[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ56580.1


[Show Plain Result]

## Summary of Sequence Search
   1::385
 107::309  1.8e-61 46.5% 0035376 00353761 1/1   thione synthetase ATP-binding domain-li 
 106::310  2.7e-56 42.1% 0046656 00466561 1/1   thione synthetase ATP-binding domain-li 
 108::312  4.6e-49 37.1% 0044434 00444341 1/1   thione synthetase ATP-binding domain-li 
 107::313  1.1e-48 38.2% 0036618 00366181 1/1   thione synthetase ATP-binding domain-li 
 110::377  2.7e-47 32.8% 0034972 00349721 1/1   thione synthetase ATP-binding domain-li 
 107::304  1.2e-45 41.1% 0046457 00464571 1/1   thione synthetase ATP-binding domain-li 
 107::309  2.6e-44 34.0% 0044852 00448521 1/1   thione synthetase ATP-binding domain-li 
 107::311  3.4e-43 34.2% 0038251 00382511 1/1   thione synthetase ATP-binding domain-li 
  85::354  5.8e-43 29.2% 0050408 00504081 1/1   thione synthetase ATP-binding domain-li 
  98::301  3.1e-42 36.7% 0047322 00473221 1/1   thione synthetase ATP-binding domain-li 
 108::304  2.3e-40 34.8% 0044272 00442721 1/1   thione synthetase ATP-binding domain-li 
 107::313  6.7e-38 33.0% 0037006 00370061 1/1   thione synthetase ATP-binding domain-li 
 108::303  1.5e-36 38.3% 0047408 00474081 1/1   thione synthetase ATP-binding domain-li 
 104::305  2.4e-35 32.3% 0045447 00454471 1/1   thione synthetase ATP-binding domain-li 
  97::306  2.5e-31 32.1% 0035215 00352151 1/1   thione synthetase ATP-binding domain-li 
  10::106  6.5e-21 39.2% 0037275 00372751 1/1   P-grasp domain                          
   8::106  9.3e-19 38.5% 0045887 00458871 1/1   P-grasp domain                          
 106::304  1.2e-17 26.5% 0038243 00382431 1/1   thione synthetase ATP-binding domain-li 
 311::387  4.3e-17 45.7% 0035374 00353741 1/1   ent single hybrid motif                 
 103::281  2.7e-16 26.9% 0046632 00466321 1/1   thione synthetase ATP-binding domain-li 
 312::384  4.4e-14 37.0% 0037274 00372741 1/1   ent single hybrid motif                 
 107::279  5.8e-12 26.2% 0045751 00457511 1/1   thione synthetase ATP-binding domain-li 
   1::385


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSETNRTVPVVGMVGGGQLARMTHQAAIALGVDFRVLAARPTDSAARVVADVHLGDDRGRDDLLAFAKDS
00353761   1/1  ----------------------------------------------------------------------
00466561   1/1  ----------------------------------------------------------------------
00444341   1/1  ----------------------------------------------------------------------
00366181   1/1  ----------------------------------------------------------------------
00349721   1/1  ----------------------------------------------------------------------
00464571   1/1  ----------------------------------------------------------------------
00448521   1/1  ----------------------------------------------------------------------
00382511   1/1  ----------------------------------------------------------------------
00504081   1/1  ----------------------------------------------------------------------
00473221   1/1  ----------------------------------------------------------------------
00442721   1/1  ----------------------------------------------------------------------
00370061   1/1  ----------------------------------------------------------------------
00474081   1/1  ----------------------------------------------------------------------
00454471   1/1  ----------------------------------------------------------------------
00352151   1/1  ----------------------------------------------------------------------
00372751   1/1  ---------tllgtpllpgatkvlilGgGqlGrmlalaaarlGievialdpyadapaaqvadevivadyl
00458871   1/1  -------lktigilGgGqLGrmlalaaarlglevivldpdadapa....................laekv
00382431   1/1  ----------------------------------------------------------------------
00353741   1/1  ----------------------------------------------------------------------
00466321   1/1  ----------------------------------------------------------------------
00372741   1/1  ----------------------------------------------------------------------
00457511   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           DVVTFDHEHVPQPVLRELHDAGIVLRPGPEALHHAQDKLVMRTRLSELGAPCPRWRGITSLDEVTEFAGQ
00353761   1/1  ------------------------------------Dkllakelleklglptapyalvdsleellaaaee
00466561   1/1  -----------------------------------gDKllakellaeagiptppyalvtsleealeaaee
00444341   1/1  -------------------------------------Kllakellakagipvppgllavatsleealaaa
00366181   1/1  ------------------------------------DKllakellakagipvppglllavvtsleealaa
00349721   1/1  ---------------------------------------lfkelleelgiptpkyavatsleealaaaee
00464571   1/1  ------------------------------------DKlltklllaeagipvppgvlvtsleea..aaee
00448521   1/1  ------------------------------------dkylakellkkagiptpkgavatspeealeaaee
00382511   1/1  ------------------------------------DKllakellakagiptppggvatsveealaaaee
00504081   1/1  --------------GflienailaqvlevagiplagdkvlakellkkagipvaPdllyegavvtsleeal
00473221   1/1  ---------------------------NspeairlagdKllakellaka.iptppglplptllvtsleea
00442721   1/1  -------------------------------------Kllakellakagipvpptlvatsleealaaaee
00370061   1/1  ------------------------------------DKvlakellakagipvppgvvltsleellllale
00474081   1/1  -------------------------------------Kllakqllaeagipvppgvlvtssdlllldlee
00454471   1/1  ---------------------------------laldkyeakellakagipvppggvatspeeaveaaee
00352151   1/1  --------------------------nspeaialamdKlltkkllaklqkklglagvpvpptsil...ed
00372751   1/1  dadalrelakaskcdvvtfefEnvpadaleelekeg----------------------------------
00458871   1/1  dvitlefEnvpldalellea.gvpvlPslealallq----------------------------------
00382431   1/1  -----------------------------------gdKl....llakaglpvPptlvasdleealeflee
00353741   1/1  ----------------------------------------------------------------------
00466321   1/1  --------------------------------rlaldeyqakellkeygipvpkgivatsaeealeaaee
00372741   1/1  ----------------------------------------------------------------------
00457511   1/1  ------------------------------------drelfsklldelglkqpesliatsleealelaee


                         +         -         -         -         -         *         -:210
query           TGWPVVLKAARGGYDGKGVWVVGDAAEAAAVVERAAREQVPLLVEEKIAFRRELAVQVARSPYGQVAAYP
00353761   1/1  lgyPvvvKparggYgGkgvsvvkseeeleaale....gdgevlvEefvegdreisvlvlrdgdgevvfyp
00466561   1/1  igyPvvvKpa.ggggGkGvrvvrseeeleaaleealeeslfgdgevlvEefiegareisvlvlrdgdgvv
00444341   1/1  eelgyPvvvKpa.gggggrGvrvvkseeeleealeealgealagfgddpvlvEeflegareievlvlg..
00366181   1/1  aeeigyPvvvKpa.ggggGkGvrvvrdeeeleealeealeealagsgdgpvlveeflegareievlvlg.
00349721   1/1  igyPvvvKp........Gvsvvyneeeleeal......dhpvlveeflegakEvsvdvvrdgggvv.ilg
00464571   1/1  lgyPvvvKpargg.ggkGvsivrseeeleaaleealegddevlvEefieg.reievlvlgd.ggevvvlp
00448521   1/1  igyPvvvKps.ggagGrGvvvvkseeeleealeealgealvgsgdgpvlvEefleg.rEisvlvlrdgeg
00382511   1/1  igyPvvvKpsggg.gGkGvrvvrseeeleealeealgealagsgdgevlvEefle.greisvlvlgdggg
00504081   1/1  eaaeeigyPvvvKpsr.ggggrGvrivkseeeleaaleealaespgspvlveefiegareyevdvladgd
00473221   1/1  lefaeelgyPvvvKpa.ggggGkGvrivkneeeleaaleealseddpvlveefiegpreirvlvlgdg..
00442721   1/1  igyPvvvKpl.ygggGrgvrlvrdeeeleaaleealeeaasgdgpvlveeflegpereirvlvvgd....
00370061   1/1  aaeelgyPvvvKpaaggg.GkGvsvvkneeeleealeeaffydsevlvEefiegarEievqvlgdgkgnv
00474081   1/1  alaaaeelgyPvvvKpaagg.ggkGvsvvrneeeleealelalegddevlvEefie.greievlvlgdg.
00454471   1/1  igyPkvVvKa.svglgGrgkaGGvrlvkseeeleeaaeellgevlvtlqtalagspvdgvlveefldgar
00352151   1/1  akelaeklgyPvvvKplyggs.Gkgvvkveneeeledalelaalldspvlveefidggrdirvqvlgdkv
00372751   1/1  ----------------------------------------------------------------------
00458871   1/1  ----------------------------------------------------------------------
00382431   1/1  lg.pvvlKpl.dgsgGrgvflvededelldaleelltlsgngpvlvqeylpgikegdirvlvv...ggev
00353741   1/1  ----------------------------------------------------------------------
00466321   1/1  lgykpvVvKaq.vlagGrGkailhksdvGGVklvlsleeakeaaeeilgkvlvtkqtglaglpvngvlve
00372741   1/1  ----------------------------------------------------------------------
00457511   1/1  igyPvlvrPs.yvlgGrgmeivyneeeLeeyleealkvsplhpvlidkfllgakevevdvvrdlgdnvii


                         -         -         -         +         -         -         -:280
query           VVETVQRGGICHEVIAPAPHLSEDRAVAAQELAIELAAALDVVGLLAVELFETDTGVVVNELAMRPHNSG
00353761   1/1  lveniqrngilvgsvaPap.lsdelleeareialkiaealgyvGvlgveffvtgdgllvnEvnprphnsg
00466561   1/1  i.fevdenvqrngvhsgevapap.lsdelleelreialkaaralgyvgllgveffvddgelyviEvnprp
00444341   1/1  dgegavvllgerdesagvhtggvieeapaptlseelleeirelalkaakalgyrGllgvdflvdedgely
00366181   1/1  .dgegvvillgerdhdagvhtggsieeapaptlseelleeirelalkaaralgyvGllgveflvddgely
00349721   1/1  iiehieeagvhtgdsgvvlppatlsdelleelreiakkiaralglrGllnvdffvtddevyviEvNprps
00464571   1/1  vveiipgngiydgeakyslgrrhqksievapap.lsdelleelrelalkaakalglrglarvdffvdedg
00448521   1/1  vvvliiasdhggvyiedvgvntggsiavapap.lseelleeireialkiakalgleglayvgllgvefll
00382511   1/1  vv.vlavaerhqkvgiedagvhtggsgavapaptltdelleeireiavkptldglaakalgyvgvlgvef
00504081   1/1  gevvalgirecsvgihtgdsievapaltlpdelleelreaalklakalglvgaggveflvdpkdgepyvl
00473221   1/1  ...vlpaierspeggflsntg.gpaalspelleeireialkaakalgyrgllgvdflldkdgepyllEvN
00442721   1/1  .evvaavirrh.gdviaevhaggsalvaplteelrelalkaakalgl.glagvdflvddgelyvlEvNpr
00370061   1/1  vvlgerecslqrrhqkfydyeakyhtggsieeappadlsdelreeirelavkaakalgyrglarvdflld
00474081   1/1  ....vlpvvelvdpkgfydgdakyrtggvievapap.lsdelleeirelalkaakalglrgllgvdflld
00454471   1/1  ElyvgvvrdrvfgnvvllgsmeGGvdiesvgrhsgdlievapadaltgllrerarelalklglalgyvga
00352151   1/1  vaavrrii.egdwkanvhggslepap.lsee....lrelalkaakalgglglagvdflvdkdgelyvlEv
00372751   1/1  ----------------------------------------------------------------------
00458871   1/1  ----------------------------------------------------------------------
00382431   1/1  vaailrrvpaggdfrsnlalggsaeaaplteelrelalkaaralkelgl.gfvgvDii....gpyvlEvN
00353741   1/1  ----------------------------------------------------------------------
00466321   1/1  efldgarElylgilldrafgvv...lliasgeGGvdiEevadvapelipkivvdalegltdeiarkllkg
00372741   1/1  ----------------------------------------------------------------------
00457511   1/1  vgimehiepaGvhsGdsivvlPpqtlsdeelerlrdatlkiaralgvevGllnvqfaldpkdgelyvie-


                         -         *         -         -         -         -         +:350
query           HWTIDGACTSQFEQHLRAVLDLPLGSPRTVAPFTVMANLLGGHDPHVFNRYIHVMARDPELKVHFYGKEV
00353761   1/1  hvtllatgislfelhlraalGlplgelvl-----------------------------------------
00466561   1/1  gvtgpvtlkatgidlaelalraalglplge----------------------------------------
00444341   1/1  viEvNprpgvsgpvtekatgidlvelalraal--------------------------------------
00366181   1/1  vlEvNprpgvtgpvtekatgidlvelalraalg-------------------------------------
00349721   1/1  rtvplvskatgvslaelalraalglplpelp..llfepaldyvvvkep........vfpfdkfvgvdlyl
00464571   1/1  evyvlEvNprpgltghslvpllak----------------------------------------------
00448521   1/1  tdgepyvlEiNprpgdtehpllelatgid-----------------------------------------
00382511   1/1  lldkdgepyviEvNprpgdpehpvvlkatgi---------------------------------------
00504081   1/1  EvNpRpggehpltekatgvdlvelalrlalglplpelelirtlvgaa............pidgvvvevpl
00473221   1/1  prpglglvehppleaalgidl-------------------------------------------------
00442721   1/1  pgvtgpekatg..idlaelilrla----------------------------------------------
00370061   1/1  edgepyviEvNtrpgvtgtslhpvtekatgidl-------------------------------------
00474081   1/1  edgepyvlEvNtrpgltetslvp-----------------------------------------------
00454471   1/1  ladlllnvefllvdgdlyvlEiNpr---------------------------------------------
00352151   1/1  Ntrpgleglv....tgidlakliakl--------------------------------------------
00372751   1/1  ----------------------------------------------------------------------
00458871   1/1  ----------------------------------------------------------------------
00382431   1/1  vrsppgflgielatgidlaeliad----------------------------------------------
00353741   1/1  ------------------------------lspavmvNllGedl.......lelllalpgaklhlYgKev
00466321   1/1  l---------------------------------------------------------------------
00372741   1/1  -------------------------------gPaasavilaegesagpvydgleaalapgadlhlyGKpe
00457511   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           RPGRKIGHVTVVGDDPEALLERARTAAAYLKGDAQ-----------------------------------
00353761   1/1  ----------------------------------------------------------------------
00466561   1/1  ----------------------------------------------------------------------
00444341   1/1  ----------------------------------------------------------------------
00366181   1/1  ----------------------------------------------------------------------
00349721   1/1  gp..emrstgevmaigrdfeeAllkal-------------------------------------------
00464571   1/1  ----------------------------------------------------------------------
00448521   1/1  ----------------------------------------------------------------------
00382511   1/1  ----------------------------------------------------------------------
00504081   1/1  isfe------------------------------------------------------------------
00473221   1/1  ----------------------------------------------------------------------
00442721   1/1  ----------------------------------------------------------------------
00370061   1/1  ----------------------------------------------------------------------
00474081   1/1  ----------------------------------------------------------------------
00454471   1/1  ----------------------------------------------------------------------
00352151   1/1  ----------------------------------------------------------------------
00372751   1/1  ----------------------------------------------------------------------
00458871   1/1  ----------------------------------------------------------------------
00382431   1/1  ----------------------------------------------------------------------
00353741   1/1  rpgRKvGHvtllgddleellerlellllllleellld---------------------------------
00466321   1/1  ----------------------------------------------------------------------
00372741   1/1  arpgRkmGvvlalgedleealekarkaasllkvr------------------------------------
00457511   1/1  ----------------------------------------------------------------------