[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ56459.1


[Show Plain Result]

## Summary of Sequence Search
   1::416
 278::416  5.4e-25 31.7% 0039121 00391211 1/1   odon-binding domain of a subclass of cl 
 279::416  5.2e-22 33.9% 0035690 00356901 1/1   odon-binding domain of a subclass of cl 
  37::121  0.00048 23.2% 0035692 00356921 1/1   yl-tRNA synthetase (ArgRS), N-terminal  
  42::139  0.00071 18.8% 0039123 00391231 1/1   yl-tRNA synthetase (ArgRS), N-terminal  
   1::416


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPEADRGRDTFAVLPGTPHIRPCTGAHMAMTALSFAAATPRYLSDLIRHACTEATGIPAAHLPDAPLRRS
00391211   1/1  ----------------------------------------------------------------------
00356901   1/1  ----------------------------------------------------------------------
00356921   1/1  ------------------------------------eslserlsllgldeleelksssllmnildllrel
00391231   1/1  -----------------------------------------dlkellaealkaalglllllieillelpk


                         -         -         *         -         -         -         -:140
query           TDQPGQYLSPLPSRLAGRLGRAARDLAADITAVLRNQPHLTDVQVTGPGFVAVTPVPSMRAALAQLVADA
00391211   1/1  ----------------------------------------------------------------------
00356901   1/1  ----------------------------------------------------------------------
00356921   1/1  iaealsellgldlelieillelpkdkelGDfatnlam.l.kvlgknPrelA-------------------
00391231   1/1  dkehGDfatn.alvlakvlkknPreiAeelvekldlddliekveiaGp.fiNffldkealaelvleill-


                         +         -         -         -         -         *         -:210
query           PAAFLLDLAVPGVAHQPGPPPDGWALSDLAHARDSGQLRDWARADARRRIAAAADPATAPAAAAALTRQP
00391211   1/1  ----------------------------------------------------------------------
00356901   1/1  ----------------------------------------------------------------------
00356921   1/1  ----------------------------------------------------------------------
00391231   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           PADWRDVPQDNTATEAAQLLTVIGEAAARVAACRSAADQVRPQETTGPDLPARPSPHAPGAWARATAANP
00391211   1/1  -------------------------------------------------------------------gnt
00356901   1/1  --------------------------------------------------------------------nt
00356921   1/1  ----------------------------------------------------------------------
00391231   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           AFALRYAHAHAHTAVHHWAAQLGLRRLGTRRRHTADEVAALTTPAAEALLGTLFDGPAALRAAARRHQPH
00391211   1/1  apylqYahaRicsilrkagelll.............dllllleeaelaLlllllrfpevlekaaedlePh
00356901   1/1  apylqYahaRicsilrkagell.......lellaladllllteeaelaLlllllrfpevlekaaedlePh
00356921   1/1  ----------------------------------------------------------------------
00391231   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           ILVRYLESLAAAYHEWWESHSVLPGHEGTADTHTTTVAARLDLCAAAAGVLRAGLLLIGVSAPTRL----
00391211   1/1  lladYlleLaslfnsfynalkvlgeeellleellelrlaRLlLvlavrqvLkngldlLGiealekm----
00356901   1/1  lladYlleLaslfnsfynalrvlgedee.......lrlaRLlLvlavrqvLkngldlLGiealerm----
00356921   1/1  ----------------------------------------------------------------------
00391231   1/1  ----------------------------------------------------------------------