------------
00516341   1/1  aa...lgggglhhlafevddldaldallarlkaaGvevl.epgdrpggrsayfrDPdGn-----------
00491331   1/1  .......gvhhiafrvdd.edldaaverlkaaGvevlgepiregdggrvfyfrdpdgnl-----------
00490361   1/1  .....vhlafevddldavlarldrllaaGvtiliepgvrepgdhpggrsayfrDPdGn------------
00478941   1/1  ..........pgggglhhlafevddldaldaalarlkaaGvevlgpprdgpgggrsayfr----------
00478931   1/1  ggglvhlafevpsrddldaalarlkaaGvevlggpgdrpggrrvlysayfrDPdGnlie-----------
00489641   1/1  vhdpldlllivalalsggtvlelteapgpeppsqilaplgnlggvglhhlafevdD....----------
00479841   1/1  gpglhhlafevdsrddldaalarlkaaGvevlgepgdrpggrrvfysayfrDPdGnlie-----------
00466821   1/1  ep............glhhlafevpsrddldaavarlkaaGvevlrgpgdhpyGvgrsayf----------
00510651   1/1  gglvhlafevpsrddldaalarllaaGvtvleep..pgggrsayfrDPdGnlielv--------------
00498031   1/1  gpeeppeagggvhlafsvddvdevda.yarllaaGgevlmpptdtpwggrfayfrDpdGnl---------
00467371   1/1  ...appgpglhhlafevdd...ldaavarlkaaGvevleepgdhpgggvrsayfrDPdG-----------
00460431   1/1  ....glvhlafevdd...ldaalarlkalglellalaGvevlgepgdrpggrsayfr-------------
00442191   1/1  faftfpea.........vslylsvddvdeadr.lakalaagGkvlmpledtfwggrfg------------
00466841   1/1  lteg...........pap..glahlafevdsrddldaaaarlraaGvevlrgpgdh--------------
00480151   1/1  .........ggglghlafsvddldaalarlraagvevlegpvdrgggrslyfrDPd--------------
00475581   1/1  espia.efldkhggpvglhhiafrvdd...vdaavarlkaaGvevlgepgdrpggggevr----------
00511451   1/1  pdggpapagnp....gvglvhlafevd...dvdaavarlkaaGgvevlgppgdrpg--------------
00520951   1/1  .....phgtglhhlafevdd...ldaavarlkaaGvevleep...gggrsayfrDP--------------
00494431   1/1  pdspaaefldkhgpgvhhlafrvdD...vdaavarlraaGveilgepvryydepgglrs-----------
00530791   1/1  gvhlafev.....ddvdaayerlkalGveilreptdepwglreavvrDPdGnlielv-------------
00479851   1/1  lalvpgpep............gglhhlafevddlddldaaadrleaaGvev.lgpp--------------
00495351   1/1  lgpdgrspiaeflekhlgpgvqhiafrvd...DidaavarlkaaGvevleePrtyyd-------------
00516351   1/1  wpgapap....rpgtgglhHlafrvddredldaalerlkaaGvpvl.gpvdhgggrsiyf----------
00498001   1/1  pfgegvslslnvddqeevdalfaalvagG........fwgdrfGw.lkDpfGvsWqiv------------
00494361   1/1  pdpgpvlelthnlgvesldlldlspaaaflerhgpglahia......frVd.d...--------------
00494351   1/1  lgteddpsqiaeflekhlgpGvqh....iafrvd...DidaaverlraagllgGvev-------------
00495341   1/1  lgedgpaasqiaeflaahgpgvqhialrvd...DvdaavarlvaaGaevleppady--------------