[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ56417.1


[Show Plain Result]

## Summary of Sequence Search
   1::284
  36::252  4.3e-61 35.3% 0039041 00390411 1/1   p containing nucleoside triphosphate hy 
  12::252  1.1e-58 35.7% 0042280 00422801 1/1   p containing nucleoside triphosphate hy 
  20::255  5.2e-57 34.1% 0049080 00490801 1/1   p containing nucleoside triphosphate hy 
  19::255  1.1e-56 33.9% 0051025 00510251 1/1   p containing nucleoside triphosphate hy 
  29::270  1.1e-56 33.5% 0037958 00379581 1/1   p containing nucleoside triphosphate hy 
  31::275  1.7e-56 31.4% 0045860 00458601 1/1   p containing nucleoside triphosphate hy 
  27::267    7e-56 31.8% 0047589 00475891 1/1   p containing nucleoside triphosphate hy 
  32::255  1.1e-55 35.6% 0037898 00378981 1/1   p containing nucleoside triphosphate hy 
  19::266  8.1e-55 31.6% 0047599 00475991 1/1   p containing nucleoside triphosphate hy 
  30::255  1.8e-54 33.2% 0048220 00482201 1/1   p containing nucleoside triphosphate hy 
  35::265  2.1e-54 36.3% 0040410 00404101 1/1   p containing nucleoside triphosphate hy 
  33::252  2.4e-54 37.5% 0036790 00367901 1/1   p containing nucleoside triphosphate hy 
  32::255  3.7e-54 34.7% 0042070 00420701 1/1   p containing nucleoside triphosphate hy 
  27::255  4.9e-54 33.3% 0050044 00500441 1/1   p containing nucleoside triphosphate hy 
  36::252  5.9e-54 38.7% 0046693 00466931 1/1   p containing nucleoside triphosphate hy 
  31::255  1.1e-53 34.2% 0048226 00482261 1/1   p containing nucleoside triphosphate hy 
  15::255  2.7e-53 32.4% 0053059 00530591 1/1   p containing nucleoside triphosphate hy 
  31::255  2.9e-53 34.2% 0050274 00502741 1/1   p containing nucleoside triphosphate hy 
  24::259  1.7e-52 35.9% 0036121 00361211 1/1   p containing nucleoside triphosphate hy 
  28::253  1.9e-52 33.2% 0046697 00466971 1/1   p containing nucleoside triphosphate hy 
  33::255  3.1e-52 36.1% 0042557 00425571 1/1   p containing nucleoside triphosphate hy 
  23::263  5.6e-52 32.8% 0044086 00440861 1/1   p containing nucleoside triphosphate hy 
  33::255  8.8e-52 35.8% 0050943 00509431 1/1   p containing nucleoside triphosphate hy 
  32::259  6.6e-49 33.0% 0049825 00498251 1/1   p containing nucleoside triphosphate hy 
  20::282  1.9e-48 36.3% 0036748 00367481 1/1   p containing nucleoside triphosphate hy 
  31::240  6.8e-48 36.7% 0043607 00436071 1/1   p containing nucleoside triphosphate hy 
  20::258    1e-47 38.8% 0037230 00372301 1/1   p containing nucleoside triphosphate hy 
  13::253    1e-46 33.8% 0042496 00424961 1/1   p containing nucleoside triphosphate hy 
  26::257  3.2e-45 32.3% 0049537 00495371 1/1   p containing nucleoside triphosphate hy 
  31::269  8.4e-45 35.8% 0046945 00469451 1/1   p containing nucleoside triphosphate hy 
  32::255  1.6e-44 35.6% 0046869 00468691 1/1   p containing nucleoside triphosphate hy 
  23::277  6.3e-44 30.0% 0048852 00488521 1/1   p containing nucleoside triphosphate hy 
  35::268  7.3e-44 33.5% 0049611 00496111 1/1   p containing nucleoside triphosphate hy 
  31::253  1.4e-43 41.1% 0042214 00422141 1/1   p containing nucleoside triphosphate hy 
   1::256  1.8e-43 35.1% 0037960 00379601 1/1   p containing nucleoside triphosphate hy 
  39::269  1.4e-42 32.1% 0048545 00485451 1/1   p containing nucleoside triphosphate hy 
  23::257  1.9e-40 32.1% 0050061 00500611 1/1   p containing nucleoside triphosphate hy 
  32::235    4e-40 37.8% 0043651 00436511 1/1   p containing nucleoside triphosphate hy 
  50::255  5.1e-40 37.6% 0046860 00468601 1/1   p containing nucleoside triphosphate hy 
  32::251  2.1e-39 33.3% 0037163 00371631 1/1   p containing nucleoside triphosphate hy 
  48::263  5.9e-39 36.3% 0044893 00448931 1/1   p containing nucleoside triphosphate hy 
  47::255  8.5e-39 35.1% 0050337 00503371 1/1   p containing nucleoside triphosphate hy 
  26::257  1.2e-38 34.3% 0049503 00495031 1/1   p containing nucleoside triphosphate hy 
  53::255  1.2e-37 35.6% 0048593 00485931 1/1   p containing nucleoside triphosphate hy 
  32::248  3.6e-37 37.9% 0046479 00464791 1/1   p containing nucleoside triphosphate hy 
  56::257  3.2e-34 36.0% 0041412 00414121 1/1   p containing nucleoside triphosphate hy 
  29::256  9.7e-34 31.3% 0043798 00437981 1/1   p containing nucleoside triphosphate hy 
  45::255  1.3e-32 33.1% 0053253 00532531 1/1   arboxykinase-like                       
  47::273  1.9e-32 32.8% 0047537 00475371 1/1   p containing nucleoside triphosphate hy 
  36::284  7.1e-32 34.2% 0048957 00489571 1/1   p containing nucleoside triphosphate hy 
  58::212  8.7e-32 32.9% 0038144 00381441 1/1   p containing nucleoside triphosphate hy 
  43::230  5.7e-30 30.1% 0047841 00478411 1/1   arboxykinase-like                       
  56::253  6.8e-28 29.0% 0045731 00457311 1/1   p containing nucleoside triphosphate hy 
  26::156  2.5e-27 33.3% 0038720 00387201 1/1   p containing nucleoside triphosphate hy 
  52::198  5.5e-27 31.9% 0048047 00480471 1/1   p containing nucleoside triphosphate hy 
  38::239  8.2e-27 33.7% 0043440 00434401 1/1   p containing nucleoside triphosphate hy 
  42::253  9.4e-26 34.0% 0046276 00462761 1/1   p containing nucleoside triphosphate hy 
  26::257  1.3e-25 33.3% 0043794 00437941 1/1   p containing nucleoside triphosphate hy 
  45::215  2.1e-25 34.4% 0047552 00475521 1/1   arboxykinase-like                       
  59::265  8.3e-25 28.7% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
  56::244  1.9e-24 30.2% 0042605 00426051 1/1   p containing nucleoside triphosphate hy 
  33::226  4.5e-24 34.2% 0037996 00379961 1/1   p containing nucleoside triphosphate hy 
   4::271    3e-23 30.0% 0036857 00368571 1/1   p containing nucleoside triphosphate hy 
  58::231  5.7e-23 32.8% 0047538 00475381 1/1   p containing nucleoside triphosphate hy 
  50::280  7.3e-23 31.5% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
  58::278  1.8e-22 27.7% 0049657 00496571 1/1   p containing nucleoside triphosphate hy 
  56::252  1.1e-21 27.6% 0048702 00487021 1/1   p containing nucleoside triphosphate hy 
  55::239  1.7e-21 30.3% 0046441 00464411 1/1   p containing nucleoside triphosphate hy 
  35::224  2.7e-21 29.9% 0035641 00356411 1/1   p containing nucleoside triphosphate hy 
  35::243  3.1e-21 31.5% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
  27::266    5e-21 23.7% 0036850 00368501 1/1   p containing nucleoside triphosphate hy 
  57::219  1.6e-20 27.3% 0051553 00515531 1/1   p containing nucleoside triphosphate hy 
  57::221  1.7e-20 27.1% 0048410 00484101 1/1   p containing nucleoside triphosphate hy 
  49::274    5e-20 25.4% 0048025 00480251 1/1   p containing nucleoside triphosphate hy 
  56::241  7.6e-20 28.8% 0047797 00477971 1/1   p containing nucleoside triphosphate hy 
  46::249  2.7e-19 29.2% 0051056 00510561 1/1   p containing nucleoside triphosphate hy 
  57::216  2.9e-19 29.7% 0051551 00515511 1/1   p containing nucleoside triphosphate hy 
  58::250  4.2e-19 28.2% 0040588 00405881 1/1   p containing nucleoside triphosphate hy 
  58::238    1e-18 27.1% 0053247 00532471 1/1   p containing nucleoside triphosphate hy 
  46::259  5.3e-18 27.0% 0049853 00498531 1/1   p containing nucleoside triphosphate hy 
  46::259  1.3e-17 26.4% 0046895 00468951 1/1   p containing nucleoside triphosphate hy 
  36::223  1.4e-17 25.6% 0047701 00477011 1/1   p containing nucleoside triphosphate hy 
  58::256  1.7e-17 25.5% 0053350 00533501 1/1   p containing nucleoside triphosphate hy 
  43::228  2.4e-17 28.4% 0047844 00478441 1/1   arboxykinase-like                       
  53::224  5.4e-17 29.7% 0045157 00451571 1/1   p containing nucleoside triphosphate hy 
  42::242  8.3e-17 32.1% 0040678 00406781 1/1   p containing nucleoside triphosphate hy 
  42::257  2.9e-16 30.2% 0039270 00392701 1/1   p containing nucleoside triphosphate hy 
  45::254  4.3e-16 29.5% 0051325 00513251 1/1   p containing nucleoside triphosphate hy 
  52::263  5.2e-16 24.4% 0047073 00470731 1/1   p containing nucleoside triphosphate hy 
  45::225  5.3e-16 31.3% 0040419 00404191 1/1   p containing nucleoside triphosphate hy 
  52::224  7.2e-16 44.0% 0043218 00432181 1/1   p containing nucleoside triphosphate hy 
  59::262  1.5e-15 27.6% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
  36::222    3e-15 25.1% 0037926 00379261 1/1   p containing nucleoside triphosphate hy 
  57::260  9.8e-14 27.0% 0049343 00493431 1/1   p containing nucleoside triphosphate hy 
  58::231  1.2e-13 24.5% 0049919 00499191 1/1   p containing nucleoside triphosphate hy 
  55::243  3.2e-13 24.2% 0043986 00439861 1/1   p containing nucleoside triphosphate hy 
  18::260    1e-12 20.4% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
  58::241  2.3e-11 22.0% 0049881 00498811 1/1   p containing nucleoside triphosphate hy 
  45::226  2.8e-11 37.4% 0038674 00386741 1/1   p containing nucleoside triphosphate hy 
  45::252  3.3e-11 23.0% 0040237 00402371 1/1   p containing nucleoside triphosphate hy 
  46::256    4e-11 25.5% 0041053 00410531 1/1   p containing nucleoside triphosphate hy 
  46::257    5e-11 28.1% 0048255 00482551 1/1   p containing nucleoside triphosphate hy 
  42::260  1.1e-10 28.8% 0044438 00444381 1/1   p containing nucleoside triphosphate hy 
  42::91   2.3e-10 42.9% 0041032 00410321 1/1   p containing nucleoside triphosphate hy 
  54::100  2.4e-10 36.2% 0042008 00420081 1/1   p containing nucleoside triphosphate hy 
  52::240  2.8e-10 26.2% 0051138 00511381 1/1   p containing nucleoside triphosphate hy 
  52::244  7.2e-10 22.6% 0049933 00499331 1/1   p containing nucleoside triphosphate hy 
  51::223  9.1e-10 27.3% 0051769 00517691 1/1   p containing nucleoside triphosphate hy 
  51::223  1.3e-09 34.4% 0040984 00409841 1/1   p containing nucleoside triphosphate hy 
  59::210  1.3e-09 22.8% 0046916 00469161 1/1   p containing nucleoside triphosphate hy 
  36::227  2.6e-09 28.2% 0043792 00437921 1/1   p containing nucleoside triphosphate hy 
  36::222  2.9e-09 25.4% 0036729 00367291 1/1   p containing nucleoside triphosphate hy 
  56::231  4.8e-09 20.1% 0048706 00487061 1/1   p containing nucleoside triphosphate hy 
  33::222  4.9e-09 28.5% 0042094 00420941 1/1   p containing nucleoside triphosphate hy 
  51::222  5.6e-09 30.6% 0043790 00437901 1/1   p containing nucleoside triphosphate hy 
  57::244  1.2e-08 21.7% 0048963 00489631 1/1   p containing nucleoside triphosphate hy 
  59::248  1.7e-08 18.2% 0048044 00480441 1/1   p containing nucleoside triphosphate hy 
  52::243  2.3e-08 21.8% 0053315 00533151 1/1   p containing nucleoside triphosphate hy 
  31::222  1.1e-07 25.9% 0047394 00473941 1/1   p containing nucleoside triphosphate hy 
  50::222  1.4e-07 30.8% 0050867 00508671 1/1   p containing nucleoside triphosphate hy 
  57::212  2.5e-07 24.6% 0046162 00461621 1/1   p containing nucleoside triphosphate hy 
  58::231  2.7e-07 24.6% 0047808 00478081 1/1   p containing nucleoside triphosphate hy 
  43::91   3.4e-07 39.6% 0037862 00378621 1/1   p containing nucleoside triphosphate hy 
  36::212  4.1e-07 26.4% 0041617 00416171 1/1   p containing nucleoside triphosphate hy 
  47::91   7.5e-07 50.0% 0049577 00495771 1/1   p containing nucleoside triphosphate hy 
  54::223  1.2e-06 29.1% 0040121 00401211 1/1   p containing nucleoside triphosphate hy 
  58::250  1.5e-06 19.9% 0047607 00476071 1/1   p containing nucleoside triphosphate hy 
  31::87     2e-06 38.6% 0047127 00471271 1/1   p containing nucleoside triphosphate hy 
  58::256    2e-06 20.8% 0048272 00482721 1/1   p containing nucleoside triphosphate hy 
  58::95   2.8e-06 39.5% 0047813 00478131 1/1   p containing nucleoside triphosphate hy 
  58::253    3e-06 25.1% 0051535 00515351 1/1   p containing nucleoside triphosphate hy 
  42::222  3.1e-06 20.6% 0043012 00430121 1/1   p containing nucleoside triphosphate hy 
  28::222  6.3e-06 25.8% 0052155 00521551 1/1   p containing nucleoside triphosphate hy 
  57::91   7.9e-06 42.9% 0040315 00403151 1/1   p containing nucleoside triphosphate hy 
  43::91   9.4e-06 33.3% 0038732 00387321 1/1   p containing nucleoside triphosphate hy 
  54::231    1e-05 21.8% 0047291 00472911 1/1   p containing nucleoside triphosphate hy 
  42::203  1.1e-05 25.9% 0052726 00527261 1/1   p containing nucleoside triphosphate hy 
  58::248  2.6e-05 17.9% 0049606 00496061 1/1   p containing nucleoside triphosphate hy 
  54::91   2.7e-05 32.4% 0044482 00444821 1/1   p containing nucleoside triphosphate hy 
  53::78   3.6e-05 42.3% 0048939 00489391 1/1   p containing nucleoside triphosphate hy 
  54::241    5e-05 20.3% 0047839 00478391 1/1   p containing nucleoside triphosphate hy 
  34::78   8.3e-05 36.6% 0047023 00470231 1/1   p containing nucleoside triphosphate hy 
  58::95   0.00012 36.8% 0049317 00493171 1/1   p containing nucleoside triphosphate hy 
  58::244  0.00017 19.6% 0045785 00457851 1/1   p containing nucleoside triphosphate hy 
  45::204  0.00025 25.6% 0041830 00418301 1/1   p containing nucleoside triphosphate hy 
  60::94   0.00038 37.1% 0050989 00509891 1/1   p containing nucleoside triphosphate hy 
  50::103  0.00047 31.5% 0037248 00372481 1/1   p containing nucleoside triphosphate hy 
  58::78   0.00047 42.9% 0047772 00477721 1/1   p containing nucleoside triphosphate hy 
  60::91   0.00053 41.9% 0052691 00526911 1/1   p containing nucleoside triphosphate hy 
  56::78   0.00054 43.5% 0049190 00491901 1/1   p containing nucleoside triphosphate hy 
  56::99   0.00056 33.3% 0046442 00464421 1/1   p containing nucleoside triphosphate hy 
  56::78   0.00067 43.5% 0051206 00512061 1/1   p containing nucleoside triphosphate hy 
  49::80   0.00074 34.4% 0041400 00414001 1/1   p containing nucleoside triphosphate hy 
  54::78   0.00075 45.8% 0051604 00516041 1/1   p containing nucleoside triphosphate hy 
  57::223   0.0008 25.9% 0044740 00447401 1/1   p containing nucleoside triphosphate hy 
  61::91   0.00085 41.9% 0052346 00523461 1/1   p containing nucleoside triphosphate hy 
  56::94   0.00097 33.3% 0053196 00531961 1/1   p containing nucleoside triphosphate hy 
   1::284


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKRIRQTMRAVVHGSGLRRLTPPQRVTSGTVVLGARHLSKSYGARTVLDDVSLDVRTGEVLALVGPNGAG
00390411   1/1  -----------------------------------MknlslrygnfralkdvslelppG.ltalvGpNGs
00422801   1/1  -----------llllllallllllllllldpllelenlsksyggrlvlalkdvsltvkpgeivalvGpnG
00490801   1/1  -------------------llllllllalllelleeeeellllllalllllgdpllelenlsksyggvpa
00510251   1/1  ------------------lllllllllaeellelleeeelllllllllllllgdpllelenlsksyggvp
00379581   1/1  ----------------------------lepllevenlsksyggvlalkdvsltvkpgeivalvGpnGsG
00458601   1/1  ------------------------------lllevenlsksyggvlalkdvsltikpgeivalvGpnGsG
00475891   1/1  --------------------------lllelllevknlsksyggvlalkdvsltikpgeivalvGpnGsG
00378981   1/1  -------------------------------lpllelenlsksyggvlalkdvsltvepgeivalvGpnG
00475991   1/1  ------------------lllaaelpelgelllevvnlsksyggvlalkdvsltikpgeivalvGpnGsG
00482201   1/1  -----------------------------llllelknlsksyggvlalkdvsltikpgeivalvGpnGsG
00404101   1/1  ----------------------------------elenlsksyggvlalkdvsltvepgeivalvGpnGa
00367901   1/1  --------------------------------lelknlslsyg.ksilkdvsleip.geltalvGpnGsG
00420701   1/1  -------------------------------lpllelenlsksypgggvlalkdvsltvepgeivalvGp
00500441   1/1  --------------------------lllelllelknlsksyggvlalddvsltikpgeivalvGpnGaG
00466931   1/1  -----------------------------------Mkllslslgnfralkdvslelp.geltalvGpNGs
00482261   1/1  ------------------------------lllevenlsksyggvlalkdvsltikpgeivalvGpnGsG
00530591   1/1  --------------llllllaleelpllgelllevknlsksyggvlalkdvsltikpgeivalvGpnGsG
00502741   1/1  ------------------------------lllevenlsksyggvlalkdvsltikpgeivalvGpnGsG
00361211   1/1  -----------------------plellgepllelenlsksyggitalddvslgirkGeivllvGpsGsG
00466971   1/1  ---------------------------llalllevknlsksyggvlalkdvsltikpgeivalvGpnGsG
00425571   1/1  --------------------------------lelenlsksyggvlalkdvsltvepgeivalvGpnGaG
00440861   1/1  ----------------------MpllslgepllelenlsksyggvvalkdislsipkGeildlldellel
00509431   1/1  --------------------------------Mlelknlslsnfr..vlkdelvslefepg.ltaivGpN
00498251   1/1  -------------------------------vekllglalllieklflkvlprllsllelenlskiytgi
00367481   1/1  -------------------yvrPelldep..llelengrhPllsksyggkvvlndislsip.gellvitG
00436071   1/1  ------------------------------pllelenlsksygg.lalkdvsltvepgeivalvGpnGaG
00372301   1/1  -------------------yvlPllsd.gmpllelenlrkpyggllvlndvsl...pgeivaltGpnGaG
00424961   1/1  ------------lgepldglgplr...papgllelenvsksygtgialidlslpigkGervalvGpsGaG
00495371   1/1  -------------------------esalellleledltklstgikaLddv.lggglpkGeivlllGpsG
00469451   1/1  ------------------------------allelenlskiyggvpkalddvslgiepGeivalvGpsGs
00468691   1/1  -------------------------------lsvpvglallgrvldvlgepidglgplllllllpivrla
00488521   1/1  ----------------------lllllalelllevenlristgikeldkllsgglppgeitlivGpsGsG
00496111   1/1  ----------------------------------elenltklytgikaLddllslgippGeivllvGpsG
00422141   1/1  ------------------------------dlsleelekllelllrdllglgplvklldplleeavvnga
00379601   1/1  llllpllllpdeplaaldvalqralvslerllellvdpgasdihinpggpvrvridgvlelllvvldlls
00485451   1/1  --------------------------------------skiygd.ealkdvsleikkllnlsgkpgeiig
00500611   1/1  ----------------------pgllsllelllelenltklptgipaLddv.lgggipkGeivllvGpsG
00436511   1/1  -------------------------------ievpvglallgrvldllgepidgkgplelgepllevenl
00468601   1/1  -------------------------------------------------dlslevkkgevialvGpnGvG
00371631   1/1  -------------------------------mseliiylelselewallradvgltlteaelkrlkglnd
00448931   1/1  -----------------------------------------------LddvslsvepgevialvGpnGsG
00503371   1/1  ----------------------------------------------Mmlkslelknfkslkdvsligdfs
00495031   1/1  -------------------------lsalellleledltkistgipaLddvlsggipkGelvllvGpsGs
00485931   1/1  ----------------------------------------------------LsvpkgevvalvGpnGaG
00464791   1/1  -------------------------------lsvpvgdkllGrvldvlgepidglgpllalerlpierla
00414121   1/1  -------------------------------------------------------kpgevvllvGpsGaG
00437981   1/1  ----------------------------lveklrpknldkvigqeealkdlslalkpgeiphalllvGpp
00532531   1/1  --------------------------------------------vlalkdvslviekGevvallGlSGsG
00475371   1/1  ----------------------------------------------alddvslsikkgevialvGkgGvG
00489571   1/1  -----------------------------------rvknlsksyggktalddvslsvepG.ivgLlGpNG
00381441   1/1  ---------------------------------------------------------GeliaivGpsGsG
00478411   1/1  ------------------------------------------Ggvlalhgvsldve.gevvlltGpsGsG
00457311   1/1  -------------------------------------------------------mkkgeiigivGpsGs
00387201   1/1  -------------------------mssgepllevenlskryggklalkdvslsvekgeivlLlGpnGaG
00480471   1/1  ---------------------------------------------------sleikkgekvaivGpsGsG
00434401   1/1  -------------------------------------lsksyggllalddvslsvkkgliigitGpsGsG
00462761   1/1  -----------------------------------------yygdvtaldgvsltikkgevialvGpsGs
00437941   1/1  -------------------------lrplveklrpknlddvygqeevlkalslalekgrpehlllvGppG
00475521   1/1  --------------------------------------------evlalhgvsldve.gevvllvGpsGs
00512891   1/1  ----------------------------------------------------------evilltGppGvG
00426051   1/1  -------------------------------------------------------kpgevialvGpsGsG
00379961   1/1  --------------------------------yrpvdfddivGqeealralslalaagppegvllvGppG
00368571   1/1  ---llgvrllpplppklagllplagladgd......glgvllGkll..dgvpvtldlgelgrhllivGpt
00475381   1/1  ---------------------------------------------------------mkgeiialtGpsG
00490731   1/1  -------------------------------------------------dvslsvkkgkvialvGkgGvG
00496571   1/1  ---------------------------------------------------------GkgelivllGpsG
00487021   1/1  -------------------------------------------------------rm.kiivltGpsGsG
00464411   1/1  ------------------------------------------------------vkkgeiivllGpsGsG
00356411   1/1  ----------------------------------lknlsksygilkalkdislelkkgikilllGlsgsG
00503741   1/1  ----------------------------------fifldlrplallplpdrlvgrdeeiealskalgg..
00368501   1/1  --------------------------kerllllelrnvllddviGqeeakealsealelplkrpelfdgl
00515531   1/1  --------------------------------------------------------kgekvallGlsgsG
00484101   1/1  --------------------------------------------------------kgpvigivGpsGsG
00480251   1/1  ------------------------------------------------EdlslavgkgkvialvGkgGvG
00477971   1/1  -------------------------------------------------------hkgelvvlvGPsGaG
00510561   1/1  ---------------------------------------------ldglgepldgllpilaklfrpievl
00515511   1/1  --------------------------------------------------------kgekvlllGlsgsG
00405881   1/1  ---------------------------------------------------------gervglvGrpgaG
00532471   1/1  ---------------------------------------------------------pGkiIvitGpsGs
00498531   1/1  ---------------------------------------------ldklgkildlalkileksflklevl
00468951   1/1  ---------------------------------------------lnvlgesidalgkilseilkllekg
00477011   1/1  -----------------------------------eelrklldlidklrdlllsldlglpkvaivGrsgs
00533501   1/1  ---------------------------------------------------------rgeiialtGpsGs
00478441   1/1  ------------------------------------------aevlalhgvsldin.gegvlivGpsGsG
00451571   1/1  ----------------------------------------------------MsikkgeiiaivGppGsG
00406781   1/1  -----------------------------------------aglrlllkdlslgippgknvllvGppGtG
00392701   1/1  -----------------------------------------agarlaledlslgirpgknvlLvGppGvG
00513251   1/1  --------------------------------------------iellsdlslsipspevvllvGppGsG
00470731   1/1  ---------------------------------------------------arpltfddvvgqdeakeel
00404191   1/1  --------------------------------------------vellpkvtlddlvgleelkealkeal
00432181   1/1  ---------------------------------------------------slelkkglkvalvGrpgvG
00513761   1/1  ----------------------------------------------------------kiiaivGkgGsG
00379261   1/1  -----------------------------------drllleelrpvllddviGqeeakealsealrlplk
00493431   1/1  --------------------------------------------------------kGelivllGpsGaG
00499191   1/1  ---------------------------------------------------------kgkiigitGpsGs
00439861   1/1  ------------------------------------------------------kleeveristgipeld
00394721   1/1  -----------------lvslleslelplleklrpvllddvvgreealeallealrrgpprnvlLvGppG
00498811   1/1  ---------------------------------------------------------kPgkiigltGpsG
00386741   1/1  --------------------------------------------lealkavllgirpgehllLvGppGtG
00402371   1/1  --------------------------------------------eallealrr..rpgrnvllvGppGvG
00410531   1/1  ---------------------------------------------gelknlslelkkglkillvGlngvG
00482551   1/1  ---------------------------------------------everlstgipalDel.lgGglppgs
00444381   1/1  -----------------------------------------asdelekllelrpvlledvigqeeakkal
00410321   1/1  -----------------------------------------yggllllkdlslelkkglkilllGlngaG
00420081   1/1  -----------------------------------------------------smkkglrIaleGpsGvG
00511381   1/1  ---------------------------------------------------llllkpgglvlitGPtgsG
00499331   1/1  ---------------------------------------------------PslslkkgklivltGppGs
00517691   1/1  --------------------------------------------------lsfelkpglnvgivGhvgaG
00409841   1/1  --------------------------------------------------lslelkkglkvalvGrpgvG
00469161   1/1  ----------------------------------------------------------llIvieGppGsG
00437921   1/1  -----------------------------------lglllveklrpkllddvvgqeealerlllalkagk
00367291   1/1  -----------------------------------vtlddvvgqeeakeallealelalkgldlflslgl
00487061   1/1  -------------------------------------------------------ldMkkgklIvieGpp
00420941   1/1  --------------------------------lrpvllddvigqeeakeallealalplkrldlglslgi
00437901   1/1  --------------------------------------------------lslgirpgrillLyGppGvG
00489631   1/1  --------------------------------------------------------MkgklillvGppGs
00480441   1/1  ----------------------------------------------------------rlivllGpsGaG
00533151   1/1  ---------------------------------------------------MsldikkgklivltGppGs
00473941   1/1  ------------------------------eklrpvllddvvgqeevkkalllalalallrgepgehvlL
00508671   1/1  -------------------------------------------------hvsllklgeldislsikkgev
00461621   1/1  --------------------------------------------------------mkgmiialtGppGs
00478081   1/1  ---------------------------------------------------------gkvivltGppGsG
00378621   1/1  ------------------------------------------glklllrrlslllkkglkvllvGlpgvG
00416171   1/1  -----------------------------------diigqeeakkallealslaartgenvllvGppGtG
00495771   1/1  ----------------------------------------------alldilldilkgktvalvGpsGvG
00401211   1/1  -----------------------------------------------------elkrglnvgivGhvgaG
00476071   1/1  ---------------------------------------------------------kgkiigltGpsGs
00471271   1/1  ------------------------------prailelesliksllekllellkrlslklkkglkvalvGr
00482721   1/1  ---------------------------------------------------------kgkiigltGpsGs
00478131   1/1  ---------------------------------------------------------kgkvivltGppGs
00515351   1/1  ---------------------------------------------------------mngklivltGppG
00430121   1/1  -----------------------------------------vgqeeakeallealrrgrkglelgirpgg
00521551   1/1  ---------------------------plveklrpvllddvigqeeakeallealarlkapelflslglr
00403151   1/1  --------------------------------------------------------kglkivlvGdsgvG
00387321   1/1  ------------------------------------------glkglllrlklelkkllkillvGlpgvG
00472911   1/1  -----------------------------------------------------mkmkkgklilltGppGs
00527261   1/1  -----------------------------------------npfilgpkvdledfigreeelkeleeal.
00496061   1/1  ---------------------------------------------------------gklivltGppGsG
00444821   1/1  -----------------------------------------------------elkkllkvllvGlpgvG
00489391   1/1  ----------------------------------------------------lsikkgklivltGppGsG
00478391   1/1  -----------------------------------------------------msikkgklilltGppGs
00470231   1/1  ---------------------------------elaellsllierlllrdlllelkll.kvllvGdpnvG
00493171   1/1  ---------------------------------------------------------mgklivllGpsGa
00457851   1/1  ---------------------------------------------------------PkgklivltGppG
00418301   1/1  --------------------------------------------kallealalplkrlelfeklrgirpg
00509891   1/1  -----------------------------------------------------------pkvigitGpsG
00372481   1/1  -------------------------------------------------dlslllkrirnvaivGhvdaG
00477721   1/1  ---------------------------------------------------------kpklilltGppGs
00526911   1/1  -----------------------------------------------------------rkvalvGlpnv
00491901   1/1  -------------------------------------------------------lmkgkiilltGppGs
00464421   1/1  -------------------------------------------------------MkkgkfIvieGpdGs
00512061   1/1  -------------------------------------------------------kkkkgklivltGppG
00414001   1/1  ------------------------------------------------rrlllelkmllrvgivGlpNvG
00516041   1/1  -----------------------------------------------------mlk.gklillvGppGsG
00447401   1/1  --------------------------------------------------------kelkivlvGdsgvG
00523461   1/1  ------------------------------------------------------------akvalvGlpn
00531961   1/1  -------------------------------------------------------kkllkvvlvGdpnvG


                         -         -         *         -         -         -         -:140
query           KSTLLSILTGDTPPDRGEVTVLDRPLAAWSPAELALRRAVLPQSFTVSFPFDVVDVVHMGRAPWAAVDVD
00390411   1/1  GKStLlkalagllgpdsglrvgklsdlirrgadkasvelvfeldggllallrllslsggeklrvalakal
00422801   1/1  sGKSTllkllagllkptsGeilldgldilalslaelrrrigyvfqdp.alfpltvrenlalglllallll
00490801   1/1  lkdvsltikpGeivalvGpnGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvll
00510251   1/1  alkdvsltikpGeivalvGpnGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvl
00379581   1/1  KSTllkllagllkptsGeilldglditalslaelrrrgigyvfqdpalfpgltvrenlalglllllllll
00458601   1/1  KSTllkllagllkptsGeilldgkditglspqelrrlggvvvqevllffltllenlllglallllllvll
00475891   1/1  KSTllkllagllkptsGeilldgkdilglsllellrrgigyvfqdpalfpgltvlenlllgll..llgla
00378981   1/1  aGKSTllkllagllkptsGeilldgldllllslaelllllrrgigyvfqdpalfpgltvrenlalgllla
00475991   1/1  KSTllkllagllkptsGeilldgkdildlslael.rgigyvfqqdallpsltvlenlllglllagellll
00482201   1/1  KSTllkllagllkptsGeilldgkdilglslkel.rgigyvvqqdallpsltvlenlllgllllglllll
00404101   1/1  GKSTllkllagll.ptsGeilldgldltalslaelrrgigyvfqdpalfpgltvrenlalgll.......
00367901   1/1  KStllkalagllgpdvsallrlsglidlilkgllllprstvatvelifdllgllliirrlilrdgsgeil
00420701   1/1  nGsGKSTllkllagllkptsGeilldgldllllslaellalrrgigyvfqdpalfpgltvrenlalglll
00500441   1/1  KSTllkllagllkptsGeilldgkdildlsl..lrrgigyvfqdpalfpgltvlenlllgll..llglsl
00466931   1/1  GKStLlkalagllgpdsGeilldgkdilalspeellrllrrrigyvfqepalfpgltveenlllglllrl
00482261   1/1  KSTllkllagllkptsGeilldgkdildlslael.rgigyvfqqdallpsltvlenlllgllllgellll
00530591   1/1  KSTllkllagllkptsGeilldgkditdlslkel.rgigyvvqqdallpsltvlenlllgllllglllll
00502741   1/1  KSTllkllagllkptsGeilldgkdilglslael.rgigyvfqqlallpsltvlenlalgll..llglsk
00361211   1/1  KStllrnllagllaptggsvlldgleisalslaerlragigyvfqdlalfpeltvlenlalg........
00466971   1/1  KSTllkllagllkptsGeilldgkdilglslaelllllrrgigyvfqdpalfpgltvlenlllgllllgl
00425571   1/1  KSTllkllagllkptsGeilldgldllalsl..lrrrigyvfqdpalfpgltvrenlalgllll..glsk
00440861   1/1  lkeldgsllnvalvGpsGsGKStLlnaLlgllkpdegvilvggkgvTrdivlytledgvkltliDtpGlg
00509431   1/1  GsGKStlldalagllggrslrllragglsdliflgslirsgadrasvelvfdlsdglyllerselilrrl
00498251   1/1  pal.dvslglgGlppGeivlllGpsGsGKTtLalrllagllkpgggvvyidgeesldll...rarrlgvv
00367481   1/1  PngsGKSTllralaglllpasggilvpgedalll....................................
00436071   1/1  KsTllkllagllkptsgeilldgldlla.....lrrgigyvfqdpalfpgltvlenlalgllllgll...
00372301   1/1  KSTllrllaglllpasggilvdgedl..........rigyvfq...........................
00424961   1/1  KttLlrliaglldpdsgeilldgvdigersrevtelleelrrviglvfqdpplfprltvaenialgaeyf
00495371   1/1  sGKttlalrllagllkp...evlvdgldltglspa..rggiglvfqteallppltvrenlealgldlrgl
00469451   1/1  GKstllrllagllaglptsGeillldgkdvlylsleesleqlrrrigyvfqdp.alfp............
00468691   1/1  ppllelenlsksygtgialidvsltigrGervglvGpnGaGKttLlkllagllkpdsgeilvdGedlr..
00488521   1/1  KTtLllqlavngllppdsGei...............ggkvlyvdqee.slfpltvlenlalg........
00496111   1/1  sGKTtlalrllagllkptggkvliiglelsaeelrerrrrigyvfqepalfpeltvlenlalgll.....
00422141   1/1  sdihiepgggllrvryridgvlielifldeeellallsrlkslaglpilearlpqggriqavlppvvvdf
00379601   1/1  ldleellalasriavlagrdiserrlpldgallpdgsrvrvrlsplptllggeslvirklpkliltledl
00485451   1/1  ivGpsGsGKsTllrlLagllkpllltggkvlvigldifrlsarelrkrig..vfqdpallphltvpenld
00500611   1/1  sGKTtlllqlagllapdsgeillggkvl.yisleeslrrrrigmvfqelgldpdltv.............
00436511   1/1  sksyggrklvlepletgialddvsltikkGervglvGpsGaGKtTLlkllagllkpdsGeilvdgliger
00468601   1/1  KTTllakLagllapqggkvlllgaDiyraaaae.rlgigavpqdvplfpsltvldnlalardlleaa.ka
00371631   1/1  lleledlskiygplsrlikllleellrllgklalddvslsvkkpeiigiaGpsGsGKSTlarlLagllap
00448931   1/1  KTTllnalagllapdggkvllvgadiarla...areqlgivfqdp....gltvlenlalg..........
00503371   1/1  pg.ltaivGpNGsGKStlldaiagllgpdsgeirldgkdlliylsdlirrgagiayveqefdlfdgltvl
00495031   1/1  GKTtlllqlagllalglgliplggkvlyiglelt.lsperlrlraqsl......................
00485931   1/1  KTTllallagllaptggkvllvgadi.........rrigavpqlpvlfprltvlenlalg.........g
00464791   1/1  ppllelenlskrfgtgivlidvslpigkGervglvGpnGaGKTtLlkllagllkpdsgeivvyg..lige
00414121   1/1  KTTLlrallglleglkvaviepdfgeilidgqlledlgvlavrlgigyvpqtlglfpaltvlellalall
00437981   1/1  GsGKttlaralagllgpdsgkilldgkdi........rrgiglvfqliglfphltvlelvalgl.....g
00532531   1/1  KTTLlrllagllipddgeilidggdinleggfyakaigllrrkigyvfq...lfpfltvlenvalgld..
00475371   1/1  KTTlaanlagllaptggkvlligaDirrpsarellgllgell............................
00489571   1/1  aGKSTllrllaGllkpt.....................................................
00381441   1/1  KsTLlklLagllppdsgsigslttrlprlgevdgvdltfls....reeigyvfqepallpdltvlenlyl
00478411   1/1  KStllralagl.....Gtilldg.dlvrlglkd...gigmvfqdpalfplltvrengvalglllagl..s
00457311   1/1  GKSTlarllagllekpgsgvividgddlyklsreelrklrrrigmvfqdpalflnpgltvrenlaeplrl
00387201   1/1  KTtLlralagllgptsfvvsptftlvreyelGeilldgrdlyrlsleeallllfldeileidglllvelr
00480471   1/1  KSTLlnaLagllsptsvpettrdfilgeilldgkdltlvdtpgiargrlklllearraaigivfqdvdll
00434401   1/1  KTTlaraLaellrerggsvavidlddfyrpaaell.lreglgidfqlpdal...................
00462761   1/1  GKsTlaraLagllpeepgsgvvlldgddlr......lglliglvfqdp...dllpfltvlenvllpllaa
00437941   1/1  tGKTtlakalaglllptsggvrvlgidaselld.....................................
00475521   1/1  GKStllralag.....sGeilvdg.dlvdleplrr..digmvfqdpalfplltvrenvilgllelaglsk
00512891   1/1  KTTlakalagelgakfgsvsltgrdv.....rsarrgigyvfq........tveellgllaelvgle...
00426051   1/1  KSTlakllakelglefidsgdilrdgvdlggesglllrdlrrliglvfqdp.ilfpgltvglllffldni
00379961   1/1  tGKstlaralagllppdsg...................rivlvgnlsdlldpkdlrellragiplvflnf
00368571   1/1  GsGKStllrllaglllpdggrviviDpkgeyaglarglgvvildpgdgrsvrlnplaliddeedaaellr
00475381   1/1  sGKsTlarlLagllkptsgivsvdglrlavlsrdllgllreglirigyvfqdyalfprltvlenvllgll
00490731   1/1  KTTlaaklagllakrggkvllidaDpyrpaadellgvlaee.............................
00496571   1/1  sGKsTlarlLagll...ggsvldtgepirgeplgelir..glvfqdpllldeltvlenlalgrylhlgli
00487021   1/1  KsTlarlLaell....gvvvidtddllra.........gevfqdyalfphltvlelldnvllgleirgll
00464411   1/1  KsTlaklLagllgptggsvlltgepvsgeplge...ligevfqdgilfpdltvlenvalgrygllglike
00356411   1/1  KSTllnrllgleygpTiginegtieidgvkltlwDtgGqesfrklwilyfegadaiifvvdasdrdsfln
00503741   1/1  aldgvslsiepggivllvGppGvGKTtLakllagllkpkfgeillfg.......................
00368501   1/1  gvelpgknvlLvGppGvGKTtlaralakll.....gapfiridgseltekdyvGesvearlrelfeeaig
00515531   1/1  KSTllnrllglefaygpTigptsgtieidgvklqlwDtgGqerfrslwilyfedadaiifvvdlsdrdsf
00484101   1/1  KTTllraLagllkprggrvavigldigrldldellg.igylfqdvgllpvltvrenlalllrglpgysae
00480251   1/1  KTTtaakLaaalaergkkvllidlDpyrpsapeqlgilgellg..................vpvvgvltg
00477971   1/1  KsTLlnaLlgll.ptsgvisvsgttrpprpgev..dgvgyvfqsrelfpeltvagnfleg...aevrgnl
00510561   1/1  algllerksverlstGikaLDll.lgiGglprGelvliaGppGsGKTtlalqlaanlaaqggkvlyiste
00515511   1/1  KSTllnrllgleflpgpTigptegtieidgvklqlwDtgGqerfrslwllyfegadaiifvvdlsdgdsl
00405881   1/1  KSTLlnaltglkaivsgypgttldpnlgvveldd.............grqlvlvDtpGlielaslgeglv
00532471   1/1  GKsTlarlLaellnglggivsvddlgrdvgelggaalldivde.grliglvfqdldllpllevlellaa.
00498531   1/1  algvlerkeverlstGikaLDal.lgiGglprGsltliaGppGsGKTtlalqlaanlaklggkvlyiste
00468951   1/1  fltalgllerksverlstgikaLDll.lgiGglprGelvlivGppGsGKTtlalqlaanlaklggkvlyi
00477011   1/1  GKSTLlnallGldvlpvgggpgtrrptelrlsetpgltvlvvflel..............gerldllglv
00533501   1/1  GKsTlaklLaellphldtgdvlldgepigtp....lgrgigyvfqdpalfpgltvrenlelllvfadryg
00478441   1/1  KStlalaLagl.....Gailvdd.dlvllelrg..rdilmvfqppa...lfpllevrglniaevlela.g
00451571   1/1  KsTlaklLakll.....glivldgddl........lreaiglvtqdgelllelid..egilvpdeiv...
00406781   1/1  KTtlakalagelgvpfvrisa.................................................
00392701   1/1  KTtlaralagllgapfgrvda.................................................
00513251   1/1  Kstlakklaellgfilidaddlr...............................................
00470731   1/1  eellagllgikkpkvillvGppGsGKTTlaralakel..gagfilidgddlrekavgeleklgr.dlfqv
00404191   1/1  ellslgikpgeivllyGppGtGKTtlakalanelkkrggrvlyvsa........................
00432181   1/1  KStLlnallglkvaivsdypgttrdptlgvveldgrkl................................
00513761   1/1  KTTllnklaglla.dggkvlvidlDparanlpeqlgidirdl.........idletvmelglgpngalvf
00379261   1/1  rlelferlglrrpgknvlLvGppGvGKTtlaralAkllgapfvevdaselteggyvgedlekrirelfqe
00493431   1/1  KsTllkllagllgptsgvisvggttreprpgev..rgigyvfqsgalfphlivagnlleg...aevhgll
00499191   1/1  GKsTlaklLaellgatvgdvd..............gllvgvvfqd.dfylllpalevlengaflldlllp
00439861   1/1  ellgGglpkgslilitGppGsGKTtlalqlaanlaknggkvlyisleesreqlleraerlgldleellll
00394721   1/1  vGKTtlakalakelaagsgpilldgvpvvrldlsellsv...............................
00498811   1/1  sGKsTlarlLae.lgvividgddltrelvaggglliglifqdfglfelldrellielllenlalglaleg
00386741   1/1  KTtlaralagelgapfvrlda.................................................
00402371   1/1  KTtlaralagllvrssgpilldgvpfvrldaselle..................................
00410531   1/1  KTtllkrlaggefvdygptigvnfktvevdgvkl....................................
00482551   1/1  lvliaGppGsGKTtlalqlaanaalplelgklggkvlyistee.afsperlreralsl............
00444381   1/1  slalelplkrlelfgklddligrspairrllellgarpgenvlLvGppGtGKTtlakalakll.......
00410321   1/1  KTTllnrllggefp.eygpti-------------------------------------------------
00420081   1/1  KTTlaklLarhlgptggrvllvgEPiaywr----------------------------------------
00511381   1/1  KsttLlralnrleeagkgvilvkdaidtrlgielvvsriglvleavglffaldllelll...........
00499331   1/1  GKtTlakaLaerl.....glpfidtddllrepvigagtdigevfqdlllaggllvddev...........
00517691   1/1  KSTLlnallgllgaivgdvlvdg...............................................
00409841   1/1  KSTLlnaLlgadlaivsdipgttrdpilgv........................................
00469161   1/1  KsTlaklLaerlgltglsvlltredgfgtplgelirelllegfqdlilvpdllvlellaanraglrelik
00437921   1/1  lphlllvGppGvGKTtlaralarlllgsgggvdvielda...............................
00367291   1/1  rpgrnvllyGppGtGKTtlaralanel..........gapfirvda........................
00487061   1/1  GsGKtTlakaLaer.gargldvvviyepvdyw................aavgggdllrlirelllrlgfg
00420941   1/1  rpgkgvllyGppGtGKTtlakalagelgapfiridg..................................
00437901   1/1  KTtlakalakel..........gapvieidaselrd..................................
00489631   1/1  GKtTlaraLaellglpf.iridgddllrellgellgrgigfgfqqgdlledatvlenlalllldeidka.
00480441   1/1  KsTlaklLaellp....glivisvgdttrepregevlgvdyvfvdrelfeelivagnlled...aivhgl
00533151   1/1  GKtTlarlLaerl.....glpfistddllrelvpggldigevfqda.leaglllfddefrglllerleel
00473941   1/1  vGppGtGKTtlaralagllga.................................................
00508671   1/1  ivlvGpsGsGKsTlaraLakrLeepgsgvvlldgddlraglsiglilsdedraalrrrlgevfqel.lla
00461621   1/1  GKsTlaklLaerlglpfistddlyrevvergtelgklikdyfdpgalvpdllirlllerllfldeg....
00478081   1/1  KtTlarlLaellkplgggvvvidtddlrreairell.lgldlleilf.......................
00378621   1/1  Kstllnrlageef.dtpgtti-------------------------------------------------
00416171   1/1  Kttlaralakllprsgvpfvrvncsalte.........................................
00495771   1/1  KStLlNaLlgellattgeipg-------------------------------------------------
00401211   1/1  KSTLlnaLlgll..........................................................
00476071   1/1  GKsTlaklLaelglpvidtddltregvll.............................ggpllerirell
00471271   1/1  pgvGKStLlnallggdf-----------------------------------------------------
00482721   1/1  GKsTlarlLae.l.....glpvidtddlyrelvaggtplgerirellgegyllpdea...........lf
00478131   1/1  GKtTlarlLaellkplglgvvvidg---------------------------------------------
00515351   1/1  sGKtTlaraLaerlglpvistd..dllreavpggtdigelfqdyllfpfltvdeni.......rglllea
00430121   1/1  nvllvGPpGvGKTtlakalagllfpsgvpfirinlseltekllvselig.....................
00521551   1/1  pgkgvlLvGppGtGKTtlaralagll..........gapfvrlsas........................
00403151   1/1  KTtLlnrllgdefpvsyipti-------------------------------------------------
00387321   1/1  KTtllnrllgdefve.ygpti-------------------------------------------------
00472911   1/1  GKtTlaraLaellgapfisgddllrglageggkpl...................................
00527261   1/1  .pkivlltGprGsGKTtllkalakel..gkpviyidlselsskgyvdleellrela..............
00496061   1/1  KtTlaklLaerlglpvistddllreevepggtdlgeifqalllagellfddevlgll.....rerldeli
00444821   1/1  Kttllnrllggefai.ygpti-------------------------------------------------
00489391   1/1  KtTlakaL--------------------------------------------------------------
00478391   1/1  GKtTlaralaerl...glpvidgddllrelvgeggrlgrd.lfdedrllfrellideidl..........
00470231   1/1  KStLlnrl--------------------------------------------------------------
00493171   1/1  GKsTlaklLaeklglivlsvgdttr---------------------------------------------
00457851   1/1  sGKtTlakaLaerl.....glpvistddllreavpggtrlgeviq................dlfllggll
00418301   1/1  knvlLvGppGtGKTtlaralakllgr............................................
00509891   1/1  sGKTTlanaLarllkarglkvavi----------------------------------------------
00372481   1/1  KsTLlnaLlgalgaiveagevklalvldsleee-------------------------------------
00477721   1/1  GKttlara--------------------------------------------------------------
00526911   1/1  GKStLlnrllgakvse.pgtT-------------------------------------------------
00491901   1/1  GKttlaka--------------------------------------------------------------
00464421   1/1  GKTTlaklLae.l.elgigvvvtrEPvdy-----------------------------------------
00512061   1/1  sGKtTlak--------------------------------------------------------------
00414001   1/1  KSTLfnaLtg------------------------------------------------------------
00516041   1/1  KtTlaral--------------------------------------------------------------
00447401   1/1  KttLlnrllgnkfivsyiptitvdiltkeveidg....................................
00523461   1/1  vGKStLlnallgdkaivsdip-------------------------------------------------
00531961   1/1  KstLlnrllggkfvsdypgttgdf----------------------------------------------


                         +         -         -         -         -         *         -:210
query           VDDDRVVADAMAATEVTALAARKFPSLSGGEKARVMLARVLAQQTQIMLWDEPTAALDIRHQESVLRIAR
00390411   1/1  lgnpeillngepvnhldlrelllnllrrrgiglvpqehdlfplltvaenialldelaglpkygnylsllk
00422801   1/1  glskaeararalellellplgldtlldrlvgeLSgGqrqrvalArallldpdllllDEptsgLDpetrae
00490801   1/1  ffltll............lllaakeaalralllllllgletlldrrpseLSgGqrqRvalArallldpdl
00510251   1/1  lffltll............lllaakeaalraellllllgletlldrrpseLSgGqrqRvalArallldpd
00379581   1/1  llllllllalskaearervlellelvgldtlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLD
00458601   1/1  lllllllllllaakeaalralllllllgledlldrlpseLSgGqrqrvalArallldpdllllDEPtsgL
00475891   1/1  lkeaalralllllllgletlldrlvseLSgGqrqrvalarallldpkllllDEPtsgLDpetraellell
00378981   1/1  g..lskaeaaaraaellellglddlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetrae
00475991   1/1  llaakeaalralllllllgletlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraell
00482201   1/1  laakeaalralllllllgletlldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraelle
00404101   1/1  kaeararalellellgldelldrlvgeLSgGqrqrvalarallllleelsldpdllllDEPtsglDpetr
00367901   1/1  idgkdislldlrelrrligyvpqdpalfpqltvlenlllglelrrklldellgllellalleellkllee
00420701   1/1  ag..lskaeararalellellglddlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetra
00500441   1/1  aeaaeralelllllgledlldrlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellr
00466931   1/1  llelllgrlelllllllllellallldlllllllllllllllllllvlllllllllvlllllllalllll
00482261   1/1  llaakeaalralllllllgletlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraell
00530591   1/1  laakeaalralllllllgletlldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraelle
00502741   1/1  aeaaaraaellellgledlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellr
00361211   1/1  .......rarellerlglail.drlpgeLSgGqqqrvaiaralaldpdllllDeptsalssrssendpet
00466971   1/1  llllaakeaalrlellllllgletlldrlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetrae
00425571   1/1  aeaaaralellellglddlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellr
00440861   1/1  dtklsdeeklilkyleeadlvllviddglteldlellkllkelgkpvilvlnkiDllkkeelekllksln
00509431   1/1  ilkpgsgeilingkdislldlrelrrligyvpqdpnllfqltvlenlllgpeerrelldellglellsle
00498251   1/1  lqelllfpeltveenl.................................drlprllsggqrqrvvidsal
00367481   1/1  ..........rvdeiltrvglsdlldrgls.lsggerqrvalaralatdpslllLDEptsgldpedgaal
00436071   1/1  .ealaralellellglgdl.drlvseLSgGqrqrvalarallldpdllllDEptsglDpetralllellr
00372301   1/1  .........llervgledlldrlpstlsgGqrqrvai.ralatepsllLlDEptsgldpelraalaeall
00424961   1/1  ..rdegadvllladsllrlagalrevlgrlgrelSgGqkqrvaiarallleragnleggGsiTalatvlv
00495371   1/1  ld.....rerviellelvgleelldrlprelsggnqrqrvvia.alallpkllllDEptsaldvslraei
00469451   1/1  ..............aeellelvgledlldrlpgelSgGqrq..aiara.ardpdllllDeptsalrgsen
00468691   1/1  elrelrrrigyvfqdpalfpeltvlenlalgallag..................lglaeyldelgkdLSg
00488521   1/1  .....gedveellerlgl.dlldrlphqlsggqrqrvaiaralaeelkpdllvlDeitalfraelegrpt
00496111   1/1  .......................drlpgeldlSgglqrqrvaia...agdpdllllDeptsalrslgndp
00422141   1/1  rvstlpdigglslvirklreviltledlglsygdpealkdlslaippgglvlltGptGsGKtTllralag
00379601   1/1  lelenlsfsyggkealkdlslaiepgelvlivGptGsGKTTllkallgllppdegiitiegpdel.....
00485451   1/1  lglll........eilervlellelvgldvvlldtyphelSgGqrqRvaiaralaldpdvlllDEptsgl
00500611   1/1  ......arerviellelvgllelldrlprelkrsggqrqrvviDaralllrpel..lDEptsaldvslra
00436511   1/1  lrevlelirelelaelrrrigyvfqdpalpallrllalfpaltvaenlrfgl....glavlllldsatrl
00468601   1/1  agydvvlidtaglld....ldrlvgelsggqkqrvaiarala.apevllldeptsgldalae..llelle
00371631   1/1  esgglkvlligtDifylpa.eqlkrigllfq.kglpealdveellellldlke.................
00448931   1/1  .eleararellellgledydvvliDtagrlrlpselsggqkqrvaiaralaaplppevllldeptsglda
00503371   1/1  envllglgdeliirrrilrdgrseyllnglgvslkeliellldlsggelnrvalllqgevdlllldepte
00495031   1/1  ......gldldellerllvidllelvgllelldrlprelsggqrqrvviDalalllrpell..Deptsal
00485931   1/1  adlaeraeellellglegfdvvliDtagrgrrvgelsggqkqrvaiarallllldpelllldEptsglda
00464791   1/1  rprevrellglllelgvlf............................aaellervglvaatadeppgels
00414121   1/1  ......lredpdlilid..................sgGqkqrlalaralladpdlgellllDeptlvlDa
00437981   1/1  gilveevrellkel...............lsgGqkqrvaiaralagdpkvlllDEpt.aldpdaqnaLlk
00532531   1/1  ..glvdeedleraenllalvgleeipnrypselsgGqqqrv...........illldEPtsgLdpvsr..
00475371   1/1  ..............gldvlvgarggdlsgglrqr..larallgdpdvlliDepgrgldpellallaelld
00489571   1/1  ................................lallelrntteagaasgsrdkgllgklkpetraelldl
00381441   1/1  g..lllalllaleegkivildgdreraeellellgldadlviilpasleellerldrrggelsggqkqRv
00478411   1/1  kaeieervdlllelvglddlldrypdelsggqrqrvaiaralalepelllldeptsaldplavvellell
00457311   1/1  l.klgkk.......llepvglpevldryphelsgGqrQRv...ralaldpdllilDeptsalgqpdpelr
00387201   1/1  egigyvfqdpalfpel------------------------------------------------------
00480471   1/1  ltltvaenlllgldllllellkelkydpvilllnkidllddrllrraeaeerieel.l------------
00434401   1/1  .drellreevlellglgevvivdvydlsggerqr...aralasgpdvlilDgptlgldv...........
00462761   1/1  gliv.....ivdgtlllvglrealrkllgllsgGqkqrvadlvvlldadpevllaReptrgldpeteeel
00437941   1/1  .........................pselsggerqrvliaralladpkvlllDEi.daldpeaqnaLlkl
00475521   1/1  aealarvdellelvglddellldrlp..sggqqqeilrvaiallilpvllgralallpelllldeptsal
00512891   1/1  ...........vrgeleellktlikelsggekqrvalarallakpdvlllDEid.gldpdvleallelle
00426051   1/1  dlgllirgdeeleaalelaglprviellle.gldtlaggggvvlsGgqrqrvalar.....pdlllflde
00379961   1/1  aalpasllesel.........................lsggerqrvalaralalrpGllvlAdggvlllD
00368571   1/1  alvsemgrgeddfftpaarallralilalaeepe.ptldellellselg.........lrdladrleklv
00475381   1/1  ..........................llgglvvildggvrqrlalarallldpdvllldeplllldaalr
00490731   1/1  .............lgldvllgarggdlsgglrqr..larallgdydvliiDtp.gtldvllelallellk
00496571   1/1  laalaagvgv..vldrvglsdlaygfprtlsglgqrqrvalarallkpdlvifldeppteeldeRlrkrl
00487021   1/1  k....aerlervevllervgllldrippalsgGqgqrvildrallselayqpdvllldeplsgldaklre
00464411   1/1  alaegviv.ildrvglsdla..ypgflsggeqqrvaiarallpkpdlvllldepteeldeRllkRg....
00356411   1/1  ldkwrnrlgevlqllelilnltvlenvpi...........ilvlNKiDlleekiveellellgleykgdr
00503741   1/1  ..............kvvyvnvselldlkellrlllealglpppyq.....lsggerlrvalaeallalgk
00368501   1/1  yvfqdp.alfpgtvlenlalgllvseligappgyvggdlggllteavlealriklvegelgfrelerevl
00515531   1/1  lelrrwigrlfqdlnlfpsltvlenlanvpillvlnKiDlleakeraeellellglgdlldklpselsgG
00484101   1/1  eleralelle.lagfdvilie.....Gllelalplilelrelsdgqiqrvaparallrdpllllldedtv
00480251   1/1  ldlagalrealell.....llegydvvliDtagglqrglllalaladlllvllldepllvldatagtell
00477971   1/1  ygtsrerveelleagldvlldidpqglsggqkqrlalaralilppsllrgldep.ealdarleraleell
00510561   1/1  esleql..rarrlgld..............................ldrlllldaltveellalaerll.
00515511   1/1  lalrrwigrlfqslnllesllvlenlanvpillvlnKiDlleaklvllll..vglfdlldglpselsggq
00405881   1/1  rqalealeradvillvvdasdplldqpvellsggekqrlalarallgkpvilvlNKiDeptneldlelle
00532471   1/1  ........................rleellerippalsggqgqrvildrslysrpavlllllyvdeplsg
00498531   1/1  esleql..rarrlgld..............................ldellllpaltveellalaerl..
00468951   1/1  dteesldqlr..arrlgldlddllllpaltveellala................................
00477011   1/1  fqdfsllpelielenralagpiagisrdairleielpglpdltlvDtPGlgsvavvdqlsggqkqrvala
00533501   1/1  vlrglikpalaegvsvildrvglsdlay.dgfprllsgggrqrvalaralvvkpdlvilldeplevldeR
00478441   1/1  lskaealkrvdlvlelvglddrypyelsggerqrvailr..vllpklllpdepgrnldvlievavlnlil
00451571   1/1  ...iellrealeeldadgvildgfprllgqaell....lsggkadlvifldaplevlleRllkrddekil
00406781   1/1  ................sellgkyvgelsgglrqrlalara..adpgvlllDEidalldarsgsgsggdss
00392701   1/1  ................sdllgkyvgelsgglrqr..larallakpsvlllDEidklapkrsptsgldvel
00513251   1/1  ................................gqkqrvalleaalkegylvvvDet..gldraqrlelle
00470731   1/1  aregglvpdilfideidall..rkgpd.vildgag.rtpeqlealldlleelgrpvvviilttnrevlld
00404191   1/1  ..........................................delvsklsgglqeqrvaiafalarkpdl
00432181   1/1  .....................................vliDtpGleefasggekqrvalalallreadvl
00513761   1/1  aleellttld..illealelleedydyiliDtpGglelrallalllaiaralaadeillvddptsgldae
00379261   1/1  arllvfltvlenirldaseylekrvvsrligappgyvgyglggllteavrrlpysvllldelekahrpir
00493431   1/1  ygtskerveealekgllvlldr...dlsggqqlrvalaralvvfildpslelldeRlsgrdadtreeirk
00499191   1/1  daldrelllelllalveglvvlldryprllsggqrqrvaia.....dpdvlildgptllldpe.......
00439861   1/1  gllsiliad....................................plglsgeellrvllalalelkpdll
00394721   1/1  ......................sdlvgelegglrgllteala.lakpsvlflDEidrlldardsesslev
00498811   1/1  vilda.lrrrllelldllgldvvilegplllsgglrqrpdlvifldappevlleRllkRggldeetiekr
00386741   1/1  ........................selsggeklrgllarala.kpgvlllDEida.ldpdvqeallelle
00402371   1/1  ...................fgkyvgafegglrqllglaraa..kpgvlflDEidsllgarggsgvdpevq
00410531   1/1  ......................viwDtaGqerfrsllarylrgadgillvvdatdglsfeevaklleell
00482551   1/1  ..............gldleelldrllvidatdlldllellerlrrllsegkvdlvviDslallarael..
00444381   1/1  ...gvpfiridgseltekelvGe...............................................
00410321   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00511381   1/1  ...........................................qdpdviliDE.aqfldp....evvevl
00499331   1/1  ........rrlllealdelllaggkvvildgfpggllqrealrrllprpdlvilldappeelleRllkrg
00517691   1/1  ..gtlllllgllsfllalvldslplerergitidvalarllldgrkilllDtPGhedfvkevlralrlad
00409841   1/1  .......................................vlldgrdllllDtPGlidfaseptnlldlei
00469161   1/1  ellaagkgvildrfp.......lsrlayqlsggerqrlaidlegalllerllldepfpdlvifldaspee
00437921   1/1  .......................................sdlrgvddlreligevlqalglllggkpdvl
00367291   1/1  .......................................selleklvgegegrlrgalaealradpgvlf
00487061   1/1  epdafdnellgellealleggkivlsarraqllei.........rlirpllaegkvvilDrepdsadlaf
00420941   1/1  ...............................sellgkyvgelsgglrqllalara..akpsilllDEidk
00437901   1/1  ................vddlsgyvgelsggeklrellaealteavlkgkpsvlllDEi.daldpdvlnal
00489631   1/1  ......................ledggvvlldgfdrsqlqrlailrallddppdlvvfldapleellerl
00480441   1/1  lygtskerieealdaglgvlldgfprglsqaqalrlaldlvllldpslevlleRllgrgddteevirkrl
00533151   1/1  largpvvildgf................pggllqrealrrlllrpdlvifldapleelleRllkrgrlir
00473941   1/1  ..................pfielsasdllgesdlrggfkqa........akpgvlflDEidrl.drevqn
00508671   1/1  grlvvldgtalglelrdelrellkeaglpllvvfldaplevlleR........drrglypeelsgglkqr
00461621   1/1  .........ggflldgfprtleqaealskpavlsggrkqrlalaralavdpe.lildgrllgrrllplpd
00478081   1/1  ........................eglllsdefrelleealalladgdvvilDgfgrlldarqlleelll
00378621   1/1  ----------------------------------------------------------------------
00416171   1/1  ............dlleselfghekgafgggekqrlgllrla..dggvlflDEidkl.dpdvqnaLlrvle
00495771   1/1  ----------------------------------------------------------------------
00401211   1/1  ...................ldtlkgelergitikigaasllldklaivsdtpgttldpilgvleldgpkl
00476071   1/1  gegyllfdealdrellaallfglelegalldglvygvlqdrllerllaagpdvlildgpl.lldvellpl
00471271   1/1  ----------------------------------------------------------------------
00482721   1/1  rallaellfgdllalalldgvvydrlrdellaelsggqgdvliiegalllepgllplpdlvifldappev
00478131   1/1  ----------------------------------------------------------------------
00515351   1/1  leellaagkvvild................glsggllqrvallrallrpdlvifldapleelleRllkRd
00430121   1/1  .................................hppgyvGedelgvlfeaarkappsvlllDEidkl.dp
00521551   1/1  ...............................elvgkyvgelegglrqllalaraa..npgvlflDEidkl
00403151   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00472911   1/1  ....................gllfedaleagfrqrladlirallakgkvvild..gtglsreareellel
00527261   1/1  ....................................eelgellellkkllkklsellglsilg-------
00496061   1/1  elllaggvvildgf............pldlegalllrealarallpdl.vifldapleelleRllkrgrl
00444821   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00478391   1/1  .........................................llakgkvvildgtnlsealdealrrllrp
00470231   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00457851   1/1  ffdeldellkerieellaag..gvildgfpldlegaealreallragplpdlvifldapleelleRllkr
00418301   1/1  ..........................pfirvdaselteaelvGyesgarlrelfaragigllal------
00509891   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00464421   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00447401   1/1  ...........................................krvklllwDtpG.......qeefrsll
00523461   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           QRAAQGDAIVVVLHDLALAAAYADQVAILSQGQIAAYGPPAEVFTAKLLSDVYSYEVEIVSHPRTGVPLV
00390411   1/1  eklkelnallkelelqlkelarllelleglkeeaekakalle----------------------------
00422801   1/1  llellrelak.gltvllvthdlsla.aladrilvlddGrive----------------------------
00490801   1/1  llLDEPtsgLDpetraellellrelakegktvllvtHdlseal.l-------------------------
00510251   1/1  llllDEPtsgLDpetraellellrelakegktvllvtHdlseal.-------------------------
00379581   1/1  petraellellrelakegltvllvthdldealrladrilvlddGrivelgtpeellenpg----------
00458601   1/1  DpetraellellrelakegltvllvtHdldealrladrilvlddGriveegtpeellenplllyt-----
00475891   1/1  relakegltvllvthdldealrladrilvlddGrivelgtpeellenpgllaallge-------------
00378981   1/1  llellrelakelgltvllvthdlsealrladrilvlddGrivelg-------------------------
00475991   1/1  ellrelakegltvllvtHdlsealrladrilvlddGriveegtpeellenpgllaa--------------
00482201   1/1  llrelak.gltvllvthdlsea.rladrilvlddGrivelgtpee-------------------------
00404101   1/1  aellellrelakegltvllvthdldealrladrilvlddGrivelgtpeellenp---------------
00367901   1/1  llkelevleaalaallkeeieeraeellellglgglldrpvs----------------------------
00420701   1/1  ellellrelakelgltvllvthdlsealrladrilvlddGrivel-------------------------
00500441   1/1  elakelgltvllvthdlsealrladrilvlddGrivelgtpeell-------------------------
00466931   1/1  alkeaallleelllllglgdlldrpvstLSGGerqrvalara----------------------------
00482261   1/1  ellrelak.gltvllvthdlseal.ladrilvlddGrivelgtpe-------------------------
00530591   1/1  llrelak.gltvllvtHdlseal.ladrilvlddGriveegtpee-------------------------
00502741   1/1  elakegltvllvthdldealrladrilvlddGrivelgtpeelle-------------------------
00361211   1/1  vaellellkelakelgvtvilvthdldlldsallrpgkrpllsdlrgsg---------------------
00466971   1/1  llellrelakegltvllvthdldealrladrilvlddGrivel---------------------------
00425571   1/1  elakelgltvllvthdlsealaladrilvlddGrivelgtpeell-------------------------
00440861   1/1  kelglkelrrgigyvfqdpnlfpglvvlisaltgegldeltvrenlalglrlr-----------------
00509431   1/1  ealaraeealeelnallkeleeeleligplldglellvglnglld-------------------------
00498251   1/1  alrpkllllDEPtsgldplsarellellrrllrlakelgvtvllvthdl---------------------
00367481   1/1  aeallellaellgatvlvvtHdlelaalaadrivvl.ngrvvadgtpeellflyklllgvagrsygleva
00436071   1/1  elaeelgltvllvthdldlalaladrivvl----------------------------------------
00372301   1/1  ellaelgatvlfvtHdlelaalladrvvvlndgrivavgtpeelyklp----------------------
00424961   1/1  eggsdpdllllDeptsalDgeivlslllalkrlyPaidvllSv---------------------------
00495371   1/1  lrlLkrlakelgvtvllvthdleeveeladrvavlaggriveqgadv-----------------------
00469451   1/1  DpetraeilrlLkelakelgvtvilvtH........Asdrvlvlrdgrivevgtpdell-----------
00468691   1/1  GqrqrvalAr.....pvlLllDEptsgldalre.ilellrellke-------------------------
00488521   1/1  saldvsllrellrlLkrlakelgvtvllvthdldevarladrvlvlaggrivehgadtvlllepl..---
00496111   1/1  elraellrllkrlkelgvtvilvthdleeaedladsgriavladgrivlegdlaelgl------------
00422141   1/1  llnpdegriltiedp............ieyvfqsp.nlfpl..---------------------------
00379601   1/1  .lrnkigyvfQdpv.lfpltvren......................------------------------
00485451   1/1  Dpetralelldllrtdldkelgrtiilvthdlreae..adrilvlrkgdivelgepqel-----------
00500611   1/1  eilrlLkrlakelgvtvllvthdlreveeladkrdrvvvlrggrive-----------------------
00436511   1/1  aqakreisalarellervglpgdlf---------------------------------------------
00468601   1/1  el...gltvlvvtKlDgtakgghdlslalrladrilvlgvGeive-------------------------
00371631   1/1  .....gledilvpvlsggqkqrlalaralvedpdvlilDgp-----------------------------
00448931   1/1  ..lrellellrel...gltvlvvthlDllakggadlslaleladrilvlgdGe-----------------
00503371   1/1  rldfldelagleeykgnyeellklleeleellkelekrlelleke-------------------------
00495031   1/1  dvqlvaeilrlLkrlakelgvtvilvthdlrevegrleladrvvvlr-----------------------
00485931   1/1  ..lrlllellkel...gltvlvvthddgtakggaalslaleladr-------------------------
00464791   1/1  ggqrqrlaiAraladdqgkpvllllDEptsgldal.re--------------------------------
00414121   1/1  asgedlldllkelaeqlgltvlivlnKiDllselthdlellreladr-----------------------
00437981   1/1  lleelak.gvtvilathdlsellpallsrcqvirfpplseeellei------------------------
00532531   1/1  .........................leladriyvllsGrivesgt-------------------------
00475371   1/1  llrelradlgllvvdathdldavlkaadrilvldlggivlnkldlvakggaalelaeelgvpl-------
00489571   1/1  lre...egttilvvth.ldeaer.aDrvavldd......Gtpeellarpanpyvrellgavpgllllall
00381441   1/1  al--------------------------------------------------------------------
00478411   1/1  lglneeldiilalellllde--------------------------------------------------
00457311   1/1  elldllifldadlgltlirlitrdlgeagrsadrvl....gri---------------------------
00387201   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00434401   1/1  .lldlpdlvifvdhdlevalerrlkrlgr-----------------------------------------
00462761   1/1  eellerleereplygadiviithdls.ieevadrilallegrl---------------------------
00437941   1/1  leelpk.gvtvilttnrleeldpallsRfdviefpppdeeelleilk-----------------------
00475521   1/1  dpdlv-----------------------------------------------------------------
00512891   1/1  elkrsgvtvilttndldel.eladriallrrgrivelgplseeelleilrrrlnr---------------
00426051   1/1  ptselleRllkrltrpgldadteeellellerla------------------------------------
00379961   1/1  Ep.daldpevqaaLlr------------------------------------------------------
00368571   1/1  agglagllegaektaasilellrkllallldlggpafdlrdllslgeglivlillslggek---------
00475381   1/1  ...........dlpdlvifld-------------------------------------------------
00490731   1/1  ellaelgadvvllvvdatlgleaadrilvlleglgvpgvvlNkldlvaeggaalell.............
00496571   1/1  ........rlgdteevlehrleraeeladrlialyegavvvidasglsleevveeileileellgelv--
00487021   1/1  elrdllrellpegilpdlvifldadpeelleR.....llkRg----------------------------
00464411   1/1  rllekleyikkrlehylelaepykddvvv-----------------------------------------
00356411   1/1  dpeelsggqkqrva--------------------------------------------------------
00503741   1/1  pdllilDEitnlldpetlspdvlelLlrlleeg-------------------------------------
00368501   1/1  ldlplhdasviallgggrelrdgellkalk..eaeaeellellglkdlllrkpsql--------------
00515531   1/1  qkqrvalar-------------------------------------------------------------
00484101   1/1  vldkvdlasil-----------------------------------------------------------
00480251   1/1  elakgllealgldgvvltkldlvaalgaalsvalilglpilflgtgenv..ddlevfnpgelvd------
00477971   1/1  elae..gfdvvivnhdleealelldrilvll---------------------------------------
00510561   1/1  ..sggkvdlvviDsltalapalelsllldeptsgldasl-------------------------------
00515511   1/1  kqrval----------------------------------------------------------------
00405881   1/1  llee......lggtvvlvSahdgegldelldailellkgk------------------------------
00532471   1/1  ldvelreelrdlleslllvlplpdlviy------------------------------------------
00498531   1/1  .lsggkpdlvviDsltalapslllldepgrvtqgldarllreilrllkr---------------------
00468951   1/1  .erllsggkpqlvviDsltalrpalllldeptgellgldvrllsellrl---------------------
00477011   1/1  rallknpdtlill---------------------------------------------------------
00533501   1/1  lrkrgrlelreldseevlekrlehylellekad.rvvvidag....------------------------
00478441   1/1  kl..lgidallelvdrle----------------------------------------------------
00451571   1/1  krleeqkqrvaiar--------------------------------------------------------
00406781   1/1  srrvlnaLlrlleelrllsgvtviattndlee--------------------------------------
00392701   1/1  rrrvlnaLlrlleglrllsgvtviattnrpeeldpallrpgrfdrii-----------------------
00513251   1/1  lardlgrpvlviflatspevlierlldrvllldegslvdlgvle--------------------------
00470731   1/1  ral.rRpgrllldep..eldppdreerleilkrllkklgtvldvthddel.ar-----------------
00404191   1/1  lllDEidalgldpel-------------------------------------------------------
00432181   1/1  llvvdadeptsfld--------------------------------------------------------
00513761   1/1  tqleilelllelllklgipiilvlnKlDllseeglelvlelleellellpil------------------
00379261   1/1  vlllsaslvlll----------------------------------------------------------
00493431   1/1  rlkrlleelgplieydyvivnddleealeelldiivvlllglilqpgsll--------------------
00499191   1/1  ....lrpladlvifldaspee-------------------------------------------------
00439861   1/1  iiDeltalldaervrelrellralkrlakelgv-------------------------------------
00394721   1/1  lnaLlrlledg...nvlviattnrpellgrleldpallrrfdvielgppd--------------------
00498811   1/1  lelylelaplygaadividndlsleevvdri---------------------------------------
00386741   1/1  egeltivgggllteld------------------------------------------------------
00402371   1/1  naLlrlleeg...nvrviaatnrpelvklgeldpallrRfdv----------------------------
00410531   1/1  glaglegvpiilvgnKlDlldalllrevsaelalelakelgikfie------------------------
00482551   1/1  ldepllgldarelrellrlLkrlakelgvtviltsqltrevedradk-----------------------
00444381   1/1  .......segailsggfkqrvgia..lladpgilflDEidkllddrgeae--------------------
00410321   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00511381   1/1  leladtgilvlvtglemdfagelfegsllL----------------------------------------
00499331   1/1  rldgreddslellekrleryeeltrdlielyeea------------------------------------
00517691   1/1  gallvvdadegvs---------------------------------------------------------
00409841   1/1  ieallrale....---------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00437921   1/1  llDEi.drldpdaqnal-----------------------------------------------------
00367291   1/1  lDEidalagkrg----------------------------------------------------------
00487061   1/1  agagyllggldleevkaleel-------------------------------------------------
00420941   1/1  lapkrsptsald----------------------------------------------------------
00437901   1/1  lklldglrdlsg----------------------------------------------------------
00489631   1/1  lkRdgrteeeilerlarleeryradlvivtddl.------------------------------------
00480441   1/1  erlapeleyyeelgladvvivnddleealelllailla--------------------------------
00533151   1/1  leddseevlekrlerylklyerliepyeeaddv-------------------------------------
00473941   1/1  aLlelleelqvt----------------------------------------------------------
00508671   1/1  vaiarplelaae----------------------------------------------------------
00461621   1/1  lv--------------------------------------------------------------------
00478081   1/1  llleepppdlvifldadpevl-------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00416171   1/1  eg--------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00401211   1/1  lllDtPGh.....---------------------------------------------------------
00476071   1/1  pdlvifldappevlleRllkRggdsleeiekrlerylela------------------------------
00471271   1/1  ----------------------------------------------------------------------
00482721   1/1  lleRllkRg...gdseeeiekrleryreiaplleaad.lvidndgs------------------------
00478131   1/1  ----------------------------------------------------------------------
00515351   1/1  dseeeilerleryreeleplleeyddalvvidadgsleevvee---------------------------
00430121   1/1  dvlnaLlqllee----------------------------------------------------------
00521551   1/1  apkrsptsgldd----------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00472911   1/1  lkelg..pvlvifldadpevl-------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00496061   1/1  lereddseevlekrlerylelyerliepykkadyvivi--------------------------------
00444821   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00478391   1/1  dlvifldapleelleRllkrgrhpeseevle---------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00457851   1/1  greplddteevilkrlerlrelyerliepyeead------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00464421   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00447401   1/1  elylrgadgvllV---------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LPVR------------------------------------------------------------------
00390411   1/1  ----------------------------------------------------------------------
00422801   1/1  ----------------------------------------------------------------------
00490801   1/1  ----------------------------------------------------------------------
00510251   1/1  ----------------------------------------------------------------------
00379581   1/1  ----------------------------------------------------------------------
00458601   1/1  ----------------------------------------------------------------------
00475891   1/1  ----------------------------------------------------------------------
00378981   1/1  ----------------------------------------------------------------------
00475991   1/1  ----------------------------------------------------------------------
00482201   1/1  ----------------------------------------------------------------------
00404101   1/1  ----------------------------------------------------------------------
00367901   1/1  ----------------------------------------------------------------------
00420701   1/1  ----------------------------------------------------------------------
00500441   1/1  ----------------------------------------------------------------------
00466931   1/1  ----------------------------------------------------------------------
00482261   1/1  ----------------------------------------------------------------------
00530591   1/1  ----------------------------------------------------------------------
00502741   1/1  ----------------------------------------------------------------------
00361211   1/1  ----------------------------------------------------------------------
00466971   1/1  ----------------------------------------------------------------------
00425571   1/1  ----------------------------------------------------------------------
00440861   1/1  ----------------------------------------------------------------------
00509431   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00367481   1/1  kl--------------------------------------------------------------------
00436071   1/1  ----------------------------------------------------------------------
00372301   1/1  ----------------------------------------------------------------------
00424961   1/1  ----------------------------------------------------------------------
00495371   1/1  ----------------------------------------------------------------------
00469451   1/1  ----------------------------------------------------------------------
00468691   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00422141   1/1  ----------------------------------------------------------------------
00379601   1/1  ----------------------------------------------------------------------
00485451   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00371631   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00503371   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00464791   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00532531   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00489571   1/1  llle------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00426051   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00368571   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00487021   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00477971   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00405881   1/1  ----------------------------------------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00533501   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00493431   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00498811   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00469161   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00480441   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00482721   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00526911   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00464421   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00531961   1/1  ----------------------------------------------------------------------