[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ56592.1


[Show Plain Result]

## Summary of Sequence Search
   1::460
   1::331  1.2e-57 34.6% 0037441 00374411 1/1   AD(P)-binding domain                    
   1::316    7e-57 32.3% 0046274 00462741 1/1   AD(P)-binding domain                    
   1::332  1.2e-55 32.9% 0049150 00491501 1/1   AD(P)-binding domain                    
   1::331    2e-53 29.9% 0043577 00435771 1/1   AD(P)-binding domain                    
   1::334  2.9e-53 27.0% 0047029 00470291 1/1   AD(P)-binding domain                    
   1::331    6e-53 31.2% 0036092 00360921 1/1   AD(P)-binding domain                    
   1::362  8.4e-53 37.6% 0040049 00400491 1/1   AD(P)-binding domain                    
   1::378  2.7e-52 30.2% 0047022 00470221 1/1   AD(P)-binding domain                    
   1::332  2.6e-50 30.6% 0040035 00400351 1/1   AD(P)-binding domain                    
   1::292  9.4e-49 31.9% 0050363 00503631 1/1   AD(P)-binding domain                    
   1::359    2e-48 28.7% 0046128 00461281 1/1   AD(P)-binding domain                    
   1::361  2.3e-47 29.8% 0041341 00413411 1/1   AD(P)-binding domain                    
   2::230  2.3e-47 34.7% 0048583 00485831 1/1   AD(P)-binding domain                    
   1::332  1.8e-46 29.8% 0048494 00484941 1/1   AD(P)-binding domain                    
   1::332  2.7e-46 36.8% 0035989 00359891 1/1   AD(P)-binding domain                    
   2::335  1.4e-45 39.6% 0045797 00457971 1/1   AD(P)-binding domain                    
   1::367  1.8e-45 31.6% 0039664 00396641 1/1   AD(P)-binding domain                    
   1::338  2.4e-45 42.7% 0050927 00509271 1/1   AD(P)-binding domain                    
   1::332  1.1e-44 30.1% 0052600 00526001 1/1   AD(P)-binding domain                    
   2::229  4.8e-44 32.7% 0047564 00475641 1/1   AD(P)-binding domain                    
   1::318  5.5e-44 34.3% 0040660 00406601 1/1   AD(P)-binding domain                    
   1::376  8.4e-44 33.5% 0052032 00520321 1/1   AD(P)-binding domain                    
   1::333    6e-42 34.5% 0046446 00464461 1/1   AD(P)-binding domain                    
   2::332  9.9e-42 29.8% 0045870 00458701 1/1   AD(P)-binding domain                    
   1::331  2.3e-41 29.6% 0047327 00473271 1/1   otide-binding domain                    
   1::332    3e-41 33.1% 0046270 00462701 1/1   AD(P)-binding domain                    
   1::220    2e-40 39.6% 0047068 00470681 1/2   AD(P)-binding domain                    
   2::334  4.8e-40 30.9% 0045881 00458811 1/1   AD(P)-binding domain                    
   1::344  6.1e-40 31.2% 0048356 00483561 1/1   AD(P)-binding domain                    
   1::340    7e-40 35.2% 0053321 00533211 1/1   AD(P)-binding domain                    
   1::332  9.9e-40 35.2% 0049003 00490031 1/1   AD(P)-binding domain                    
   1::351  1.1e-36 31.7% 0049990 00499901 1/1   otide-binding domain                    
   1::331  1.5e-36 32.7% 0040602 00406021 1/1   AD(P)-binding domain                    
   1::234  5.3e-35 37.4% 0047141 00471411 1/1   otide-binding domain                    
   1::233  4.4e-34 30.6% 0049222 00492221 1/2   AD(P)-binding domain                    
 171::343    6e-34 35.7% 0047270 00472702 2/2   AD(P)-binding domain                    
 173::335  5.2e-33 34.4% 0048364 00483642 2/2   AD(P)-binding domain                    
   1::366    1e-32 25.8% 0047682 00476821 1/1   AD(P)-binding domain                    
 170::332  3.5e-32 34.0% 0036300 00363002 2/2   AD(P)-binding domain                    
 173::336  8.2e-32 36.5% 0050960 00509602 2/2   AD(P)-binding domain                    
   1::213  1.4e-31 34.1% 0036459 00364591 1/2   otide-binding domain                    
 155::335  1.7e-31 35.8% 0048199 00481992 2/2   AD(P)-binding domain                    
 171::338  2.5e-31 36.5% 0048865 00488652 2/2   AD(P)-binding domain                    
   1::272  8.4e-31 25.7% 0044413 00444131 1/1   AD(P)-binding domain                    
 170::331  1.2e-30 35.0% 0046514 00465142 2/2   AD(P)-binding domain                    
 168::336  3.6e-30 36.0% 0050148 00501482 2/2   AD(P)-binding domain                    
 174::335  7.4e-30 36.6% 0046760 00467602 2/2   AD(P)-binding domain                    
   1::309  9.3e-30 29.9% 0046579 00465791 1/1   AD(P)-binding domain                    
   1::213    1e-29 38.7% 0046750 00467501 1/2   AD(P)-binding domain                    
 339::456  1.3e-29 43.2% 0050928 00509281 1/1   AD-linked reductases, dimerisation (C-t 
 171::335  2.1e-29 35.2% 0038074 00380742 2/2   AD(P)-binding domain                    
   1::155  3.8e-29 36.7% 0048607 00486071 1/2   AD(P)-binding domain                    
 339::456  8.4e-29 40.7% 0038450 00384501 1/1   AD-linked reductases, dimerisation (C-t 
 339::461  1.1e-28 41.5% 0040690 00406901 1/1   AD-linked reductases, dimerisation (C-t 
 339::455  1.3e-28 42.7% 0037510 00375101 1/1   AD-linked reductases, dimerisation (C-t 
 339::451  1.4e-28 41.6% 0041941 00419411 1/1   AD-linked reductases, dimerisation (C-t 
   3::267  1.6e-28 30.8% 0048016 00480161 1/1   otide-binding domain                    
   1::267  3.2e-28 27.9% 0046156 00461561 1/1   otide-binding domain                    
 172::335  3.8e-28 35.8% 0037643 00376432 2/2   AD(P)-binding domain                    
 339::455  3.9e-28 41.9% 0041887 00418871 1/1   AD-linked reductases, dimerisation (C-t 
   1::203  4.5e-28 40.3% 0048807 00488071 1/1   otide-binding domain                    
 339::461  4.5e-28 39.8% 0039504 00395041 1/1   AD-linked reductases, dimerisation (C-t 
 339::462  7.7e-28 39.5% 0045533 00455331 1/1   AD-linked reductases, dimerisation (C-t 
 339::461  8.1e-28 39.8% 0036655 00366551 1/1   AD-linked reductases, dimerisation (C-t 
 339::462    9e-28 39.5% 0040604 00406041 1/1   AD-linked reductases, dimerisation (C-t 
 338::455  1.6e-27 41.5% 0035130 00351301 1/1   AD-linked reductases, dimerisation (C-t 
 341::455  2.6e-27 42.6% 0036890 00368901 1/1   AD-linked reductases, dimerisation (C-t 
 339::460  4.1e-27 41.8% 0041023 00410231 1/1   AD-linked reductases, dimerisation (C-t 
 151::285  5.5e-27 36.0% 0045519 00455192 2/2   AD(P)-binding domain                    
 171::338  1.4e-26 36.4% 0047133 00471332 2/2   AD(P)-binding domain                    
 144::265  1.5e-26 33.6% 0038285 00382852 2/2   AD(P)-binding domain                    
 339::451  1.6e-26 44.2% 0038076 00380761 1/1   AD-linked reductases, dimerisation (C-t 
 168::331  2.5e-26 34.0% 0044098 00440982 2/2   AD(P)-binding domain                    
 168::331  2.6e-26 36.3% 0040688 00406882 2/2   AD(P)-binding domain                    
   3::150  2.8e-26 34.3% 0048199 00481991 1/2   AD(P)-binding domain                    
 153::265  2.9e-26 36.3% 0045798 00457982 2/2   AD(P)-binding domain                    
 339::451  3.5e-26 42.5% 0045520 00455201 1/1   AD-linked reductases, dimerisation (C-t 
 174::335  3.6e-26 35.4% 0046416 00464162 2/2   AD(P)-binding domain                    
 174::335  9.9e-26 33.5% 0045518 00455182 2/2   AD(P)-binding domain                    
 145::267  1.5e-25 34.7% 0048584 00485842 2/2   AD(P)-binding domain                    
 148::268    3e-25 32.5% 0048108 00481082 2/2   AD(P)-binding domain                    
 151::266  3.6e-25 32.8% 0053322 00533222 2/2   AD(P)-binding domain                    
 152::266  8.8e-25 34.8% 0048045 00480452 2/2   AD(P)-binding domain                    
 150::264  1.7e-24 33.0% 0047565 00475652 2/2   AD(P)-binding domain                    
   1::214  1.9e-24 32.3% 0052963 00529631 1/2   AD(P)-binding domain                    
   1::216  2.4e-24 29.0% 0052313 00523131 1/2   AD(P)-binding domain                    
 144::266  2.4e-24 33.3% 0048866 00488662 2/2   AD(P)-binding domain                    
 151::266  3.2e-24 32.8% 0048009 00480092 2/2   AD(P)-binding domain                    
   1::154    5e-24 36.0% 0040688 00406881 1/2   AD(P)-binding domain                    
 153::266  5.2e-24 33.6% 0038449 00384492 2/2   AD(P)-binding domain                    
 149::265  9.6e-24 33.0% 0041940 00419402 2/2   AD(P)-binding domain                    
 152::266  1.7e-23 34.8% 0046973 00469732 2/2   AD(P)-binding domain                    
 148::265  2.2e-23 35.6% 0036654 00366542 2/2   AD(P)-binding domain                    
 152::266  2.6e-23 30.4% 0046972 00469722 2/2   AD(P)-binding domain                    
 338::462  2.7e-23 39.5% 0041394 00413941 1/1   AD-linked reductases, dimerisation (C-t 
 172::333  4.1e-23 28.1% 0052926 00529262 2/2   AD(P)-binding domain                    
 144::314  4.6e-23 25.1% 0037437 00374372 2/2   )-binding Rossmann-fold domains         
   1::149  7.5e-23 35.2% 0038074 00380741 1/2   AD(P)-binding domain                    
 151::264  7.8e-23 30.7% 0036889 00368892 2/2   AD(P)-binding domain                    
 151::266  2.3e-22 32.8% 0048200 00482002 2/2   AD(P)-binding domain                    
 155::267  8.2e-22 31.9% 0046761 00467612 2/2   AD(P)-binding domain                    
 138::309  2.2e-21 30.0% 0046344 00463442 2/2   AD(P)-binding domain                    
   2::143  7.6e-21 44.9% 0038449 00384491 1/2   AD(P)-binding domain                    
   1::146  1.4e-20 33.8% 0046416 00464161 1/2   AD(P)-binding domain                    
 145::267  2.9e-20 29.9% 0050961 00509612 2/2   AD(P)-binding domain                    
   1::146  4.4e-20 32.4% 0046514 00465141 1/2   AD(P)-binding domain                    
 172::382  1.1e-19 25.1% 0048771 00487712 2/2   AD(P)-binding domain                    
 172::304  1.4e-19 33.9% 0047909 00479092 2/2   )-binding Rossmann-fold domains         
   4::209  1.6e-19 30.9% 0052911 00529111 1/2   AD(P)-binding domain                    
 151::265  2.1e-19 27.2% 0048365 00483652 2/2   AD(P)-binding domain                    
   2::141  3.1e-19 41.9% 0036889 00368891 1/2   AD(P)-binding domain                    
   3::266  3.5e-19 27.0% 0050364 00503641 1/1   AD(P)-binding domain                    
   1::147  7.8e-19 26.2% 0045518 00455181 1/2   AD(P)-binding domain                    
   1::170  9.8e-19 35.7% 0047270 00472701 1/2   AD(P)-binding domain                    
   1::170    1e-18 39.1% 0048865 00488651 1/2   AD(P)-binding domain                    
   2::143  1.2e-18 48.9% 0046972 00469721 1/2   AD(P)-binding domain                    
   3::143  1.6e-18 44.8% 0046973 00469731 1/2   AD(P)-binding domain                    
   1::167  1.9e-18 30.1% 0037643 00376431 1/2   AD(P)-binding domain                    
 149::266  1.9e-18 31.6% 0036301 00363012 2/2   AD(P)-binding domain                    
   1::150  2.2e-18 38.4% 0044098 00440981 1/2   AD(P)-binding domain                    
   2::147  4.4e-18 28.1% 0047133 00471331 1/2   AD(P)-binding domain                    
   3::143  8.1e-18 46.5% 0048200 00482001 1/2   AD(P)-binding domain                    
   2::144  1.5e-17 43.2% 0048584 00485841 1/2   AD(P)-binding domain                    
   2::143  1.6e-17 45.5% 0048009 00480091 1/2   AD(P)-binding domain                    
   2::143  1.6e-17 45.5% 0053322 00533221 1/2   AD(P)-binding domain                    
 146::266  2.1e-17 26.1% 0049679 00496792 2/2   AD(P)-binding domain                    
   2::143  2.5e-17 42.7% 0048866 00488661 1/2   AD(P)-binding domain                    
 144::265  3.1e-17 29.1% 0044705 00447052 2/2   AD(P)-binding domain                    
   2::143  3.3e-17 42.0% 0048045 00480451 1/2   AD(P)-binding domain                    
   2::148  4.2e-17 47.1% 0045519 00455191 1/2   AD(P)-binding domain                    
   1::150  5.3e-17 37.4% 0036300 00363001 1/2   AD(P)-binding domain                    
   1::147  6.8e-17 34.5% 0050148 00501481 1/2   AD(P)-binding domain                    
   1::147  8.9e-17 31.2% 0046760 00467601 1/2   AD(P)-binding domain                    
   3::144  1.4e-16 36.0% 0042446 00424461 1/2   AD(P)-binding domain                    
   2::142  1.5e-16 46.5% 0036654 00366541 1/2   AD(P)-binding domain                    
   3::144  2.7e-16 44.8% 0050961 00509611 1/2   AD(P)-binding domain                    
   2::146  3.2e-16 38.5% 0048364 00483641 1/2   AD(P)-binding domain                    
   2::150  3.8e-16 38.5% 0050960 00509601 1/2   AD(P)-binding domain                    
   2::144  3.9e-16 43.8% 0046761 00467611 1/2   AD(P)-binding domain                    
   2::141  4.6e-16 45.9% 0047565 00475651 1/2   AD(P)-binding domain                    
   1::147  5.7e-16 34.8% 0052926 00529261 1/2   AD(P)-binding domain                    
 173::332  1.2e-15 25.7% 0046834 00468342 2/2   AD(P)-binding domain                    
 214::325  2.1e-15 33.3% 0036459 00364592 2/2   otide-binding domain                    
 145::267  3.8e-15 26.2% 0042446 00424462 2/2   AD(P)-binding domain                    
   3::158  9.5e-15 33.9% 0047909 00479091 1/2   )-binding Rossmann-fold domains         
 146::266    1e-14 27.6% 0047271 00472712 2/2   AD(P)-binding domain                    
   1::147  1.7e-14 31.5% 0046834 00468341 1/2   AD(P)-binding domain                    
   3::142  1.7e-14 41.9% 0048365 00483651 1/2   AD(P)-binding domain                    
   2::142  2.4e-14 45.7% 0044705 00447051 1/2   AD(P)-binding domain                    
 171::331  2.4e-14 27.1% 0047712 00477122 2/2   AD(P)-binding domain                    
   3::143  3.2e-14 41.2% 0049679 00496791 1/2   AD(P)-binding domain                    
   2::149  4.2e-14 32.5% 0045795 00457951 1/2   otide-binding domain                    
 172::332  5.1e-14 29.4% 0046057 00460572 2/2   otide-binding domain                    
   3::143  2.6e-13 34.8% 0038468 00384681 1/2   AD(P)-binding domain                    
   1::149  4.6e-13 31.6% 0046057 00460571 1/2   otide-binding domain                    
   3::143  6.8e-13 43.9% 0047271 00472711 1/2   AD(P)-binding domain                    
   3::143    1e-12 31.8% 0036301 00363011 1/2   AD(P)-binding domain                    
   1::147  1.5e-12 26.4% 0047712 00477121 1/2   AD(P)-binding domain                    
   1::149  5.2e-12 32.8% 0048771 00487711 1/2   AD(P)-binding domain                    
   3::144  1.7e-11 24.3% 0040619 00406191 1/2   AD(P)-binding domain                    
 174::311  2.1e-11 27.9% 0048607 00486072 2/2   AD(P)-binding domain                    
 146::266  2.2e-11 22.9% 0040619 00406192 2/2   AD(P)-binding domain                    
 144::266  8.9e-11 25.6% 0038468 00384682 2/2   AD(P)-binding domain                    
   3::141  2.1e-09 32.3% 0041940 00419401 1/2   AD(P)-binding domain                    
 174::310  3.4e-09 26.7% 0045795 00457952 2/2   otide-binding domain                    
   1::145    4e-09 35.2% 0048108 00481081 1/2   AD(P)-binding domain                    
   3::142  7.1e-09 34.5% 0038285 00382851 1/2   AD(P)-binding domain                    
   1::148  2.1e-08 28.0% 0044559 00445591 1/2   )-binding Rossmann-fold domains         
   3::143  2.2e-08 26.4% 0036016 00360161 1/2   AD(P)-binding domain                    
   3::142  8.7e-08 25.8% 0045798 00457981 1/2   AD(P)-binding domain                    
   3::82   9.3e-08 22.8% 0042342 00423421 1/2   )-binding Rossmann-fold domains         
   1::103  9.6e-08 24.3% 0047276 00472761 1/2   )-binding Rossmann-fold domains         
   1::145  1.9e-07 29.5% 0047992 00479921 1/2   )-binding Rossmann-fold domains         
   3::143  3.3e-07 37.3% 0045481 00454811 1/2    N-terminal domain                      
   3::141  3.9e-07 26.0% 0052964 00529641 1/2   AD(P)-binding domain                    
   3::132  5.8e-07 35.5% 0046344 00463441 1/2   AD(P)-binding domain                    
   3::143  6.8e-07 32.0% 0037437 00374371 1/2   )-binding Rossmann-fold domains         
   2::140  7.2e-07 27.4% 0046357 00463571 1/2   )-binding Rossmann-fold domains         
   2::143  2.4e-06 40.0% 0047278 00472781 1/2   )-binding Rossmann-fold domains         
   3::143  2.4e-06 33.3% 0053383 00533831 1/2   )-binding Rossmann-fold domains         
   2::143  3.8e-06 26.7% 0053172 00531721 1/2   )-binding Rossmann-fold domains         
 172::310  4.5e-06 19.4% 0050443 00504432 2/2   )-binding Rossmann-fold domains         
   1::152  5.7e-06 26.2% 0048227 00482271 1/2   )-binding Rossmann-fold domains         
   1::33   6.1e-06 39.4% 0035535 00355351 1/2   )-binding Rossmann-fold domains         
   1::33   1.6e-05 36.4% 0042534 00425341 1/2   )-binding Rossmann-fold domains         
   2::127  3.1e-05 25.2% 0048027 00480271 1/2   )-binding Rossmann-fold domains         
   2::145  6.2e-05 23.2% 0047346 00473461 1/2   )-binding Rossmann-fold domains         
   1::33   6.4e-05 33.3% 0050443 00504431 1/2   )-binding Rossmann-fold domains         
   1::33   7.6e-05 36.4% 0048102 00481021 1/2   )-binding Rossmann-fold domains         
 145::265    8e-05 21.4% 0052964 00529642 2/2   AD(P)-binding domain                    
 173::220  8.3e-05 31.9% 0046357 00463572 2/2   )-binding Rossmann-fold domains         
 146::266  8.8e-05 20.7% 0036016 00360162 2/2   AD(P)-binding domain                    
   2::34   0.00011 51.5% 0047510 00475101 1/2   )-binding Rossmann-fold domains         
   3::55   0.00011 34.0% 0037275 00372751 1/2   P-grasp domain                          
   1::33   0.00012 42.4% 0052837 00528371 1/2   )-binding Rossmann-fold domains         
   2::33   0.00016 50.0% 0042340 00423401 1/2   )-binding Rossmann-fold domains         
   3::33   0.00023 45.2% 0042366 00423661 1/2   )-binding Rossmann-fold domains         
   1::33   0.00027 36.4% 0046673 00466731 1/2   )-binding Rossmann-fold domains         
 172::249  0.00045 26.3% 0044559 00445592 2/2   )-binding Rossmann-fold domains         
   2::34   0.00063 39.4% 0045243 00452431 1/2   )-binding Rossmann-fold domains         
   3::33   0.00066 29.0% 0048035 00480351 1/2   )-binding Rossmann-fold domains         
   1::33   0.00078 42.4% 0036785 00367851 1/2   )-binding Rossmann-fold domains         
 172::220  0.00081 32.7% 0047992 00479922 2/2   )-binding Rossmann-fold domains         
   3::33   0.00084 45.2% 0036746 00367461 1/2   )-binding Rossmann-fold domains         
   3::145   0.0009 30.3% 0038379 00383791 1/1   )-binding Rossmann-fold domains         
   2::126   0.0011 25.2% 0040651 00406511 1/2   )-binding Rossmann-fold domains         
   3::33    0.0011 35.5% 0043276 00432761 1/2   )-binding Rossmann-fold domains         
   1::33    0.0013 36.4% 0048687 00486871 1/2    N-terminal domain                      
 130::225   0.0014 17.2% 0045243 00452432 2/2   )-binding Rossmann-fold domains         
 174::241   0.0014 30.9% 0037275 00372752 2/2   P-grasp domain                          
 216::338   0.0021 16.4% 0052963 00529632 2/2   AD(P)-binding domain                    
   2::33    0.0022 40.6% 0042180 00421801 1/2   )-binding Rossmann-fold domains         
   3::145   0.0025 32.0% 0048414 00484141 1/2   )-binding Rossmann-fold domains         
 168::208   0.0025 29.3% 0045481 00454812 2/2    N-terminal domain                      
   2::33    0.0043 40.6% 0050269 00502691 1/2   )-binding Rossmann-fold domains         
   2::146   0.0059 35.9% 0036664 00366641 1/2   )-binding Rossmann-fold domains         
 217::352   0.0075 13.2% 0052313 00523132 2/2   AD(P)-binding domain                    
   1::33     0.015 33.3% 0043507 00435071 1/2   )-binding Rossmann-fold domains         
 172::292     0.02 25.3% 0042340 00423402 2/2   )-binding Rossmann-fold domains         
 166::225     0.06 25.0% 0042534 00425342 2/2   )-binding Rossmann-fold domains         
 154::209    0.074 25.0% 0047278 00472782 2/2   )-binding Rossmann-fold domains         
 169::201    0.095 33.3% 0046673 00466732 2/2   )-binding Rossmann-fold domains         
 172::252     0.15 24.3% 0042342 00423422 2/2   )-binding Rossmann-fold domains         
 154::201     0.19 27.1% 0053383 00533832 2/2   )-binding Rossmann-fold domains         
 173::202     0.28 30.0% 0035535 00355352 2/2   )-binding Rossmann-fold domains         
 172::208     0.35 27.0% 0036746 00367462 2/2   )-binding Rossmann-fold domains         
 173::201     0.37 44.8% 0047276 00472762 2/2   )-binding Rossmann-fold domains         
 173::202     0.42 33.3% 0048102 00481022 2/2   )-binding Rossmann-fold domains         
 173::201     0.68 31.0% 0048227 00482272 2/2   )-binding Rossmann-fold domains         
 173::220     0.71 27.1% 0036664 00366642 2/2   )-binding Rossmann-fold domains         
 173::246     0.75 25.4% 0048687 00486872 2/2    N-terminal domain                      
 172::208     0.84 35.1% 0042366 00423662 2/2   )-binding Rossmann-fold domains         
 174::205     0.94 38.7% 0036785 00367852 2/2   )-binding Rossmann-fold domains         
 130::205      1.1 22.4% 0047510 00475102 2/2   )-binding Rossmann-fold domains         
 221::274      1.1 23.1% 0047068 00470682 2/2   AD(P)-binding domain                    
 213::283      1.3 21.4% 0052911 00529112 2/2   AD(P)-binding domain                    
 214::300      1.3 16.7% 0046750 00467502 2/2   AD(P)-binding domain                    
 172::207      1.4 27.8% 0043276 00432762 2/2   )-binding Rossmann-fold domains         
 173::222      2.2 22.0% 0050269 00502692 2/2   )-binding Rossmann-fold domains         
 170::201      2.7 28.1% 0047346 00473462 2/2   )-binding Rossmann-fold domains         
 172::236      3.4 20.0% 0043507 00435072 2/2   )-binding Rossmann-fold domains         
 173::201      3.9 27.6% 0052837 00528372 2/2   )-binding Rossmann-fold domains         
 234::331      4.1 14.3% 0049222 00492222 2/2   AD(P)-binding domain                    
 173::201      5.6 31.0% 0040651 00406512 2/2   )-binding Rossmann-fold domains         
 155::202      5.7 27.1% 0048414 00484142 2/2   )-binding Rossmann-fold domains         
 151::204      5.9 27.8% 0048035 00480352 2/2   )-binding Rossmann-fold domains         
 172::201      6.4 33.3% 0053172 00531722 2/2   )-binding Rossmann-fold domains         
 173::202      6.9 36.7% 0042180 00421802 2/2   )-binding Rossmann-fold domains         
 173::201       10 31.0% 0048027 00480272 2/2   )-binding Rossmann-fold domains         
   1::460


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTKVVIIGGGPGGYEAALVAAQLGADVTVIERDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINV
00374411   1/1  MpvligllesliidtalllgllpplsaskkydvvviGaGpaGlaaAleLaraGlkVtvlEardrlGGrlr
00462741   1/1  mlMkkkyDviiiGaGpaGlaaAleLaraGlkVlvlEkgdrlGGtwasngipgipsdggaavilgpellel
00491501   1/1  MirvcpalceslvvlaaglepplpplsaskkkdvvviGaGpaGlaaAyrLaraGlkVtvlEardrlGGrs
00435771   1/1  MkdVaviGAGiaGlaaAyeLaraGlkVtvlEardrlGGrsrtvgy.pgfrldlgaglipgsy........
00470291   1/1  lllllslsllllllsslllmmskeyDvviiGaGpaGlvaAlrLaelaGlkVlvlEa...GGtarnggyig
00360921   1/1  pplmmdeeydvvViGaGpaGlaaAlrLaraGlkVlvlEr...gG.rlasgripgklldggahllpgllee
00400491   1/1  MkdleyDvvvvGaGpaGlaaAlalaragpdlkvaliekgplgggasclngggipakllle..........
00470221   1/1  myDVvviGgGiaGlaaAlrLaraGlkVlvlEagdrlGGrlrtvrlgggtsldlggivfpgl.....ypal
00400351   1/1  MeyDvvvvGaGpaGlaaAlrLaraGlkVlvlErgdrpGGtsltnggpgfkldlgaalllg..........
00503631   1/1  masmsmkydvvIiGaGpaGlaaAlrLaraGlkvtvlEkgprlGgtwrtgrypglllllpallyllldlpl
00461281   1/1  glellllslltemmskeyDvvvvGaGpaGlvaAlrLaedaGlkVlvlEagdrlgGa...scipsgaglga
00413411   1/1  MpmsseeyDvvViGaGpaGlaaAlrlaraGlkVlllEkgpvlgGtssrnqggirldlgaipl........
00485831   1/1  -lsedkeyDVvviGgGpaGlaaAlalaraGlkVlllEkgpelggtclaaggipskallllalgllllela
00484941   1/1  aakkydvvIiGaGpaGlaaAlrLaraGlkVtvlEkgdrlGGrsrtggypgfpiidsgallf.........
00359891   1/1  MkeldeeyDvviiGaGpaGlsaAlrLaraG.kVlvlEkgpvlggtsglngggipggllld..........
00457971   1/1  -sekydvviiGaGpaGlaaAlrlarlaglkvlliekgrlgglllllayggil..................
00396641   1/1  MsylasaallaalpslletieyDVlviGgGpaGlsaAlelarlapdaGlkValvEkgdlgggasgrsggg
00509271   1/1  vydvviiGaGpaGlaaAlrlaraglklsevlllekdrlggtilllggvpsglllgaalll..........
00526001   1/1  MseeyDvvvvGaGpaGltaAleLaraGlkVlllEagdrvgGtslrngglphkglrelad..rlielleel
00475641   1/1  -lldkeyDVvviGgGpaGlaaAlrlaraGlkvlllEkgdrlgGtclnsgcipskalllaalglllllgaa
00406601   1/1  MddlpeeyDVvViGaGlaGlaaAaaLaraGlrVlvlEkrdrlGGtsatsrypGfrfdvggsllpgtipg.
00520321   1/1  MmdeeyDvviiGaGpaGlsaAlrLaraGlkVlvlEkgpllggtsglngggihaglskllldl........
00464461   1/1  MmplslllatalelplpalaldkkyDvvViGaGpaGlaaAlalaraGlkVlllEkgdrlGGtsltaggil
00458701   1/1  -ydVvvvGAGiaGlaaAlrLaeaGltdvlvlEagdrvGGrartvrypgfrfdlgahvflgpgg.......
00473271   1/1  MyDviviGaGiaGlaaAyrLakaGlkVlvlEkgdrlGGraatfrldgfrvdnvgahpfkgl.....npel
00462701   1/1  MMsplllalllllpllllaldeeydvvviGaGpaGlaaAlalaraGlkVlllEkgdrlGGtslrsggill
00470681   1/2  lllllmmmlhydvvviGgGpAGlaaAlrlarldpgarvllieke..pglgynrgclpkklllaaaelldl
00458811   1/1  -llydvvIiGaGpaGlsaAlrLaraGlkVlvlEkGplvnrdrlGGts.nggdg...rldlgahvfflllp
00483561   1/1  MskkydvviiGaGiaGlsaAlrLaraGlkVlllEkgdrlGGtsgrnaglipgglrldaall.........
00533211   1/1  mekydvviiGaGpaGlaaAlrlaraGlkvlvlEkgprpgglsrlnggggaaldlpsklllrlldll....
00490031   1/1  lMlpeslleplpalsaseeydVvViGaGpaGlaaAlalaraGlkVlllEkgprlggtsclnggglppggl
00499901   1/1  kkdvvviGAGiaGlaaAlrLaeaGhkVtvlEardriGGrsrtnggllipglrldlgahlfpgsy......
00406021   1/1  MseyDvvvvGaGpaGlaaAlrlaraGlkvlllEkgdrlggtsllgggllnagdildklgllaallvrl..
00471411   1/1  mstkkdvaiiGaGpaGlsaAiyLaraGlddvtvlEkndrlgGrll..ggipg..................
00492221   1/2  MmktpvliklleslladtalrlpplpplsldeeyDVvvvGAGpaGlaaAyeLarapGlkVlvlEkgdrlG
00472702   2/2  ----------------------------------------------------------------------
00483642   2/2  ----------------------------------------------------------------------
00476821   1/1  lallslllllllglllalpdlamdkeyDvvvvGaGpaGltaAlrLae.GlkVlvlEaggrlggrgat...
00363002   2/2  ----------------------------------------------------------------------
00509602   2/2  ----------------------------------------------------------------------
00364591   1/2  mgrvcppcegaclllllagpvailllepaladelllgllplllpamskkkdvvvvGaGpaGlaaAlalar
00481992   2/2  ----------------------------------------------------------------------
00488652   2/2  ----------------------------------------------------------------------
00444131   1/1  MsdedyDviviGaGiaGlvaAarLakaGlkVlvlEkgdrlGGtaatlgldglkfdlggsvihgllypall
00465142   2/2  ----------------------------------------------------------------------
00501482   2/2  ----------------------------------------------------------------------
00467602   2/2  ----------------------------------------------------------------------
00465791   1/1  mkeyDvvIiGaGiaGlsaAlrLakaGlkVlvlEkgdrpGgrgasgrnaggia..................
00467501   1/2  kkkdvvvvGgGpaGltaAlrlarlgpdlevtliekgdrlggtpllpgvlggk..................
00509281   1/1  ----------------------------------------------------------------------
00380742   2/2  ----------------------------------------------------------------------
00486071   1/2  myDvviiGaGpaGlaaAlrLaraGlkVlvlEkdrlGGtclnvgcipskallyagllpdelelleelglpl
00384501   1/1  ----------------------------------------------------------------------
00406901   1/1  ----------------------------------------------------------------------
00375101   1/1  ----------------------------------------------------------------------
00419411   1/1  ----------------------------------------------------------------------
00480161   1/1  --tgkkVavvGaGpAGlaaAaqLaraldlseelghdvtvferlprpggllrygiapd.............
00461561   1/1  gkkvaviGaGpaGlaaAllLakalpghdvtvfEkgpvpggllrygiapd.....................
00376432   2/2  ----------------------------------------------------------------------
00418871   1/1  ----------------------------------------------------------------------
00488071   1/1  irvcilcelacllllllgpvlilllelaaalllpllllpatkkkdvaviGaGpaGlaaAlalaraGlkVt
00395041   1/1  ----------------------------------------------------------------------
00455331   1/1  ----------------------------------------------------------------------
00366551   1/1  ----------------------------------------------------------------------
00406041   1/1  ----------------------------------------------------------------------
00351301   1/1  ----------------------------------------------------------------------
00368901   1/1  ----------------------------------------------------------------------
00410231   1/1  ----------------------------------------------------------------------
00455192   2/2  ----------------------------------------------------------------------
00471332   2/2  ----------------------------------------------------------------------
00382852   2/2  ----------------------------------------------------------------------
00380761   1/1  ----------------------------------------------------------------------
00440982   2/2  ----------------------------------------------------------------------
00406882   2/2  ----------------------------------------------------------------------
00481991   1/2  --klllatgslplipplegllldgvlllrtlldalallemlkkeydvvviGgGpaGlaaAaylarlGlkv
00457982   2/2  ----------------------------------------------------------------------
00455201   1/1  ----------------------------------------------------------------------
00464162   2/2  ----------------------------------------------------------------------
00455182   2/2  ----------------------------------------------------------------------
00485842   2/2  ----------------------------------------------------------------------
00481082   2/2  ----------------------------------------------------------------------
00533222   2/2  ----------------------------------------------------------------------
00480452   2/2  ----------------------------------------------------------------------
00475652   2/2  ----------------------------------------------------------------------
00529631   1/2  mptkkdVaiIGAGpaGLaaAllLaraGhdldVtvfErrdrpGGlwrttgrigsgldlgpsll....rlle
00523131   1/2  msydVvvvGAGiaGlsaAlaLarrGlrvlllergdvlgga...scrnsggglakgllleelpalgg....
00488662   2/2  ----------------------------------------------------------------------
00480092   2/2  ----------------------------------------------------------------------
00406881   1/2  MsskeydvvviGgGpaGlaaAlrlaraGlkvlllekgdrlgglllagcipgkallaaalllrllellael
00384492   2/2  ----------------------------------------------------------------------
00419402   2/2  ----------------------------------------------------------------------
00469732   2/2  ----------------------------------------------------------------------
00366542   2/2  ----------------------------------------------------------------------
00469722   2/2  ----------------------------------------------------------------------
00413941   1/1  ----------------------------------------------------------------------
00529262   2/2  ----------------------------------------------------------------------
00374372   2/2  ----------------------------------------------------------------------
00380741   1/2  keydvvviGgGpaGlaaAlrlaraGlkvlllekgdlgggclnvgcipgkrllaaaelydelrelleelgi
00368892   2/2  ----------------------------------------------------------------------
00482002   2/2  ----------------------------------------------------------------------
00467612   2/2  ----------------------------------------------------------------------
00463442   2/2  ----------------------------------------------------------------------
00384491   1/2  -lpgvellltsddalaleelpkdvvviGgGpaGleaAlalarlglkvtvverdrlggtl...dcilskal
00464161   1/2  MleydvvviGgGpaGlaaAlrlaraGlkvlliekgdrlGGtllntgcipgkalllgalllellrellelg
00509612   2/2  ----------------------------------------------------------------------
00465141   1/2  eieydvvViGaGpaGlaaAlrlaraGlkVtviEkgprlggclnvgcipgkaldaaalllrllelleelgv
00487712   2/2  ----------------------------------------------------------------------
00479092   2/2  ----------------------------------------------------------------------
00529111   1/2  ---llsnlplgrllpfllptslwldtlplpllellisraileralpdldmdkeyDVvIvGAGpaGLsaAy
00483652   2/2  ----------------------------------------------------------------------
00368891   1/2  -ppipglellltsddalellelpkdvvviGgGpaGleaAlalarlglkvtliergdrlgglld.......
00503641   1/1  --epklPdipGledFkgelfhsarwphdlvdltgkrVaviGaGpaGlaaaaelakaglevtvfertprig
00455181   1/2  MseydvvviGgGpaGlaaAlrlaeaGlkvlvlEkgdrlgglsnrngipglrlllgalllrllelleelgi
00472701   1/2  ledllldllsmstkkdvvviGaGpaGleaAlalarlglkvtlierg.lGgtllnggpglskpll......
00488651   1/2  mlpkdvviiGgGpaGleaalalarlglklevtliergdrlggtllplgpgpllglldaeelaey......
00469721   1/2  -dlpgvellltsddalalkelpkdvvviGgGpaGleaAlalarlgakvtliergdrllg..lldpelska
00469731   1/2  --dipglellltsddalalkelpkdvvviGgGyiGleaAaalarlgaevtlvergdrll..pyldcelsk
00376431   1/2  eydvvvvGaGpaGlaaAlalaraglkvlllekgprlg.gllvglipsklll...................
00363012   2/2  ----------------------------------------------------------------------
00440981   1/2  MeskkydvvviGaGpaGlaaAlylaraglkvtllekgprlggllntgcgpsklllpgall..........
00471331   1/2  -tmkydvviiGaGpaGlaaAlrlaraGlkvlllEkgprlgyktllalGgllltvglipgkallgaallle
00482001   1/2  --llpipglevltsdgaldllelpkdvvviGgGpaGleaAlalarlglkvtlvergdrlggtl.......
00485841   1/2  -rPrvppipgldlvltsddlldleelpkdvvviGgGviGleaAlalarlgakvtvvergdrllgtld...
00480091   1/2  -ppipglegvltsrdlldllelpkdvvviGgGpaGleaAlalarlgaevtvvergdrlgglld.......
00533221   1/2  -ipgldlegvltsrdlldllelpkdvvviGgGpaGleaAlalarlgaevtvvergdrlgglld.......
00496792   2/2  ----------------------------------------------------------------------
00488661   1/2  -srprvlpipgldlegvlllrtlldsdallellalpkdvvviGgGpaGleaAaalarlgakvtlvergdr
00447052   2/2  ----------------------------------------------------------------------
00480451   1/2  -pgldlelvltsddlldleelpkdvvviGgGpaGleaAlalarlgakvtlverrdrlgglld........
00455191   1/2  -ppipgvellltsddalalkelpkdvvviGgGpaGleaAlalarlgakvtlierrdrllgtl........
00363001   1/2  mekydvvviGaGlaGlsaAlelaragldvtvlergprlggcllllsvp......................
00501481   1/2  lmeleydvvviGgGpaGlaaAlylaraglkvtliekgplllyalgglllyvgcilskall..........
00467601   1/2  MkeyDvvviGaGpaGlaaAlrlarlgldkvlviekgpllggqtllllggtclnvgcipskllllaallpe
00424461   1/2  --vPrvlpipgidlggvlhaldfldpkalkgkkVaviGaGpaGlaaAlyLarlGaevtvierrprlggtl
00366541   1/2  -vlpipgldgegvltsrdlldllelpkdvvviGgGpaGleaAaalarlgakvtvvergdrlggtld....
00509611   1/2  --lPrllpipglegvlllrtlldsdlllellelpkdvvviGgGpaGleaAlalarlglkVtliergdrlg
00483641   1/2  -ydvviiGgGpaGltaaiylarlgpdlkvtliek...ggtclyvgcllskalg.................
00509601   1/2  -kdvvviGgGpaGleaAlalar.glkvtliergdrlggtrpllsgvipgkll..................
00467611   1/2  -gvlllltsddalalkelpkdvvviGgGyiGleaAlalarllpegakvtlvergdrll.pcld.......
00475651   1/2  -pipgldlegvltsrdlldllelpkdvvviGgGpaGleaAlalarlgakvtvvereprlggtld......
00529261   1/2  lniksielflsiieraldeglvppsmemmmekydvvIiGaGpaGlaaAlrLlqlAaraGpdlkVtvlEkg
00468342   2/2  ----------------------------------------------------------------------
00364592   2/2  ----------------------------------------------------------------------
00424462   2/2  ----------------------------------------------------------------------
00479091   1/2  --mmsylplfldlkgkrVliiGgGpaGltaAlelakaGakvtlverdpr.....................
00472712   2/2  ----------------------------------------------------------------------
00468341   1/2  smasesdydvvIiGaGpaGlsaAlrLaralgklpGlkVtvlEkgprpggrsrggglypgglellrelgle
00483651   1/2  --ipgldlpgvlllltsddalallellllakpkdvvviGgGpaGleaAlalarlGakVtviergdrlggr
00447051   1/2  -arprllpipgedlflgkgvltsatilgalllfkgkdvvviGgGpaGleaAlylarlgakvtlierrdrl
00477122   2/2  ----------------------------------------------------------------------
00496791   1/2  --PgipgleeflgkgvhtsatldglefrgkdvvviGgGpaGleaAlylarlglkvtlierrdrlggd...
00457951   1/2  -yDVvIiGaGpaGlsaAlrLaraGldlgselkVtvlEkgdrlGGtsglnaglipp...............
00460572   2/2  ----------------------------------------------------------------------
00384681   1/2  --dVaViGaGpaGldaAlylarlgakkvtlverrdrlg................................
00460571   1/2  pmmskkkdvvViGaGiaGlsaAlaLaraGysVtvlErgdrpggtsgtnggllaaglvapllllpggipll
00472711   1/2  --PrlpdipglelflgkgvhtsatldgllfkgkdvvviGgGpaGleaAlalarlglkvtllerrprlggt
00363011   1/2  --ppipgldlegvftlrtlddalalreallagkrvvvvGgGlaGleaAaalrrlglevtlvergdrlllp
00477121   1/2  ektdVaIvGAGpaGlaaAlaLaraGldvtvlErrdrpggtalgrggalsprglelleelglldallargv
00487711   1/2  kydvviiGaGiaGlsaAleLarrGlkdVtvlErgplpggggasgrnagllhaglaylelarlaresldll
00406191   1/2  --prvlpipGedlcgvlslrdfvgdynlhpaawllppdltgkrVvviGaGpaGldaArellkdldlllkt
00486072   2/2  ----------------------------------------------------------------------
00406192   2/2  ----------------------------------------------------------------------
00384682   2/2  ----------------------------------------------------------------------
00419401   1/2  --lPdipglelvltsddalelkepkkvvviGgGyiGleaAsalrrlgaevtliergdrllpll.......
00457952   2/2  ----------------------------------------------------------------------
00481081   1/2  aalliliaslglellpadylvlaigssdgaldlpklpkrvvvvGgGyiGlelAaalarllpelgaeVtlv
00382851   1/2  --rvvviGgGliGlelAaalrellpklglevtlveagdrllpryldpelsklll................
00445591   1/2  pkkvaviGaGgvGlalAlllaaagggdVtlvDid....................................
00360161   1/2  --prklgiPGedlpgvfsardfvawynglpdaallepdltgkrVvviGgGpaGldaArlllksldellkt
00457981   1/2  --rlvviGgGyiGlelAsalrrlgpdaaevtlvergdrl...............................
00423421   1/2  --ldllplfldlrgkdvlviGgGdvGlaaarllleagakvtvverrllprlaalaee.lgvevvlgdfle
00472761   1/2  ysrplllgligllgakvlpgkkvaviGaGgvGlalAlalaaagaagevtlvDideekleglardlldile
00479921   1/2  pkkvaviGaGavGlalAlalaraGaageVvlvdrd...................................
00454811   1/2  --rVvViGaGlsGlaaarlllrlGaevtvldrrdrpggl...............................
00529641   1/2  --rVvViGaGaSgldialelakvaksvtllersdelggpw..............................
00463441   1/2  --rVlVvdgGgGpaGleaAealarrGheVtlvealdrlggll............................
00374371   1/2  --agrlavleaalllervltglgalagllpgkrvlViGaGgiGleaAaalarlGakVtvvd.........
00463571   1/2  -mKiaviGaGyvGlelAavla.lgheVtlvdinpeklealnegllpilelgldelveell..gnltattd
00472781   1/2  -ldifvkrlikelivvklpgkkvvviGaGpvGlalAlalallgavgkVvlvdide...............
00533831   1/2  --lellgvallevlgkrilkgkkvaviGaGgvGlalAllllelgvaaeVtlvDiddelleglalelgdii
00531721   1/2  -rrsrlllliglegqeklkgakVaviGaGgvGlalAllLalagvagevvlvDidevklsnlardllhila
00504432   2/2  ----------------------------------------------------------------------
00482271   1/2  m.kiaviGaGyvGlplAallaeaGheVvgvDideekvealndgilpilepgleellrdlldagrltattd
00355351   1/2  GkkvaviGlGsmGlalAallaaaGheVlvwdrd-------------------------------------
00425341   1/2  lsmvlkgkkvaviGaGliGlalalllallglge-------------------------------------
00480271   1/2  -mhviiiGlGrvGrlvarlLlelgidvvvidldpervellaellgvlvvvgdatdpevLeeagi......
00473461   1/2  -klkmhviiiGagrvGrslarlLleegidvvvidrdperveelaeelellgvlvivgdatdpevLeeagi
00504431   1/2  lmeikkvaviGaGlmGlgiAavlaraGleVvlv-------------------------------------
00481021   1/2  lllmlkmmkiaviGaGavGtalAallaengheV-------------------------------------
00529642   2/2  ----------------------------------------------------------------------
00463572   2/2  ----------------------------------------------------------------------
00360162   2/2  ----------------------------------------------------------------------
00475101   1/2  -sepiadtvlvlilnllrdllgarqrlsagllrl------------------------------------
00372751   1/2  --tllgtpllpgatkvlilGgGqlGrmlalaaarlGievialdpyadapaaqvad---------------
00528371   1/2  mkkvgiiGlGlmGlslalalaraGfadeVvgyd-------------------------------------
00423401   1/2  -aGylavllaalllcrflgglgllltlagglag-------------------------------------
00423661   1/2  --lplelgalvltlatavralllagvlpgakVl-------------------------------------
00466731   1/2  mlkikkvaViGaGlmGsgiAavlaaaGikVvlv-------------------------------------
00445592   2/2  ----------------------------------------------------------------------
00452431   1/2  -tisvaelalalllalarnlpgaapllragiwra------------------------------------
00480351   1/2  --gllldtallvllllllllldlkgkvalVtGa-------------------------------------
00367851   1/2  kgkkvlviGaGgiGralaraLaeaGaevtvadr-------------------------------------
00479922   2/2  ----------------------------------------------------------------------
00367461   1/2  --lellsvalhallraglvpGktVlviGaGgiG-------------------------------------
00383791   1/1  --pkdvdlrvllllpeigltalealkrallelkpgsrVlviGaGgvGsaaaqllaaaGvgkvilvDrd..
00406511   1/2  -mhviiiGlGrvGlalarlLlelgidvvvidideerveelrelgvlvvvgdatdedvLeeagied.....
00432761   1/2  --lplelaaalglalltavlavlaagvkpgktv-------------------------------------
00486871   1/2  llllllkikkvafiGlGgmGmsalAllllkaGy-------------------------------------
00452432   2/2  ----------------------------------------------------------------------
00372752   2/2  ----------------------------------------------------------------------
00529632   2/2  ----------------------------------------------------------------------
00421801   1/2  -DgigavsllkrllvdlpgkkvlvlGaGgiGra-------------------------------------
00484141   1/2  --tvliiGaGgvGlaiaqalaalGakkVvlvdrd....................................
00454812   2/2  ----------------------------------------------------------------------
00502691   1/2  -kkvgiiGlGlmGlalarnlaaaGyeVvvydrs-------------------------------------
00366641   1/2  -ntesvaelalalllalarrlpeaaagvrtgkwlllggllgrelagktvgviGlGniGlavarrlaalGa
00523132   2/2  ----------------------------------------------------------------------
00435071   1/2  rmKiaviGaGsvgtalalllalkgldelpvgev-------------------------------------
00423402   2/2  ----------------------------------------------------------------------
00425342   2/2  ----------------------------------------------------------------------
00472782   2/2  ----------------------------------------------------------------------
00466732   2/2  ----------------------------------------------------------------------
00423422   2/2  ----------------------------------------------------------------------
00533832   2/2  ----------------------------------------------------------------------
00355352   2/2  ----------------------------------------------------------------------
00367462   2/2  ----------------------------------------------------------------------
00472762   2/2  ----------------------------------------------------------------------
00481022   2/2  ----------------------------------------------------------------------
00482272   2/2  ----------------------------------------------------------------------
00366642   2/2  ----------------------------------------------------------------------
00486872   2/2  ----------------------------------------------------------------------
00423662   2/2  ----------------------------------------------------------------------
00367852   2/2  ----------------------------------------------------------------------
00475102   2/2  ----------------------------------------------------------------------
00470682   2/2  ----------------------------------------------------------------------
00529112   2/2  ----------------------------------------------------------------------
00467502   2/2  ----------------------------------------------------------------------
00432762   2/2  ----------------------------------------------------------------------
00502692   2/2  ----------------------------------------------------------------------
00473462   2/2  ----------------------------------------------------------------------
00435072   2/2  ----------------------------------------------------------------------
00528372   2/2  ----------------------------------------------------------------------
00492222   2/2  ----------------------------------------------------------------------
00406512   2/2  ----------------------------------------------------------------------
00484142   2/2  ----------------------------------------------------------------------
00480352   2/2  ----------------------------------------------------------------------
00531722   2/2  ----------------------------------------------------------------------
00421802   2/2  ----------------------------------------------------------------------
00480272   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           GNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAVGDERIRADVVLI
00374411   1/1  taripglgasldlggilfpgl.....sprllellaelgleaelarllglrvlilldgtvvsldgdld...
00462741   1/1  lrelgielgpkvpeildyllklldkfdllklleflskvngveyiegrasfldagkwevltedgwgifeee
00491501   1/1  rtaglippgflldlgahvfpg..laplllelleelgle.......lelltlagaavlalldgklidlpad
00435771   1/1  ........pyllelleelglelairlntevggavllpdgglltvprdladllaellaladgllleadavi
00470291   1/1  skpdlgaalfgelldelyelgle............ldgrrllfprgkvlGGsssinggvylrgskndfdl
00360921   1/1  llaglg.....dlaellalkpelvalledgaailllprgvrllaglglggssainagvylrvspadfdel
00400491   1/1  .........................................dllerlvvdllkggailvdedlvelldge
00470221   1/1  lelleelglelallaldg....ellayldglvlelgi..dlntl...........vvaldpdalevlled
00400351   1/1  .......................pelleelgteaaellaergvrvlrgkg........lgggstinadav
00503631   1/1  lf......glpppggggvdraelldylleaaerlgvedvirlgtevtsidfdedgvv..vgvttedGeti
00461281   1/1  dlgltllpglfdtll...........agldgrdllarrgkvlggsslingmvylrglpedldelakllgv
00413411   1/1  .....dlleelgldl......................................................v
00485831   1/1  allgillllllld.......lllllrrllllllllaagvegllillgvevvvgvadgggvtvvtgdgeti
00484941   1/1  ..................................pellpyllellkelglelrl..pdlggrvvvlpdgk
00359891   1/1  .........................................dllerlgedlliglallvdgdlvvvltge
00457971   1/1  ............lrvgfiplkrlaelleallelaeklgveillgtevtdidlddd....vvvvltdgeti
00396641   1/1  iaaglrll.............................................ienylgldlaellvedl
00509271   1/1  .................................allelleklgveillgtevtsidldggtvvgvttgdg
00526001   1/1  gvelllntvvgalltlaellae..ydavvlalglglatglagrglavprg..rvlggssvingavylrad
00475641   1/1  lfglllllllllldlvllgaakralgae.....llrllaelaeklgveillgtavtellkddggvvvtgd
00406601   1/1  ll..........rllrelg......ledlellplglagvirgggsvvnalpdeaeallaelgvlfpigya
00520321   1/1  .........................................rdlleelgvelllggaglvdprgvellge
00464461   1/1  .................ldlgarlleglglldlleelleelgielr........................
00458701   1/1  ................................elleylldlleelgleddlrlntevggarlllpdgkll
00473271   1/1  ldllkelgledkldlrrlvllrg........................kvlggpsdlngllavr.....gd
00462701   1/1  dgglrlleglgll.......................................drleelleelgield...
00470681   1/2  llelaglgll................llvaagdldaeelvlalaelleelgvevllgtrvtgidpdgvtv
00458811   1/1  pgllellaelglplglelldlleelleelgidfllgkgvg.......glsaingvvlergsaedydalip
00483561   1/1  ...........................................................lvrlaleslda
00533211   1/1  ......................................................................
00490031   1/1  .........................................rylaglglldlleelaeelgidld..flr
00499901   1/1  .......................ellldlleelgvel..rlntrvv..vdrdgklvtvpl.dldglelea
00406021   1/1  ......................................................................
00471411   1/1  ..........................falpaelldalaelaeklgveirlgtev..dgvtvttedgetie
00492221   1/2  Gtsrnggvipdgglld....pelldlleelGlpf..dlllpgggvvdpaellralaealaeelgve..ir
00472702   2/2  ----------------------------------------------------------------------
00483642   2/2  ----------------------------------------------------------------------
00476821   1/1  psgggflvdtgadwlfgtep.......................................elglegrgill
00363002   2/2  ----------------------------------------------------------------------
00509602   2/2  ----------------------------------------------------------------------
00364591   1/2  aGlkvtllekgdrlggrlllvggipg............................................
00481992   2/2  ----------------------------------------------------------------------
00488652   2/2  ----------------------------------------------------------------------
00444131   1/1  rllrklgldlgpkilhalgelvdll.lrtdvsdylefrlldgrvvfpdgkvlkvptnlaellksfllgls
00465142   2/2  ----------------------------------------------------------------------
00501482   2/2  ----------------------------------------------------------------------
00467602   2/2  ----------------------------------------------------------------------
00465791   1/1  ......................................................................
00467501   1/2  ...........................llaelllrllelllklgvevllgevtsidpdgktvtledgetl
00509281   1/1  ----------------------------------------------------------------------
00380742   2/2  ----------------------------------------------------------------------
00486071   1/2  .lpgldipvlpgrkgg.......greellrylaealeklgveirlgtalfvdpnrVtsvtvttedGetge
00384501   1/1  ----------------------------------------------------------------------
00406901   1/1  ----------------------------------------------------------------------
00375101   1/1  ----------------------------------------------------------------------
00419411   1/1  ----------------------------------------------------------------------
00480161   1/1  ...............................frlpkevvdrlvdlledlgvefvlnvevgvd...vtlde
00461561   1/1  .......................frlpkelldrlielleelgveirlntev...gkdvtledllleydav
00376432   2/2  ----------------------------------------------------------------------
00418871   1/1  ----------------------------------------------------------------------
00488071   1/1  llEardrlggrlllsggipgk............................................vdpae
00395041   1/1  ----------------------------------------------------------------------
00455331   1/1  ----------------------------------------------------------------------
00366551   1/1  ----------------------------------------------------------------------
00406041   1/1  ----------------------------------------------------------------------
00351301   1/1  ----------------------------------------------------------------------
00368901   1/1  ----------------------------------------------------------------------
00410231   1/1  ----------------------------------------------------------------------
00455192   2/2  ----------------------------------------------------------------------
00471332   2/2  ----------------------------------------------------------------------
00382852   2/2  ----------------------------------------------------------------------
00380761   1/1  ----------------------------------------------------------------------
00440982   2/2  ----------------------------------------------------------------------
00406882   2/2  ----------------------------------------------------------------------
00481991   1/2  lliekgprlggtclnvgcipskallkaaelaeliellpglgvelllg.....glgldlaellerkdavvd
00457982   2/2  ----------------------------------------------------------------------
00455201   1/1  ----------------------------------------------------------------------
00464162   2/2  ----------------------------------------------------------------------
00455182   2/2  ----------------------------------------------------------------------
00485842   2/2  ----------------------------------------------------------------------
00481082   2/2  ----------------------------------------------------------------------
00533222   2/2  ----------------------------------------------------------------------
00480452   2/2  ----------------------------------------------------------------------
00475652   2/2  ----------------------------------------------------------------------
00529631   1/2  elgl.......ldelleeglsplypglrldvpkelygfpdfplpgwfpvfpgrkelldyladlaeklgve
00523131   1/2  .......................vdrarlaaalaeaaealgveirlgtevtdllleggrvtgVrtadGet
00488662   2/2  ----------------------------------------------------------------------
00480092   2/2  ----------------------------------------------------------------------
00406881   1/2  giellllp....ypgvdlslvplllrvlgaelaaalaealeelgveillgtavvedggrvtldgetiead
00384492   2/2  ----------------------------------------------------------------------
00419402   2/2  ----------------------------------------------------------------------
00469732   2/2  ----------------------------------------------------------------------
00366542   2/2  ----------------------------------------------------------------------
00469722   2/2  ----------------------------------------------------------------------
00413941   1/1  ----------------------------------------------------------------------
00529262   2/2  ----------------------------------------------------------------------
00374372   2/2  ----------------------------------------------------------------------
00380741   1/2  pfd.......evllglllllgrggadgaelaaalaelleelgvevllgtavtiddgrVtldgetitadav
00368892   2/2  ----------------------------------------------------------------------
00482002   2/2  ----------------------------------------------------------------------
00467612   2/2  ----------------------------------------------------------------------
00463442   2/2  -------------------------------------------------------------------vvi
00384491   1/2  l.........................................elleelgvevllgtevteveldgggvvv
00464161   1/2  glflllpd......ldlelllelldalveelaaalaealeelgveillgtevt.iedgrvgvtledgeel
00509612   2/2  ----------------------------------------------------------------------
00465141   1/2  elr.......lppldglllpgvgdvlgaelaaalaealeelgveillgtrvteidggvvgvttedgetie
00487712   2/2  ----------------------------------------------------------------------
00479092   2/2  ----------------------------------------------------------------------
00529111   1/2  yLakarPglkVlvlEkgdrpGGasgrnggilpsglltde....llelleelgipf..dpegpgggtvdga
00483652   2/2  ----------------------------------------------------------------------
00368891   1/2  ...............................................pelaaallelleklgvevllgte
00503641   1/1  glwrgipypp....................................lgkelldyleeyarklglrirfgt
00455181   1/2  pfdlpglgglflprggrvdgaelaaalaeaaeelgveillgtrvt.i..dggvvgvtt...dgetirada
00472701   1/2  .................................lrvlgpelaeylrelleklgveillgtrvtsidrdgd
00488651   1/2  ....................................lrelleklgvevllgtevtsidgdgkgvtledge
00469721   1/2  ll....................................................elleklgvelllgtev
00469731   1/2  all....................................................elleklgvdlllgtk
00376431   1/2  .........lrvlgaelaaalaealeel..gvevllgtevtsidrdgggvtgvllvttgdgetiradavv
00363012   2/2  ----------------------------------------------------------------------
00440981   1/2  ............................gaelveallelleelgveillgtevtsidldgggvvltdget
00471331   1/2  laelleelgvevtll......ellggdrvlprldldgpellkallealeklgv.illgtveilgddggvg
00482001   1/2  ................................................dpelsklllelleklgvevllg
00485841   1/2  ....................................................pelsklllelleklgvdl
00480091   1/2  ...............................................eelsllllelleklgvelllgtr
00533221   1/2  ...............................................eelslallelleklgvelllgtr
00496792   2/2  ----------------------------------------------------------------------
00488661   1/2  lggtlld.....................................................eelaaallel
00447052   2/2  ----------------------------------------------------------------------
00480451   1/2  ..............................................pelaaallelleklgvelllgtrv
00455191   1/2  ...............................................dpelskallelleklgvevllgt
00363001   1/2  .....................ggrldpeelvlalaelleelgvevrlgtevtsidrdgdgvtledgetle
00501481   1/2  .................llgilgeellarlreqleklgveillgtrvtsidl...dggtv....vltdge
00467601   1/2  llelleglgvefdle.....ekgvdldglrlaydklvdaelaaalaelleklgvevllgt.vteiegddg
00424461   1/2  lalgripakllglealllrllllllglglll.................pipgrvlpkellealaealekl
00366541   1/2  ...................................................pelskallelleklgvevl
00509611   1/2  g...ld....................................................pelskallelle
00483641   1/2  .....................llglldeelalrllelleklgvelllgtevtsidlegktvtllllvlgd
00509601   1/2  ..........................deelaeylrelleklgvevllgtevtsidgdgkgvtlddgelea
00467611   1/2  ..............................................pelsklllelleklgvdvllgtev
00475651   1/2  .................................................pelskallelleklgvelllg
00529261   1/2  drlGGtsrtnggliprgl.........eelldelgipgalldagfpydgllfvfgggfigledargllrl
00468342   2/2  ----------------------------------------------------------------------
00364592   2/2  ----------------------------------------------------------------------
00424462   2/2  ----------------------------------------------------------------------
00479091   1/2  .................pelallllelleklgvevllgtrvteiakeylpelllgveveagdgvvtvv..
00472712   2/2  ----------------------------------------------------------------------
00468341   1/2  deleelgvdflkalvvlldldlvlalrllgpdvtggerrpragvvdraellralleaaeelGngrve..i
00483651   1/2  ll......................................................deelalallellek
00447051   1/2  ggtl............................................................dlllel
00477122   2/2  ----------------------------------------------------------------------
00496791   1/2  .....................................................pelleyllelleklgve
00457951   1/2  ....glggplddrglalaeetlellrelgaelglldglvrpngalvlaigledadelarlgkrvavlggg
00460572   2/2  ----------------------------------------------------------------------
00384681   1/2  .................fpafpelvellkeegveillgtavleilgddgkvtgvrvvrveldesgrvvvv
00460571   1/2  alalealdllrelglelgidf...rvgalvlatglaela...dalllalgapprlldapelrellpvvvp
00472711   1/2  l...........................................................dlllellekl
00363011   1/2  ylrpelskall.....................................................elleel
00477121   1/2  pldglvvvdgg..grlaldfaelalgapgyvvdraellralleaaeelgve..irlgtrvtsileedgdg
00487711   1/2  relveelgidfrrygklvlatgeaelellr..........elaealralgvd.....velldaaelrale
00406191   1/2  disdnaleallarlgaevtvvgRrgpliaaftlkelerlpelggllry..gipedkllkeflareiad..
00486072   2/2  ----------------------------------------------------------------------
00406192   2/2  ----------------------------------------------------------------------
00384682   2/2  ----------------------------------------------------------------------
00419401   1/2  .........................deelsllleelleelgidvllgtevteiekdgdgvlv........
00457952   2/2  ----------------------------------------------------------------------
00481081   1/2  ergdrl..................................lpglldeelaell.................
00382851   1/2  .....................................elleelgvelllgtkvtsiegdgdgvvvtledg
00445591   1/2  ..............................pekleglaadlldilelllverlitttdleealadaDvvi
00360161   1/2  dindlalealkrlggkeVtvveRrgpleap............ftlkelrelggllrygippdpldlalle
00457981   1/2  ............lpyldpelsklllelleklgvevllgtkvtsidrgedgvvv....vtledgetleadl
00423421   1/2  edlgdadlviaa----------------------------------------------------------
00472761   1/2  llgvglvvttdleealkgaDvviiatgvprkpg-------------------------------------
00479921   1/2  ............................eerlealaadledllellgvdlrattdleealk....daDlv
00454811   1/2  ..................................lllelgvefvlgs.........lllellleadlvvl
00529641   1/2  ....................................lgvvillnteveevtgdgvvledgtelleaDavi
00463441   1/2  ..........................rlgipdpllerleelgveillgvavteilgdgvelg--------
00374371   1/2  .........................................................rrpellerleelg
00463571   1/2  leealkdaDlviiavgtplk.dgdgrpdldivnavaeeiakllgpdtivvsstvpvgtteylatpllgid
00472781   1/2  ................................ekleglalelidillpklvdv..vvttelkevlkg...
00533831   1/2  sllgk.................................................................
00531721   1/2  dlgvpkvvva............................................................
00504432   2/2  ----------------------------------------------------------------------
00482271   1/2  laealadadvviiavg.tpldadg.gadlsyvlaaaralakvlkklgvgaivviestvpvgtteellapl
00355351   1/2  ----------------------------------------------------------------------
00425341   1/2  ----------------------------------------------------------------------
00480271   1/2  edadavvaatgddeanllivllakelgpk.riiarardpehaellrklgadvvispe-------------
00473461   1/2  ee......adavialtdddeanlliallakelnpdlriiarardpeylelleklgadevispellaalll
00504431   1/2  ----------------------------------------------------------------------
00481021   1/2  ----------------------------------------------------------------------
00529642   2/2  ----------------------------------------------------------------------
00463572   2/2  ----------------------------------------------------------------------
00360162   2/2  ----------------------------------------------------------------------
00475101   1/2  ----------------------------------------------------------------------
00372751   1/2  ----------------------------------------------------------------------
00528371   1/2  ----------------------------------------------------------------------
00423401   1/2  ----------------------------------------------------------------------
00423661   1/2  ----------------------------------------------------------------------
00466731   1/2  ----------------------------------------------------------------------
00445592   2/2  ----------------------------------------------------------------------
00452431   1/2  ----------------------------------------------------------------------
00480351   1/2  ----------------------------------------------------------------------
00367851   1/2  ----------------------------------------------------------------------
00479922   2/2  ----------------------------------------------------------------------
00367461   1/2  ----------------------------------------------------------------------
00383791   1/1  .....................eealerarrlgpdvvvdpie.dlaeallellgg................
00406511   1/2  .adavvvatgddeenllivllarklnpvlkiiarardpehaellrklgadlvispe--------------
00432761   1/2  ----------------------------------------------------------------------
00486871   1/2  ----------------------------------------------------------------------
00452432   2/2  -----------------------------------------------------------tisvaelalal
00372752   2/2  ----------------------------------------------------------------------
00529632   2/2  ----------------------------------------------------------------------
00421801   1/2  ----------------------------------------------------------------------
00484141   1/2  ..............eekaqalveqlkelgskikvkavsldvgdveele..................ellg
00454812   2/2  ----------------------------------------------------------------------
00502691   1/2  ----------------------------------------------------------------------
00366641   1/2  kVivydrspraleelgadvvsleellae..........................................
00523132   2/2  ----------------------------------------------------------------------
00435071   1/2  ----------------------------------------------------------------------
00423402   2/2  ----------------------------------------------------------------------
00425342   2/2  ----------------------------------------------------------------------
00472782   2/2  ----------------------------------------------------------------------
00466732   2/2  ----------------------------------------------------------------------
00423422   2/2  ----------------------------------------------------------------------
00533832   2/2  ----------------------------------------------------------------------
00355352   2/2  ----------------------------------------------------------------------
00367462   2/2  ----------------------------------------------------------------------
00472762   2/2  ----------------------------------------------------------------------
00481022   2/2  ----------------------------------------------------------------------
00482272   2/2  ----------------------------------------------------------------------
00366642   2/2  ----------------------------------------------------------------------
00486872   2/2  ----------------------------------------------------------------------
00423662   2/2  ----------------------------------------------------------------------
00367852   2/2  ----------------------------------------------------------------------
00475102   2/2  -----------------------------------------------------------sepiadtvlvl
00470682   2/2  ----------------------------------------------------------------------
00529112   2/2  ----------------------------------------------------------------------
00467502   2/2  ----------------------------------------------------------------------
00432762   2/2  ----------------------------------------------------------------------
00502692   2/2  ----------------------------------------------------------------------
00473462   2/2  ----------------------------------------------------------------------
00435072   2/2  ----------------------------------------------------------------------
00528372   2/2  ----------------------------------------------------------------------
00492222   2/2  ----------------------------------------------------------------------
00406512   2/2  ----------------------------------------------------------------------
00484142   2/2  ----------------------------------------------------------------------
00480352   2/2  ----------------------------------------------------------------------
00531722   2/2  ----------------------------------------------------------------------
00421802   2/2  ----------------------------------------------------------------------
00480272   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ATGAHPRELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPT
00374411   1/1  .......................fevlladgeeleadalilatGarprllpipgfdgkgvltardlldll
00462741   1/1  ltadaviiatGarpripdlipgl.gggvltsddyldledlpgklvdfvllalalaiaviGggasglelas
00491501   1/1  varlla..............arlvrlldgleleadalilatGarprlllpipgldlfgvlgrvllssdll
00435771   1/1  lAtGarprlppipgldlkgvltsrdlldl..lgkrvvviGgGasgldiaealarlgaevtvverrprlla
00470291   1/1  waglaglegwsydellpyfkkaekliiatgsrpllpdlpgglllggdgiltselalsldllpklvvvigg
00360921   1/1  ...gawgvtlddlepyfelaadalvlatGsrprlpplpgl.elggvlltaaealgldflgkrvvviggga
00400491   1/1  aleadalllatGarpr.lgipg........sdlpgvllalgkrvvvvgggviglelaaal..........
00470221   1/1  leelradavvlAtGsrprlppipgedlggvlhsallldll..gkrvvvigggasgldlaellarlgaevt
00400351   1/1  vlatgadprllgipgldydfllpgvhsaedalgldllgkrvvviGggysgvelaealarlgapvtlldrs
00503631   1/1  eadavvlAtGalsrprlppsipgldltfkggvtlsavws.dgalallgllvdllpkrvvviGgG.sglel
00461281   1/1  egw.gydellpyfkvaedglgltadaiiiatgsrprypg...ipg..plsvswaldldelpkrlvviggg
00413411   1/1  kggdgltleagalvlatgarpripplpglgvpgvltsdgalalrepgkrvvviggglsglel........
00485831   1/1  radavilAtGarsrvppipgldlpgvltsrtaldllflgkrvvviGgGyiglelAlalarlgakvtlver
00484941   1/1  vlgyd.................lglgalpdspealgleefpgrvvvigggyiglelagkrvrvgg..akv
00359891   1/1  gleadalllatGapprlldipgldelggllsldal.....ggrvvvigggviglela.............
00457971   1/1  tltadavvlAtGsrprllpipgldlegvltsptsildalalllellpgklvviggGai............
00396641   1/1  vkggaglvdedlve...........ilatgappavleleglgvpflrtsdgaldlk..gglvavigggsi
00509271   1/1  etltad..vlAtGarprllllllvpgipgfdgkgvhtartlldldllgkrvvviGggaiglelal.....
00526001   1/1  aidfatgar..gipgwdldgvlpyfdrledslgvlglpflgkrvvviGggpigvefaealarlgakvtlv
00475641   1/1  getiradavilAtGarsrvppipgldgpgvltsdtalellllpkrvvviGggyiglelalalarlgakvt
00406601   1/1  ellpfyerleklygvlgegylpdlpgasifkglpvhssfddreldldgkrvvvigsgasavrakavviat
00520321   1/1  lgleadalllatG.rpfdlpipglelfgvrglltlldalkleplllssdlaggllypgkrvvvigggail
00464461   1/1  .llrdgklvvaltgegleadavllatGarprllpipgld..............llggrvvvigggvigle
00458701   1/1  vltsdlnalllelradalilatgalprlppipgldlgevlhsagyeellrrlgldllgkrvvvigggasa
00473271   1/1  edlleakalllatgpylpllpgl....sleevldsllgldllpklvlvigggviglelaellarlgaevt
00462701   1/1  llvdgrlvvaladealeadalllatGarprllpipgld..............llgglvvvigggviglel
00470681   1/2  tladgetitadklvlAtGarprllpipgldlpgvlvlrtlddalalrellaallpkrvvvvGgGliGlel
00458811   1/1  atgaedflgglflpaegilgatgsepfllp..gvsllrvldsagalslafrgkrvvvrltyddnyfndey
00483561   1/1  lreliatgarplglpipgrdlgglllardaldldalpkrlavlgggllgvdelaellpllgsevtgglrs
00533211   1/1  ..............................................lelaellarlgaevlrlllglltl
00490031   1/1  dgllvlaldgegleadalllatGapprlldipgld..............llggrvvvigggvdglela..
00499901   1/1  davvlatGalsllprlpdipgldlfsleellsalglldllgkrvvvigggasgvdlaellarlgarvtll
00406021   1/1  ...adalvlatgarprrlgipglelp..............ggrvvvigggvia.................
00471411   1/1  adavvlAtGalrprllpipgldlpgvlgvhsllsavllgllllgkrvvvigggdigllaelalalarlga
00492221   1/2  lgtevtdilrdggrvtgvttedllvdkngvevtdgdggtiradavvlAtGarprllelpgldlpgvpdal
00472702   2/2  ------------------------------ledllldllsmstkkdvvviGaGpaGleaAlalarlglkv
00483642   2/2  --------------------------------ydvviiGgGpaGltaaiylarlgpdlkvtliekggtcl
00476821   1/1  prgkvlGGsslinggvlvrglpedfdalglgwsyeellpyfkkaekllgvlgalr..kllvvigggaigl
00363002   2/2  -----------------------------mekydvvviGaGlaGlsaAlelaragldvtvlergprlggc
00509602   2/2  --------------------------------kdvvviGgGpaGleaAlalar.glkvtliergdrlggt
00364591   1/2  gvlpeelvealaelleklgveirlgtrvt.dgvgvttedgetieadavilAtGarpntllllrggivvde
00481992   2/2  --------------klllatgslplipplegllldgvlllrtlldalallemlkkeydvvviGgGpaGla
00488652   2/2  ------------------------------mlpkdvviiGgGpaGleaalalarlglklevtliergdrl
00444131   1/1  ekrrllaflgviatgdrpralgipgldldd.lslfellerfllldllpklllilgggliglepaelsarl
00465142   2/2  -----------------------------eieydvvViGaGpaGlaaAlrlaraGlkVtviEkgprlggc
00501482   2/2  ---------------------------lmeleydvvviGgGpaGlaaAlylaraglkvtliekgplllya
00467602   2/2  ---------------------------------MkeyDvvviGaGpaGlaaAlrlarlgldkvlviekgp
00465791   1/1  ...............pglgyddrllalakeslellkelgaelgidlfrppgklvvagggdiglllelaea
00467501   1/2  eydllvlAtGarprllpipgldlegvltlrtlldalalrealldlllllkgkrvvvvGgGliGlelaaal
00509281   1/1  ----------------------------------------------------------------------
00380742   2/2  ------------------------------keydvvviGgGpaGlaaAlrlaraGlkvlllekgdlgggc
00486071   1/2  lvpgetiradavvlA-------------------------------------------------------
00384501   1/1  ----------------------------------------------------------------------
00406901   1/1  ----------------------------------------------------------------------
00375101   1/1  ----------------------------------------------------------------------
00419411   1/1  ----------------------------------------------------------------------
00480161   1/1  llleydavvlAtGatkprllgipgldldgvysaldflfgynllldglyllgllargkrvvviGggntald
00461561   1/1  vlAtGalsprllgipgedlpgvvlaldflllgnllpgkrvvviGgalrlldgvigntaldvartlarlga
00376432   2/2  -------------------------------eydvvvvGaGpaGlaaAlalaraglkvlllekgprlggl
00418871   1/1  ----------------------------------------------------------------------
00488071   1/1  llealaelaeelgveirlgtrv..D......dgetiradavvlAtGarprllplpgld.....-------
00395041   1/1  ----------------------------------------------------------------------
00455331   1/1  ----------------------------------------------------------------------
00366551   1/1  ----------------------------------------------------------------------
00406041   1/1  ----------------------------------------------------------------------
00351301   1/1  ----------------------------------------------------------------------
00368901   1/1  ----------------------------------------------------------------------
00410231   1/1  ----------------------------------------------------------------------
00455192   2/2  ----------ppipgvellltsddalalkelpkdvvviGgGpaGleaAlalarlgakvtlierrdrllgt
00471332   2/2  ------------------------------tmkydvviiGaGpaGlaaAlrlaraGlkvlllEkgprlgy
00382852   2/2  ---srPrvlpipgldlegvlllrtledalellellelpkrvvviGgGliGlelAaalrellpklglevtl
00380761   1/1  ----------------------------------------------------------------------
00440982   2/2  ---------------------------MeskkydvvviGaGpaGlaaAlylaraglkvtllekgprlggl
00406882   2/2  ---------------------------MsskeydvvviGgGpaGlaaAlrlaraGlkvlllekgdrlggl
00481991   1/2  geelaaalae------------------------------------------------------------
00457982   2/2  ------------iPglelvltsddaldleelpkrlvviGgGyiGlelAsalrrlgpdaaevtlvergdrl
00455201   1/1  ----------------------------------------------------------------------
00464162   2/2  ---------------------------------MleydvvviGgGpaGlaaAlrlaraGlkvlliekgdr
00455182   2/2  ---------------------------------dvvviGgGpaGlaaAlrlaeaGlkvlvlEkgdrlggl
00485842   2/2  ----rPrvppipgld..lvltsddlldleelpkdvvviGgGviGleaAlalarlgakvtvvergdrllgt
00481082   2/2  -------aalliliaslglellpadylvlaigssdgaldlpklpkrvvvvGgGyiGlelAaalarllpel
00533222   2/2  ----------ipgldlegvltsrdlldllelpkdvvviGgGpaGleaAlalarlgaevtvvergdrlggl
00480452   2/2  -----------pgldlelvltsddlldleelpkdvvviGgGpaGleaAlalarlgakvtlverrdrlggl
00475652   2/2  ---------pipgldlegvltsrdlldllelpkdvvviGgGpaGleaAlalarlgakvtvvereprlggt
00529631   1/2  ..irlnteVtsverdgdg...vtvttedgepdgeeetleadaVvlAtGalsrprllgllpdipgldlfgg
00523131   1/2  lradavvlAtGafsrlllllglelpvgptlgyalvtdllellgkrvvvvgggktgtelaldlrsigasvt
00488662   2/2  ---srprvlpipgldlegvlllrtlldsdallellalpkdvvviGgGpaGleaAaalarlgakvtlverg
00480092   2/2  ----------ppipglegvltsrdlldllelpkdvvviGgGpaGleaAlalarlgaevtvvergdrlggl
00406881   1/2  lvvlAtGarsllll--------------------------------------------------------
00384492   2/2  ------------lpgvellltsddalaleelpkdvvviGgGpaGleaAlalarlglkvtvver.drlggt
00419402   2/2  --------lPdipgle.lvltsddalelke.pkkvvviGgGyiGleaAsalrrlgaevtliergdrllpl
00469732   2/2  -----------dipglellltsddalalkelpkdvvviGgGyiGleaAaalarlgaevtlvergdrllpy
00366542   2/2  -------vlpipgldgegvltsrdlldllelpkdvvviGgGpaGleaAaalarlgakvtvvergdrlggt
00469722   2/2  -----------dlpgvellltsddalalkelpkdvvviGgGpaGleaAlalarlgakvtliergdrllgl
00413941   1/1  ----------------------------------------------------------------------
00529262   2/2  -------------------------------lniksielflsiieraldeglvppsmemmmekydvvIiG
00374372   2/2  ---agrlavleaalllervltglgalagllpgkrvlViGaGgiGleaAaalarlGakVtvvdrrpeller
00380741   1/2  ilAtGarpr-------------------------------------------------------------
00368892   2/2  ----------ppipglellltsddalellelpkdvvviGgGpaGleaAlalarlglkvtliergdrlggl
00482002   2/2  ----------llpipglevltsdgaldllelpkdvvviGgGpaGleaAlalarlglkvtlvergdrlggt
00467612   2/2  --------------gvlllltsddalalkelpkdvvviGgGyiGleaAlalarllpegakvtlvergdrl
00463442   2/2  atgsapvvitqlpipgadlarvltleevllgkaktgkrVlVvdgGgGpaGleaAealarrGheVtlveal
00384491   1/2  vlg-------------------------------------------------------------------
00464161   1/2  tleadl----------------------------------------------------------------
00509612   2/2  ----lPrllpipglegvlllrtlldsdlllellelpkdvvviGgGpaGleaAlalarlglkVtliergdr
00465141   1/2  adavvl----------------------------------------------------------------
00487712   2/2  -------------------------------kydvviiGaGiaGlsaAleLarrGlkdVtvlErgplpgg
00479092   2/2  -------------------------------mmsylplfldlkgkrVliiGgGpaGltaAlelakaGakv
00529111   1/2  alvralaeaaleelgve..irlgteVtdilvdgggvlwtvrvtGVvvndtgvaldgllkllvdpllllk-
00483652   2/2  ----------ipgldlpgvlllltsddalallellllakpkdvvviGgGpaGleaAlalarlGakVtvie
00368891   1/2  v---------------------------------------------------------------------
00503641   1/1  evtsvdr........dgwtvtgeeltleadavvlatGasvprlpdipgldlfggllahsflrrkirelvk
00455181   1/2  vilAtGa---------------------------------------------------------------
00472701   1/2  tgrvtgvtledgetleadavvlAtGarsn.----------------------------------------
00488651   1/2  tleadlvvlatGarpntppipgldllgvld----------------------------------------
00469721   1/2  tai-------------------------------------------------------------------
00469731   1/2  vta-------------------------------------------------------------------
00376431   1/2  lAtGarpntplleglglelderggivv-------------------------------------------
00363012   2/2  --------ppipgldlegvftlrtlddalalreallagkrvvvvGgGlaGleaAaalrrlglevtlverg
00440981   1/2  ieadavvlAt------------------------------------------------------------
00471331   1/2  vtledGe---------------------------------------------------------------
00482001   1/2  tev-------------------------------------------------------------------
00485841   1/2  llgt------------------------------------------------------------------
00480091   1/2  vta-------------------------------------------------------------------
00533221   1/2  vta-------------------------------------------------------------------
00496792   2/2  -----PgipgleeflgkgvhtsatldglefrgkdvvviGgGpaGleaAlylarlglkvtlierrdrlg..
00488661   1/2  lek-------------------------------------------------------------------
00447052   2/2  ---arprllpipgedlflgkgvltsatilgalllfkgkdvvviGgGpaGleaAlylarlgakvtlierrd
00480451   1/2  tai-------------------------------------------------------------------
00455191   1/2  evteidg.--------------------------------------------------------------
00363001   1/2  adavvlAtGa------------------------------------------------------------
00501481   1/2  tieadav---------------------------------------------------------------
00467601   1/2  rvtgvvv---------------------------------------------------------------
00424461   1/2  gvei------------------------------------------------------------------
00366541   1/2  lg--------------------------------------------------------------------
00509611   1/2  klgv------------------------------------------------------------------
00483641   1/2  getley----------------------------------------------------------------
00509601   1/2  davvlatGsr------------------------------------------------------------
00467611   1/2  taid------------------------------------------------------------------
00475651   1/2  t---------------------------------------------------------------------
00529261   1/2  gagvtvv---------------------------------------------------------------
00468342   2/2  --------------------------------smasesdydvvIiGaGpaGlsaAlrLaralgklpGlkV
00364592   2/2  ----------------------------------------------------------------------
00424462   2/2  ----vPrvlpipgidlggvlhaldfldpkalkgkkVaviGaGpaGlaaAlyLarlGaevtvierrprlgg
00479091   1/2  .lgdgetieadlvilAtG----------------------------------------------------
00472712   2/2  -----PrlpdipglelflgkgvhtsatldgllfkgkdvvviGgGpaGleaAlalarlglkvtllerrprl
00468341   1/2  rlgtrvt---------------------------------------------------------------
00483651   1/2  lg--------------------------------------------------------------------
00447051   1/2  le--------------------------------------------------------------------
00477122   2/2  ------------------------------ektdVaIvGAGpaGlaaAlaLaraGldvtvlErrdrpggt
00496791   1/2  ill-------------------------------------------------------------------
00457951   1/2  ellladgvt-------------------------------------------------------------
00460572   2/2  -------------------------------pmmskkkdvvViGaGiaGlsaAlaLaraGysVtvlErgd
00384681   1/2  tge-------------------------------------------------------------------
00460571   1/2  gggvvdpaa-------------------------------------------------------------
00472711   1/2  gve-------------------------------------------------------------------
00363011   1/2  gve-------------------------------------------------------------------
00477121   1/2  ...vtvt---------------------------------------------------------------
00487711   1/2  plldlpdll-------------------------------------------------------------
00406191   1/2  .lpl------------------------------------------------------------------
00486072   2/2  ---------------------------------myDvviiGaGpaGlaaAlrLaraGlkVlvlEk.drlG
00406192   2/2  -----prvlpip...GedlcgvlslrdfvgdynlhpaawllppdltgkrVvviGaGpaGldaArellkdl
00384682   2/2  ---ftprvlpipgeeacglltadepvailflerlihsyavkdgppftgkdVaViGaGpaGldaAlylarl
00419401   1/2  .---------------------------------------------------------------------
00457952   2/2  ---------------------------------yDVvIiGaGpaGlsaAlrLaraGldlgselkVtvlEk
00481081   1/2  ..lel-----------------------------------------------------------------
00382851   1/2  et--------------------------------------------------------------------
00445591   1/2  iavgtprk--------------------------------------------------------------
00360161   1/2  lel-------------------------------------------------------------------
00457981   1/2  vl--------------------------------------------------------------------
00423421   1/2  ----------------------------------------------------------------------
00472761   1/2  ----------------------------------------------------------------------
00479921   1/2  iiavg-----------------------------------------------------------------
00454811   1/2  spg-------------------------------------------------------------------
00529641   1/2  l---------------------------------------------------------------------
00463441   1/2  ----------------------------------------------------------------------
00374371   1/2  akf-------------------------------------------------------------------
00463571   1/2  ----------------------------------------------------------------------
00472781   1/2  ...-------------------------------------------------------------------
00533831   1/2  ...-------------------------------------------------------------------
00531721   1/2  ...-------------------------------------------------------------------
00504432   2/2  -------------------------------lmeikkvaviGaGlmGlgiAavlaraGleVvlvdinpea
00482271   1/2  ledlsglvvgld----------------------------------------------------------
00355351   1/2  ----------------------------------------------------------------------
00425341   1/2  ----------------------------------------------------------------------
00480271   1/2  ----------------------------------------------------------------------
00473461   1/2  arlvl-----------------------------------------------------------------
00504431   1/2  ----------------------------------------------------------------------
00481021   1/2  ----------------------------------------------------------------------
00529642   2/2  ----ePripdipglleefkgkvlhsaayrdpedfkgkrVvViGaGaSgldialelakvaksvtllersde
00463572   2/2  --------------------------------mKiaviGaGyvGlelAavla.lgheVtlvdinpeklea
00360162   2/2  -----prklgiPGedlpgvfsardfvawynglpdaallepdltgkrVvviGgGpaGldaArlllksldel
00475101   1/2  ----------------------------------------------------------------------
00372751   1/2  ----------------------------------------------------------------------
00528371   1/2  ----------------------------------------------------------------------
00423401   1/2  ----------------------------------------------------------------------
00423661   1/2  ----------------------------------------------------------------------
00466731   1/2  ----------------------------------------------------------------------
00445592   2/2  -------------------------------pkkvaviGaGgvGlalAlllaaagggdVtlvDidpekle
00452431   1/2  ----------------------------------------------------------------------
00480351   1/2  ----------------------------------------------------------------------
00367851   1/2  ----------------------------------------------------------------------
00479922   2/2  -------------------------------pkkvaviGaGavGlalAlalaraGaageVvlvdrdeerl
00367461   1/2  ----------------------------------------------------------------------
00383791   1/1  .....-----------------------------------------------------------------
00406511   1/2  ----------------------------------------------------------------------
00432761   1/2  ----------------------------------------------------------------------
00486871   1/2  ----------------------------------------------------------------------
00452432   2/2  llalarnlpgaapllragiwrasdllglelkgktvgviGlGriGlalarllaalGakVivydrspeklee
00372752   2/2  ---------------------------------tllgtpllpgatkvlilGgGqlGrmlalaaarlGiev
00529632   2/2  ----------------------------------------------------------------------
00421801   1/2  ----------------------------------------------------------------------
00484141   1/2  kvDiv-----------------------------------------------------------------
00454812   2/2  ---------------------------tdlkgkrVvViGaGlsGlaaarlllrlGaevtvldrrdrpg--
00502691   1/2  ----------------------------------------------------------------------
00366641   1/2  ......----------------------------------------------------------------
00523132   2/2  ----------------------------------------------------------------------
00435071   1/2  ----------------------------------------------------------------------
00423402   2/2  -------------------------------aGylavllaalllcrflgglgllltlagglagkkvlviG
00425342   2/2  -------------------------lsmvlkgkkvaviGaGliGlalalllallglgeVvlyDinpekle
00472782   2/2  -------------ldifvkrlikelivvklpgkkvvviGaGpvGlalAlalallgavgkVvlvdideek-
00466732   2/2  ----------------------------mlkikkvaViGaGlmGsgiAavlaaaGikVvlv---------
00423422   2/2  -------------------------------ldllplfldlrgkdvlviGgGdvGlaaarllleagakvt
00533832   2/2  -------------lellgvallevlgkrilkgkkvaviGaGgvGlalAllllelgvaaeVt---------
00355352   2/2  --------------------------------GkkvaviGlGsmGlalAallaaaGheVlvw--------
00367462   2/2  -------------------------------lellsvalhallraglvpGktVlviGaGgiGlaaala--
00472762   2/2  --------------------------------ysrplllgligllgakvlpgkkvaviGaG---------
00481022   2/2  --------------------------------lllmlkmmkiaviGaGavGtalAallaeng--------
00482272   2/2  --------------------------------mkiaviGaGyvGlplAallaeaGheVvgv---------
00366642   2/2  --------------------------------ntesvaelalalllalarrlpeaaagvrtgkwlllggl
00486872   2/2  --------------------------------llllllkikkvafiGlGgmGmsalAllllkaGyeVtgs
00423662   2/2  -------------------------------lplelgalvltlatavralllagvlpgakVlvlGaGv--
00367852   2/2  ---------------------------------kgkkvlviGaGgiGralaraLaeaGaevt.va-----
00475102   2/2  ilnllrdllgarqrlsagllrlkpllglelkgkkvviiGaGnvGralakvlralGaevtvydide-----
00470682   2/2  ----------------------------------------------------------------------
00529112   2/2  ----------------------------------------------------------------------
00467502   2/2  ----------------------------------------------------------------------
00432762   2/2  -------------------------------lplelaaalglalltavlavlaagvkpgktvlvlGa---
00502692   2/2  --------------------------------kkvgiiGlGlmGlalarnlaaaGyeVvvydrspeklea
00473462   2/2  -----------------------------klkmhviiiGagrvGrslarlLleegidvvvi---------
00435072   2/2  -------------------------------rmKiaviGaGsvgtalalllalkgldelpvgevvlldid
00528372   2/2  --------------------------------mkkvgiiGlGlmGlslalalaraGfadeV---------
00492222   2/2  ----------------------------------------------------------------------
00406512   2/2  --------------------------------mhviiiGlGrvGlalarlLlelgidvvvi---------
00484142   2/2  --------------dyiglvnllkklgldlkgktvliiGaGgvGlaiaqalaalGakkVvlv--------
00480352   2/2  ----------gllldtallvllllllllldlkgkvalVtGasggiGlaiAralaaaGarVvlad------
00531722   2/2  -------------------------------rrsrlllliglegqeklkgakVaviGaGgv---------
00421802   2/2  --------------------------------DgigavsllkrllvdlpgkkvlvlGaGgiG--------
00480272   2/2  --------------------------------mhviiiGlGrvGrlvarlLlelgidvvvi---------


                         -         -         -         +         -         -         -:280
query           QDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLGLEEAG
00374411   1/1  flgkrvvviGggvsglelaealarllkilgaevtllersdrllallddegqvdprglldalaealeellg
00462741   1/1  alarlgakvtllersgrllppgglgelvkallelleklGveirlntevteierddgkvtgvttdGeeiea
00491501   1/1  lgllllgkrvvviGggaiglelalalarlgaevtlversprlgpvlpaglsealaealeallGveirlgt
00435771   1/1  lldalalllgllsldalaalepllalellggllypdggpaalvealaeal.e.gveillgtrvteierdg
00470291   1/1  gaiglelapvlarlgakvtgvgrlprglpvgdgglsalvaalakalerlgveiltntrvtrilvdggggg
00360921   1/1  sgvelasalarlgagvtvvyrpdgg....rgalaralaraaeaagvtvltgtrvteierdggggrvtgVt
00400491   1/1  .................aealealpgveillgtevtellgdggrvtgvvledgetgeevtiradavvlat
00470221   1/1  vvlerrdrlllffppdgqvdpaglvralaealeallgveirlgtrvteierdgggvtVttadGetieadl
00400351   1/1  plarlppgllspgdglldggdgalvaalaealerlgveillgtrvteilrdgggvtgVttedgeleldge
00503631   1/1  asalarlgakvtlverrprllprldpelvepllealeklgvevllnlkvteiegcdslylvvlvdgrvll
00461281   1/1  aiglelapflarlgakvtgvgrlpgll.plggvdpsalvaalakalerlgveiltntrvtrilrdgggkg
00413411   1/1  ..........lvgrgdgaalaralaeaaealgveiltgtevteilrdeggrvtgVvtadtkdGeevtira
00485831   1/1  rdrllprldpeiadlllkll--------------------------------------------------
00484941   1/1  tllqrrppfvlpllllglllllllllglspdhligagplrggcdyrgggvfgcpggaglvlggrgslaea
00359891   1/1  ...............ralleaaeelpgveillgtevteilgdgdgvtvttgrvtgvvlrdladGeevtir
00457971   1/1  .................................................................vllai
00396641   1/1  arela..............................laeaalklgveilegtevtellgdgdgkgrvtgvv
00509271   1/1  ......................................................................
00526001   1/1  ergglllpgdgvgdraslaralleaaealgveiltgtrvteilrdedggrvtgVetrdladGeeftirad
00475641   1/1  vverrdrllpgldpeisdl---------------------------------------------------
00406601   1/1  Gareralpapgldllgrspagalpllsrrflvdllpklllaggglvnlllasdstrylefkalpkslvii
00520321   1/1  le...............................alaeaaeelGveiltgtevteierdggrvtgVtvrdt
00464461   1/1  la............................ralaeaaeelgveillgtrvteilvdeggrvtgvttedad
00458701   1/1  vela.alaragasvtlllrsprlglltprggygalvealakalendylealarlgveirlgtrvteilrd
00473271   1/1  vlergdgllgggdgqiyprggagallealak.gveirlntevtri...e........dGetieadaVila
00462701   1/1  a............................ralaeaaeelgveillgtrvteilvdeggrvtgvtlrdadG
00470681   1/2  Aaalarlgve------------------------------------------------------------
00458811   1/1  qglpereklltlviiGgGn.............................dpgklaralaealekrlGveir
00483561   1/1  prggtvdparlvralaeaaeelGveillgtevtsierdggvvgVttedGe.iradlvvlAtGawsp..el
00533211   1/1  lergdrllp....ellrallealeelgveirlgt.vtei..dggvvgvtledGeeetleadlvvlatGsv
00490031   1/1  ..........................ralaeaaeelgveillgtrvtellvdeggrvtgvvledadGeev
00499901   1/1  erldglllpgdgvldpkgglgallealleelgveillgtpvtei.............Ge.leadavvlat
00406021   1/1  .................leeaaeelgveiltgtevtei..dg.vvgvvledGeeltieadlvvlatGars
00471411   1/1  lkvtlverrdrllpradpe....l----------------------------------------------
00492221   1/2  gilvleglplvlpenlqgkrvvv-----------------------------------------------
00472702   2/2  tlierglGgtllnggpglskplllrvlgpelaeylrelleklgveillgtrvtsidrdgdtgrvtgvtle
00483642   2/2  yvgcllskalgllglldeelalrllelleklgvelllgtevtsidlegktvtllllvlgdgetleydklv
00476821   1/1  glalvldrlgakvtgvgrldrglptggrgslakallraaerlGveiltnteVtrilrdedgggrvtGVet
00363002   2/2  llllsvpggrldpeelvlalaelleelgvevrlgtevtsidrdgdg..vtledgetleadavvlAtGarp
00509602   2/2  rpllsgvipgklldeelaeylrelleklgvevllgtevtsidgdgkg..vtlddge.leadavvlatGsr
00364591   1/2  ylr-------------------------------------------------------------------
00481992   2/2  aAaylarlGlkvlliekgprlggtclnvgcipskallkaaelaeliellpglgvelllgglgldlaelle
00488652   2/2  ggtllplgpgpllglldaeelaeylrelleklgvevllgtevtsidgdgkg..vtledgetleadlvvla
00444131   1/1  glkvt.vlflggllyfgdsaqlyprgGlgalaqalaraaeeagvtvllntevteilvdgdgr--------
00465142   2/2  lnvgcipgkaldaaalllrllelleelgvelrlppldglllpgvgdvlgaelaaalaealeelgveillg
00501482   2/2  lgglllyvgcilskallllgilgeellarlreqleklgveillgtrvtsidl..dggtvvltdgetiead
00467602   2/2  llggqtllllggtclnvgcipskllllaallpellelleglgvefdleekgvdldglrlaydklvdaela
00465791   1/1  lrrlgvpvellspeelkellplldfpeflgglytprggtvdpaelvralleaaeelGveillgtevtsie
00467501   1/2  ael-------------------------------------------------------------------
00509281   1/1  ----------------------------------------------------------------------
00380742   2/2  lnvgcipgkrllaaaelydelrelleelgipfdevllglllllgrggadgaelaaalaelleelgvevll
00486071   1/2  ----------------------------------------------------------------------
00384501   1/1  ----------------------------------------------------------------------
00406901   1/1  ----------------------------------------------------------------------
00375101   1/1  ----------------------------------------------------------------------
00419411   1/1  ----------------------------------------------------------------------
00480161   1/1  vartllrlgasvtlverrgrll....apaspkelrelleegveflfladpveidgdg-------------
00461561   1/1  kvtlverrgll.....lpatpeelralleegvelllltspveilgdgrvvgvvlvdg-------------
00376432   2/2  lvglipskllllrvlgaelaaalaealeelgvevllgtevtsidrdgggvtgvllvttgdgetiradavv
00418871   1/1  ----------------------------------------------------------------------
00488071   1/1  ----------------------------------------------------------------------
00395041   1/1  ----------------------------------------------------------------------
00455331   1/1  ----------------------------------------------------------------------
00366551   1/1  ----------------------------------------------------------------------
00406041   1/1  ----------------------------------------------------------------------
00351301   1/1  ----------------------------------------------------------------------
00368901   1/1  ----------------------------------------------------------------------
00410231   1/1  ----------------------------------------------------------------------
00455192   2/2  ldpelskallelleklgvevllgtevteidg..........dgetleadavliAtGarpntlllglengg
00471332   2/2  ktllalGgllltvglipgkallgaalllelaelleelgvevtllellggdrvlprldldgpellkallea
00382852   2/2  veagdrllpryldpelsklllelleelgvelllgtkvtsiegdgdgvvvtledge---------------
00380761   1/1  ----------------------------------------------------------------------
00440982   2/2  lntgcgpsklllpgallgaelveallelleelgveillgtevtsidldgggv..vltdgetieadavvlA
00406882   2/2  llagcipgkallaaalllrllellaelgiellllpypgvdlslvplllrvlgaelaaalaealeelgvei
00481991   1/2  ----------------------------------------------------------------------
00457982   2/2  lpyldpelsklllelleklgvevllgtkvtsidrgedgvvvvtledgetleadlv---------------
00455201   1/1  ----------------------------------------------------------------------
00464162   2/2  lGGtllntgcipgkalllgalllellrellelgglflllpdldlelllelldalve.elaaalaealeel
00455182   2/2  snrngipglrlllgalllrllelleelgipfdlpglgglflprggrvdgaelaaalaeaaeelgveillg
00485842   2/2  ldpelsklllelleklgvdlllgtkvtaidrdgdgvtvvlllkdgdgetleadlvll-------------
00481082   2/2  gaeVtlvergdrllpglldeelaelllelleklgvelllgtkvteidgdgkgvtvtle------------
00533222   2/2  ldeelslallelleklgvelllgtrvtaidvdgdgvtvtledggeeetleadlvvl--------------
00480452   2/2  ldpelaaallelleklgvelllgtrvtaidldgggvtvtledgetleadlvvlAtG--------------
00475652   2/2  ldpelskallelleklgvelllgtevtaidgdgdgvvvvlllvdvvlgdgetle----------------
00529631   1/2  rvlh------------------------------------------------------------------
00523131   1/2  lfqpgd----------------------------------------------------------------
00488662   2/2  drlggtlldeelaaallelleklgvevllgtrvtaidvdgdgvtvtlvtlgdgetl--------------
00480092   2/2  ldeelsllllelleklgvelllgtrvtaidvdgdgvtvtledggeeetleadlvvl--------------
00406881   1/2  ----------------------------------------------------------------------
00384492   2/2  ldcilskallelleelgvevllgtevteveldgggvvvvlgltvevvvlgdgetle--------------
00419402   2/2  ldeelsllleelleelgidvllgtevteiekdgdgvlvvvvlgdgetleadlvll---------------
00469732   2/2  ldcelskallelleklgvdlllgtkvtaidrdddgvlvvvledgetleadlvllAt--------------
00366542   2/2  ldpelskallelleklgvevllgtevtaidvdgdgvtvtvldvvlgdgetleadl---------------
00469722   2/2  ldpelskallelleklgvelllgtevtaidldgdgvtvvtledgetleadlvllAt--------------
00413941   1/1  ----------------------------------------------------------------------
00529262   2/2  aGpaGlaaAlrLlqlAaraGpdlkVtvlEkgdrlGGtsrtnggliprgleelldelgipgalldagfpyd
00374372   2/2  leelgakfvlltldeelvevvlaltvdvsdeegrlkavetleellgeaDvvivaagippataplllteel
00380741   1/2  ----------------------------------------------------------------------
00368892   2/2  ldpelaaallelleklgvevllgtevtaidvdgdgvtvtllldgdgetleadlv----------------
00482002   2/2  ldpelsklllelleklgvevllgtevtaiegdgdgvvvvvklvtlgdgetleadlv--------------
00467612   2/2  lpcldpelsklllelleklgvdvllgtevtaidvddktvtvvtledgetleadlvli-------------
00463442   2/2  drlggllrlgipdpllerleelgveillgvavteilgdg....velgeeleleaDlvvlatgftpndel.
00384491   1/2  ----------------------------------------------------------------------
00464161   1/2  ----------------------------------------------------------------------
00509612   2/2  lgg.ldpelskallelleklgvelllgtevteidgd.....vvlgdgetleadlvvl-------------
00465141   1/2  ----------------------------------------------------------------------
00487712   2/2  ggasgrnagllhaglaylelarlaresldllrelveelgidfrrygklvlatgeaelellrelaealral
00479092   2/2  tlverdpr......pelallllelleklgvevllgtrvteiakeylpelllgveveagdgvvtvvlgdge
00529111   1/2  ----------------------------------------------------------------------
00483652   2/2  rgdrlggrlldeelalallelleklgvelllgtevteidgdgggv.vvltdgetl---------------
00368891   1/2  ----------------------------------------------------------------------
00503641   1/1  dpelaelltplllflgkrvvvigggysgv...........................--------------
00455181   1/2  ----------------------------------------------------------------------
00472701   1/2  ----------------------------------------------------------------------
00488651   1/2  ----------------------------------------------------------------------
00469721   1/2  ----------------------------------------------------------------------
00469731   1/2  ----------------------------------------------------------------------
00376431   1/2  ----------------------------------------------------------------------
00363012   2/2  drlllpylrpelskallelleelgvelrlgtevtsidrdg....vvlddgttlead--------------
00440981   1/2  ----------------------------------------------------------------------
00471331   1/2  ----------------------------------------------------------------------
00482001   1/2  ----------------------------------------------------------------------
00485841   1/2  ----------------------------------------------------------------------
00480091   1/2  ----------------------------------------------------------------------
00533221   1/2  ----------------------------------------------------------------------
00496792   2/2  gdpelleyllelleklgveillgtevteiegdgdgvtgvtledgeltgeeetlead--------------
00488661   1/2  ----------------------------------------------------------------------
00447052   2/2  rlggtld.....lllelleklgveillgtevteiegdgdgftvtlvrllnlvdgd---------------
00480451   1/2  ----------------------------------------------------------------------
00455191   1/2  ----------------------------------------------------------------------
00363001   1/2  ----------------------------------------------------------------------
00501481   1/2  ----------------------------------------------------------------------
00467601   1/2  ----------------------------------------------------------------------
00424461   1/2  ----------------------------------------------------------------------
00366541   1/2  ----------------------------------------------------------------------
00509611   1/2  ----------------------------------------------------------------------
00483641   1/2  ----------------------------------------------------------------------
00509601   1/2  ----------------------------------------------------------------------
00467611   1/2  ----------------------------------------------------------------------
00475651   1/2  ----------------------------------------------------------------------
00529261   1/2  ----------------------------------------------------------------------
00468342   2/2  tvlEkgprpggrsrggglypgglellrelgledeleelgvdflkalvvlldldlvlalrllgpdvtgger
00364592   2/2  ---elvealaelleklgveirlgtrvt.....dg.vgvttedgetieadavilAtGarpntllll.....
00424462   2/2  tllalgripakllglealllrllllllglglllpipgrvlpkellealaealeklgv-------------
00479091   1/2  ----------------------------------------------------------------------
00472712   2/2  ggtl.....dlllelleklgveillgtevteidgdgggvtgvtledgldgeeetle--------------
00468341   1/2  ----------------------------------------------------------------------
00483651   1/2  ----------------------------------------------------------------------
00447051   1/2  ----------------------------------------------------------------------
00477122   2/2  algrggalsprglelleelglldallargvpldglvvvdgggrlaldfaelalgapgyvvdraellrall
00496791   1/2  ----------------------------------------------------------------------
00457951   1/2  ----------------------------------------------------------------------
00460572   2/2  rpggtsgtnggllaaglvapllllpggipllalalealdllrelglelgidfrvgalvlatglaeladal
00384681   1/2  ----------------------------------------------------------------------
00460571   1/2  ----------------------------------------------------------------------
00472711   1/2  ----------------------------------------------------------------------
00363011   1/2  ----------------------------------------------------------------------
00477121   1/2  ----------------------------------------------------------------------
00487711   1/2  ----------------------------------------------------------------------
00406191   1/2  ----------------------------------------------------------------------
00486072   2/2  Gtclnvgcipskallyagllpdelelleelglpllpgldipvlpgrkgggreellrylaealeklgveir
00406192   2/2  dlllktdisdnaleallarlgaevtvvgRrgpliaaftlkelerlpelggllrygi--------------
00384682   2/2  gakkvtlverrdrlgfpafp.....elvellkeegveillgtavleilgdd.gkvt--------------
00419401   1/2  ----------------------------------------------------------------------
00457952   2/2  gdrlGGtsglnaglippglggplddrglalaeetlellrelgaelglldglvrpngalvlaigledadel
00481081   1/2  ----------------------------------------------------------------------
00382851   1/2  ----------------------------------------------------------------------
00445591   1/2  ----------------------------------------------------------------------
00360161   1/2  ----------------------------------------------------------------------
00457981   1/2  ----------------------------------------------------------------------
00423421   1/2  ----------------------------------------------------------------------
00472761   1/2  ----------------------------------------------------------------------
00479921   1/2  ----------------------------------------------------------------------
00454811   1/2  ----------------------------------------------------------------------
00529641   1/2  ----------------------------------------------------------------------
00463441   1/2  ----------------------------------------------------------------------
00374371   1/2  ----------------------------------------------------------------------
00463571   1/2  ----------------------------------------------------------------------
00472781   1/2  ----------------------------------------------------------------------
00533831   1/2  ----------------------------------------------------------------------
00531721   1/2  ----------------------------------------------------------------------
00504432   2/2  leraldeiaklllklvlkgllvelllgaal......aritgttdlealadadlVieavpenldvklavla
00482271   1/2  ----------------------------------------------------------------------
00355351   1/2  ----------------------------------------------------------------------
00425341   1/2  ----------------------------------------------------------------------
00480271   1/2  ----------------------------------------------------------------------
00473461   1/2  ----------------------------------------------------------------------
00504431   1/2  ----------------------------------------------------------------------
00481021   1/2  ----------------------------------------------------------------------
00529642   2/2  lggpw..............lgvvillnteveevtgdg....vvledgtelleaDa---------------
00463572   2/2  lnegllpile------------------------------------------------------------
00360162   2/2  lktdindlalealkrlggkeVtvveRrgpleapftlkelrelggllrygippdpld--------------
00475101   1/2  ----------------------------------------------------------------------
00372751   1/2  ----------------------------------------------------------------------
00528371   1/2  ----------------------------------------------------------------------
00423401   1/2  ----------------------------------------------------------------------
00423661   1/2  ----------------------------------------------------------------------
00466731   1/2  ----------------------------------------------------------------------
00445592   2/2  glaadlldilelllve..rlitttdleealadaDvviia-------------------------------
00452431   1/2  ----------------------------------------------------------------------
00480351   1/2  ----------------------------------------------------------------------
00367851   1/2  ----------------------------------------------------------------------
00479922   2/2  ealaadledl------------------------------------------------------------
00367461   1/2  ----------------------------------------------------------------------
00383791   1/1  ----------------------------------------------------------------------
00406511   1/2  ----------------------------------------------------------------------
00432761   1/2  ----------------------------------------------------------------------
00486871   1/2  ----------------------------------------------------------------------
00452432   2/2  ldglgvdsleellke-------------------------------------------------------
00372752   2/2  ialdpyadapaaqvadevivadyldadalre---------------------------------------
00529632   2/2  -----ldyladlaeklgveirlnteVtsverdgdgvtvttedgepdgeeetleadaVvlAtGalsrprll
00421801   1/2  ----------------------------------------------------------------------
00484141   1/2  ----------------------------------------------------------------------
00454812   2/2  ----------------------------------------------------------------------
00502691   1/2  ----------------------------------------------------------------------
00366641   1/2  ----------------------------------------------------------------------
00523132   2/2  ------aalaeaaealgveirlgtevtdllleggrvtgVrtadGetlradavvlAtGafsrlllllglel
00435071   1/2  ----------------------------------------------------------------------
00423402   2/2  aGgvGlaaarllaalGakVtvldrn........pekleqleelgadavevdvsdtad.............
00425342   2/2  glaadladilelllv-------------------------------------------------------
00472782   2/2  ----------------------------------------------------------------------
00466732   2/2  ----------------------------------------------------------------------
00423422   2/2  vverrll..........prlaalaeelgvevvlgdfleedl.----------------------------
00533832   2/2  ----------------------------------------------------------------------
00355352   2/2  ----------------------------------------------------------------------
00367462   2/2  ----------------------------------------------------------------------
00472762   2/2  ----------------------------------------------------------------------
00481022   2/2  ----------------------------------------------------------------------
00482272   2/2  ----------------------------------------------------------------------
00366642   2/2  lgrelagktv------------------------------------------------------------
00486872   2/2  Dlnd...........pallelleelgievvlghdae----------------------------------
00423662   2/2  ----------------------------------------------------------------------
00367852   2/2  ----------------------------------------------------------------------
00475102   2/2  ----------------------------------------------------------------------
00470682   2/2  ----------elleelgvevllgtrvtgidpdg..vtvtladgetitadklvlAtGarprllpi------
00529112   2/2  --aalvralaeaaleelgveirlgteVtdilvdgggvlwtvrvtGVvvndtgvaldgllkllvdpllllk
00467502   2/2  ---elllrllelllklgvevllg.evtsidpdg..ktvtledgetleydllvlAtGarprllpipgldle
00432762   2/2  ----------------------------------------------------------------------
00502692   2/2  laalgaevaasl----------------------------------------------------------
00473462   2/2  ----------------------------------------------------------------------
00435072   2/2  eerlegealdlllakllaelglpvnv--------------------------------------------
00528372   2/2  ----------------------------------------------------------------------
00492222   2/2  -----------------------tevtdilrdggrvtgvttedllvdkngvevtdgdggtiradavvlAt
00406512   2/2  ----------------------------------------------------------------------
00484142   2/2  ----------------------------------------------------------------------
00480352   2/2  ----------------------------------------------------------------------
00531722   2/2  ----------------------------------------------------------------------
00421802   2/2  ----------------------------------------------------------------------
00480272   2/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           IRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHP
00374411   1/1  veirlgtrvteierdgggvtvtledgdgeeetieadlvvlatGarsltell-------------------
00462741   1/1  dlvil.tGar.ntrllgllgsgleldpggfllipvd----------------------------------
00491501   1/1  rvteierdgggvtvttedGdgeeetieadavvlatGarpllr..lledlglp------------------
00435771   1/1  ggvtvttedadgslkpvledgetieadavvlatGarslar.llldpplppv-------------------
00470291   1/1  lrvtgVetedgggeektiradkeVilaaGaigsprllllsgiglklllkalgip----------------
00360921   1/1  ledgegltgeevtiradlvvlaaGarsttrllllsglglplppdlgvvgrn-------------------
00400491   1/1  GgrpnlellltnppgntgdglalleraglelhdtrggivvdetlrtsvpglyaaGdvagtplhgagrlgg
00470221   1/1  vvlatGarsllrllglpglgleldpagerlpdgWgggipvdpdlrtgvpglylaGdaaggfggggvagal
00400351   1/1  evtiradavvlatGarssprllllsgigpaellkalgielpldlpgvgenli------------------
00503631   1/1  ..lvlyaggllp----------------------------------------------------------
00461281   1/1  lrvtgvevetadGeevtiradkeVilaaGaigsprlLllsgigpalllrgl.......ginvpgihavGl
00413411   1/1  davvlatGafsnlrlllglglgltgdglalalrlgaplpdggflqfhPthytmggivvdpdlrtsvpgly
00485831   1/1  ----------------------------------------------------------------------
00484941   1/1  llealeelpGveirlgteVteiegdgggvtVttedGeeieadlVilatGars------------------
00359891   1/1  adlvvlatGarsnllllllsgigptgdglalleraglelvderggivvdegl------------------
00457971   1/1  grrpntellglegagleld.rggivvdetlrtsvpgiyaaGdvaggpklavvAla---------------
00396641   1/1  tkdlktgevgtiradavvlatGgagnlllllsvlepdlrttnpptntgdglalalraglelaglelfvqf
00509271   1/1  igvrpntegllledaglelderggilvdetlrtsvpglyaaGdvaggpglaavAlaqG------------
00526001   1/1  lVvlaaGaipspr..llllsGiglpevgrilvdhpgggvlilphwsgtrpmg------------------
00475641   1/1  ----------------------------------------------------------------------
00406601   1/1  gggvigvpatraeifsskllslaekrrlmkflgrlley--------------------------------
00520321   1/1  adGeeetiradlvvlatGarsnvrllglsglglpgdgyalairvgeplpdhlpggivvdetlrtsvpgly
00464461   1/1  GeeltiradavvlatGgfpnlalllglglpphPdgrllfgprdddellrllpg-----------------
00458701   1/1  gggvtvttadGetieadavvlatgarplaell..gllgpelpergiiavdgl------------------
00473271   1/1  aGaipsprllglsgiglkldklg.igvvekvrlsvdgpfaggdladhlqlv-------------------
00462701   1/1  eevtiradavvlatGglsnlrlllglglPifPdgrlllgprpddelrellpg------------------
00470681   1/2  ----------------------------------------------------------------------
00458811   1/1  lgtevteierdeggrvtvttedgetkdvlgeeeeieadlvvlaaGarpstrlll----------------
00483561   1/1  .lkllgielplgllpvrgqilvv......dpglfaigdllggillggvtgdggsdlalltevll------
00533211   1/1  vrlllgvrpnlegllleglglelderggivvdetlrtsvpgvyaaGdaaggpklavvAla----------
00490031   1/1  tiradavvlatGgfpnlrrllgldlpllpvrgtalalgatgdglalleragv------------------
00499901   1/1  gldplaellgle.....lperglivvdpglrtgvpglylaGdaagpggpgvtgaiasgrlaadailgllk
00406021   1/1  nlrlllgldlpkelleglgleldtrggivvdetlrtsvpglyaaGdaagpg-------------------
00471411   1/1  ----------------------------------------------------------------------
00492221   1/2  ----------------------------------------------------------------------
00472702   2/2  dgetleadavvlAtGarsnpnilglegagl.lderggivvdetlrtsvpgvfaaGdvaggplg-------
00483642   2/2  lAtGarpvvvaigvtpntgllkaglelderggivvdetlrtsvpgiyAaGDvagv---------------
00476821   1/1  edadGeertltirAdkeVvlaaGai.gsprl.LllsGig.parglikvgiglvtdlpgv...Grnlqdhp
00363002   2/2  rvlllpglellegagleld..ggivvdeylrtsvpgvyaaGdvagvplpllg------------------
00509602   2/2  pntpllp....glelderggilvdetlrtsvpgvfaagDvagkpvlvvgagaegrl--------------
00364591   1/2  ----------------------------------------------------------------------
00481992   2/2  rkdavvdgeelaaalaelleelgvevllgtav..ii..ddgtvtv..dgetiead---------------
00488652   2/2  tGarpntppipgldllgv.ldvrgaivvdellqtgkpvvvaggdvagleglllgllll------------
00444131   1/1  ----------------------------------------------------------------------
00465142   2/2  trvtei.d.ggvvgvttedgetieadavvlAtGarslllllgrrpntellg-------------------
00501482   2/2  avilAtGvlvaigrrpntellkl...glelderggivvdelllrtsvpgvfaaGdv--------------
00467602   2/2  aalaelleklgvevllgt.vteiegddgrvtgvvvvrledgetleadlvilatGg---------------
00465791   1/1  rdgdgvtVttedG.tiradlvvlAtGawg-----------------------------------------
00467501   1/2  ----------------------------------------------------------------------
00509281   1/1  ----------------------------------------------------------ydlvPsvvftdP
00380742   2/2  gtavt.i...ddgr.Vtl.dgetitadavilAtGarprllglpgitptllleaag---------------
00486071   1/2  ----------------------------------------------------------------------
00384501   1/1  ----------------------------------------------------------ydaiPtvvftdP
00406901   1/1  ----------------------------------------------------------ydavPsvvftdP
00375101   1/1  ----------------------------------------------------------ydlvPtvvftdP
00419411   1/1  ----------------------------------------------------------YdliPtvvftdP
00480161   1/1  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00376432   2/2  lAtGarpntp..lleglglelderggivvdetlrtsvpglyaaGdaaggvnplag---------------
00418871   1/1  ----------------------------------------------------------yraipsvvftdp
00488071   1/1  ----------------------------------------------------------------------
00395041   1/1  ----------------------------------------------------------ydaipsvvftdp
00455331   1/1  ----------------------------------------------------------ydaiPsvvftdp
00366551   1/1  ----------------------------------------------------------ydaiPsvvftdp
00406041   1/1  ----------------------------------------------------------ydaiPsvvftdP
00351301   1/1  ---------------------------------------------------------DydliPtvvftdP
00368901   1/1  ------------------------------------------------------------gvpsvvftdp
00410231   1/1  ----------------------------------------------------------ydaipsvvftdp
00455192   2/2  ivvde-----------------------------------------------------------------
00471332   2/2  leklgv.illgt..veilgddggvgvtledGeeetieadlvvlAtGglsrvrlllvrp------------
00382852   2/2  ----------------------------------------------------------------------
00380761   1/1  ----------------------------------------------------------ydaiPsvvftdP
00440982   2/2  tGarprllglpgldlpgglealglelderggivvdetlrtsvpglyaaGdv-------------------
00406882   2/2  llgtav...ve.dggr.vtl.dgetieadlvvlAtGarsllllgrrpntel-------------------
00481991   1/2  ----------------------------------------------------------------------
00457982   2/2  ----------------------------------------------------------------------
00455201   1/1  ----------------------------------------------------------YdaiPsvvftdP
00464162   2/2  gveillgtevt.i..edgrvgvtledgeeltleadlvilatGrrslPlllpntel---------------
00455182   2/2  trvt.i..dggvvgvtt.dgetiradavilAtGalslplllglspntpglllegl---------------
00485842   2/2  ----------------------------------------------------------------------
00481082   2/2  ----------------------------------------------------------------------
00533222   2/2  ----------------------------------------------------------------------
00480452   2/2  ----------------------------------------------------------------------
00475652   2/2  ----------------------------------------------------------------------
00529631   1/2  ----------------------------------------------------------------------
00523131   1/2  ----------------------------------------------------------------------
00488662   2/2  ----------------------------------------------------------------------
00480092   2/2  ----------------------------------------------------------------------
00406881   1/2  ----------------------------------------------------------------------
00384492   2/2  ----------------------------------------------------------------------
00419402   2/2  ----------------------------------------------------------------------
00469732   2/2  ----------------------------------------------------------------------
00366542   2/2  ----------------------------------------------------------------------
00469722   2/2  ----------------------------------------------------------------------
00413941   1/1  ---------------------------------------------------------gylgipavvftdp
00529262   2/2  gllfvfgggfigledargllrlgagvtvvdrgd.llralaeaaeelGveirlg-----------------
00374372   2/2  lelmkpggiivdiasvaggivetsvpgifaagdv------------------------------------
00380741   1/2  ----------------------------------------------------------------------
00368892   2/2  ----------------------------------------------------------------------
00482002   2/2  ----------------------------------------------------------------------
00467612   2/2  ----------------------------------------------------------------------
00463442   2/2  .................dealrtsvpgvf-----------------------------------------
00384491   1/2  ----------------------------------------------------------------------
00464161   1/2  ----------------------------------------------------------------------
00509612   2/2  ----------------------------------------------------------------------
00465141   1/2  ----------------------------------------------------------------------
00487712   2/2  gvdvelldaaelraleplldlpdllgglyvpdggvvdpaalaaalaraaealGveirlgtevtgierdgg
00479092   2/2  tieadlvilAtGarpn..nlllpg----------------------------------------------
00529111   1/2  ----------------------------------------------------------------------
00483652   2/2  ----------------------------------------------------------------------
00368891   1/2  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------
00455181   1/2  ----------------------------------------------------------------------
00472701   1/2  ----------------------------------------------------------------------
00488651   1/2  ----------------------------------------------------------------------
00469721   1/2  ----------------------------------------------------------------------
00469731   1/2  ----------------------------------------------------------------------
00376431   1/2  ----------------------------------------------------------------------
00363012   2/2  ----------------------------------------------------------------------
00440981   1/2  ----------------------------------------------------------------------
00471331   1/2  ----------------------------------------------------------------------
00482001   1/2  ----------------------------------------------------------------------
00485841   1/2  ----------------------------------------------------------------------
00480091   1/2  ----------------------------------------------------------------------
00533221   1/2  ----------------------------------------------------------------------
00496792   2/2  ----------------------------------------------------------------------
00488661   1/2  ----------------------------------------------------------------------
00447052   2/2  ----------------------------------------------------------------------
00480451   1/2  ----------------------------------------------------------------------
00455191   1/2  ----------------------------------------------------------------------
00363001   1/2  ----------------------------------------------------------------------
00501481   1/2  ----------------------------------------------------------------------
00467601   1/2  ----------------------------------------------------------------------
00424461   1/2  ----------------------------------------------------------------------
00366541   1/2  ----------------------------------------------------------------------
00509611   1/2  ----------------------------------------------------------------------
00483641   1/2  ----------------------------------------------------------------------
00509601   1/2  ----------------------------------------------------------------------
00467611   1/2  ----------------------------------------------------------------------
00475651   1/2  ----------------------------------------------------------------------
00529261   1/2  ----------------------------------------------------------------------
00468342   2/2  rpragvvdraellralleaaeelGngrveirlgtrvtsierdgelledleey------------------
00364592   2/2  .....rggivvdeylrtsvpgifaagdvaagpllvglaaagkrvv-------------------------
00424462   2/2  ----------------------------------------------------------------------
00479091   1/2  ----------------------------------------------------------------------
00472712   2/2  ----------------------------------------------------------------------
00468341   1/2  ----------------------------------------------------------------------
00483651   1/2  ----------------------------------------------------------------------
00447051   1/2  ----------------------------------------------------------------------
00477122   2/2  eaaeelgveirlgtrvtsileedgdgvtvtledggeeetieadlvvgAdGa-------------------
00496791   1/2  ----------------------------------------------------------------------
00457951   1/2  ----------------------------------------------------------------------
00460572   2/2  llalgapprlldapelrellpvvvpgggvvdpaallealaeaaeelGveirl------------------
00384681   1/2  ----------------------------------------------------------------------
00460571   1/2  ----------------------------------------------------------------------
00472711   1/2  ----------------------------------------------------------------------
00363011   1/2  ----------------------------------------------------------------------
00477121   1/2  ----------------------------------------------------------------------
00487711   1/2  ----------------------------------------------------------------------
00406191   1/2  ----------------------------------------------------------------------
00486072   2/2  lgtalfvdpnrVts.......vtvttedGet---------------------------------------
00406192   2/2  ----------------------------------------------------------------------
00384682   2/2  ----------------------------------------------------------------------
00419401   1/2  ----------------------------------------------------------------------
00457952   2/2  arlgkrvavlgggellladgvtgglrpdgg----------------------------------------
00481081   1/2  ----------------------------------------------------------------------
00382851   1/2  ----------------------------------------------------------------------
00445591   1/2  ----------------------------------------------------------------------
00360161   1/2  ----------------------------------------------------------------------
00457981   1/2  ----------------------------------------------------------------------
00423421   1/2  ----------------------------------------------------------------------
00472761   1/2  ----------------------------------------------------------------------
00479921   1/2  ----------------------------------------------------------------------
00454811   1/2  ----------------------------------------------------------------------
00529641   1/2  ----------------------------------------------------------------------
00463441   1/2  ----------------------------------------------------------------------
00374371   1/2  ----------------------------------------------------------------------
00463571   1/2  ----------------------------------------------------------------------
00472781   1/2  ----------------------------------------------------------------------
00533831   1/2  ----------------------------------------------------------------------
00531721   1/2  ----------------------------------------------------------------------
00504432   2/2  e.leallkpgailas...ntsslsitalad----------------------------------------
00482271   1/2  ----------------------------------------------------------------------
00355351   1/2  ----------------------------------------------------------------------
00425341   1/2  ----------------------------------------------------------------------
00480271   1/2  ----------------------------------------------------------------------
00473461   1/2  ----------------------------------------------------------------------
00504431   1/2  ----------------------------------------------------------------------
00481021   1/2  ----------------------------------------------------------------------
00529642   2/2  ----------------------------------------------------------------------
00463572   2/2  ----------------------------------------------------------------------
00360162   2/2  ----------------------------------------------------------------------
00475101   1/2  ----------------------------------------------------------------------
00372751   1/2  ----------------------------------------------------------------------
00528371   1/2  ----------------------------------------------------------------------
00423401   1/2  ----------------------------------------------------------------------
00423661   1/2  ----------------------------------------------------------------------
00466731   1/2  ----------------------------------------------------------------------
00445592   2/2  ----------------------------------------------------------------------
00452431   1/2  ----------------------------------------------------------------------
00480351   1/2  ----------------------------------------------------------------------
00367851   1/2  ----------------------------------------------------------------------
00479922   2/2  ----------------------------------------------------------------------
00367461   1/2  ----------------------------------------------------------------------
00383791   1/1  ----------------------------------------------------------------------
00406511   1/2  ----------------------------------------------------------------------
00432761   1/2  ----------------------------------------------------------------------
00486871   1/2  ----------------------------------------------------------------------
00452432   2/2  ----------------------------------------------------------------------
00372752   2/2  ----------------------------------------------------------------------
00529632   2/2  gllpdipgldlfggrvlhsalyldnldllplykhlfppkgkrvvviGggasgldp.pl------------
00421801   1/2  ----------------------------------------------------------------------
00484141   1/2  ----------------------------------------------------------------------
00454812   2/2  ----------------------------------------------------------------------
00502691   1/2  ----------------------------------------------------------------------
00366641   1/2  ----------------------------------------------------------------------
00523132   2/2  pvgptlgyalvtdllellgkrvvvvgggktgtelaldlrsigasvtlfqpgdrllppfspelaaallral
00435071   1/2  ----------------------------------------------------------------------
00423402   2/2  .leelvaeaDvv----------------------------------------------------------
00425342   2/2  ----------------------------------------------------------------------
00472782   2/2  ----------------------------------------------------------------------
00466732   2/2  ----------------------------------------------------------------------
00423422   2/2  ----------------------------------------------------------------------
00533832   2/2  ----------------------------------------------------------------------
00355352   2/2  ----------------------------------------------------------------------
00367462   2/2  ----------------------------------------------------------------------
00472762   2/2  ----------------------------------------------------------------------
00481022   2/2  ----------------------------------------------------------------------
00482272   2/2  ----------------------------------------------------------------------
00366642   2/2  ----------------------------------------------------------------------
00486872   2/2  ----------------------------------------------------------------------
00423662   2/2  ----------------------------------------------------------------------
00367852   2/2  ----------------------------------------------------------------------
00475102   2/2  ----------------------------------------------------------------------
00470682   2/2  ----------------------------------------------------------------------
00529112   2/2  lll-------------------------------------------------------------------
00467502   2/2  gvltlrtlldalalrealld--------------------------------------------------
00432762   2/2  ----------------------------------------------------------------------
00502692   2/2  ----------------------------------------------------------------------
00473462   2/2  ----------------------------------------------------------------------
00435072   2/2  ----------------------------------------------------------------------
00528372   2/2  ----------------------------------------------------------------------
00492222   2/2  Garprllelpgldlpgvpdalgilvleglplvlpenlqgkrvvvigggasg-------------------
00406512   2/2  ----------------------------------------------------------------------
00484142   2/2  ----------------------------------------------------------------------
00480352   2/2  ----------------------------------------------------------------------
00531722   2/2  ----------------------------------------------------------------------
00421802   2/2  ----------------------------------------------------------------------
00480272   2/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           ELAAVGATEDDVVSGRVDGRIVKLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGVIVGPRASELILAV
00374411   1/1  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00491501   1/1  ----------------------------------------------------------------------
00435771   1/1  ----------------------------------------------------------------------
00470291   1/1  ----------------------------------------------------------------------
00360921   1/1  ----------------------------------------------------------------------
00400491   1/1  nglataaasGrl----------------------------------------------------------
00470221   1/1  asgrlaaeailgalkggpldpealprye------------------------------------------
00400351   1/1  ----------------------------------------------------------------------
00503631   1/1  ----------------------------------------------------------------------
00461281   1/1  tcrmgpdla-------------------------------------------------------------
00413411   1/1  aaGdaagpglh-----------------------------------------------------------
00485831   1/1  ----------------------------------------------------------------------
00484941   1/1  ----------------------------------------------------------------------
00359891   1/1  ----------------------------------------------------------------------
00457971   1/1  ----------------------------------------------------------------------
00396641   1/1  hptglitepvrggivvd-----------------------------------------------------
00509271   1/1  ----------------------------------------------------------------------
00526001   1/1  ----------------------------------------------------------------------
00475641   1/1  ----------------------------------------------------------------------
00406601   1/1  ----------------------------------------------------------------------
00520321   1/1  aaGdaaggsghganplggnglataia--------------------------------------------
00464461   1/1  ----------------------------------------------------------------------
00458701   1/1  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00462701   1/1  ----------------------------------------------------------------------
00470681   1/2  ----------------------------------------------------------------------
00458811   1/1  ----------------------------------------------------------------------
00483561   1/1  ----------------------------------------------------------------------
00533211   1/1  ----------------------------------------------------------------------
00490031   1/1  ----------------------------------------------------------------------
00499901   1/1  g---------------------------------------------------------------------
00406021   1/1  ----------------------------------------------------------------------
00471411   1/1  ----------------------------------------------------------------------
00492221   1/2  ----------------------------------------------------------------------
00472702   2/2  ----------------------------------------------------------------------
00483642   2/2  ----------------------------------------------------------------------
00476821   1/1  vlavvalvdgpial.g------------------------------------------------------
00363002   2/2  ----------------------------------------------------------------------
00509602   2/2  ----------------------------------------------------------------------
00364591   1/2  ----------------------------------------------------------------------
00481992   2/2  ----------------------------------------------------------------------
00488652   2/2  ----------------------------------------------------------------------
00444131   1/1  ----------------------------------------------------------------------
00465142   2/2  ----------------------------------------------------------------------
00501482   2/2  ----------------------------------------------------------------------
00467602   2/2  ----------------------------------------------------------------------
00465791   1/1  ----------------------------------------------------------------------
00467501   1/2  ----------------------------------------------------------------------
00509281   1/1  eiAsvGlteeeakeagidvkvgklpfaalgralalgetegfvklvvdkdtgrilGahivgpdagelinll
00380742   2/2  ----------------------------------------------------------------------
00486071   1/2  ----------------------------------------------------------------------
00384501   1/1  eiAsVGlteeeakeagiddnlevkvgkfpfaalgralalgetegfvklvvdkdtgrilGahivgpnagel
00406901   1/1  eiAsvGlteeeakeagidvkvgklpfaalgralalgetegfvklvvdkdtgrilGahivgpgagelinel
00375101   1/1  eiAsvGlteeeakeagidvkvgklpfaalgralalgeategfvklvvdkdtgrilGahivgpgAgeline
00419411   1/1  eiAsvGlteeeakeagievkvgvllsllklpfaavgralalgetegfvklvvdkdtgrilGahivgpgAg
00480161   1/1  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00376432   2/2  ----------------------------------------------------------------------
00418871   1/1  eiAsvGlteeeakeagidvkvgklpfaalgralalgetegfvklvvdkdtgrilGahivgpgagelinel
00488071   1/1  ----------------------------------------------------------------------
00395041   1/1  eiAsvGlteeeakeagidvkvvtlpfaalgralalgetegfvklvvdkdtgrilGahivgpgagelinel
00455331   1/1  eiAsvGlteeeakeagidvkvgklpfaalgralalgetegfvklvvdkdtgrilGahivgpgagelinel
00366551   1/1  eiAsvGlteeeakeagidvkvgklpfaalgralalgetegfvklvvdkdtgrilGahivgpgagelinll
00406041   1/1  eiAsvGlteeeakeagidvkvgklpfaalgralalgetegfvklvvdkdtgrilGahivgpgagelinel
00351301   1/1  eiAsvGlteeeakeagidvkvgklpfaalgralalgeltegfvKlvvdkdtgrilGahivgpnAgeline
00368901   1/1  eiAsvGlteeeakelgidvkvvtlpfaalgralalgetegfvklvvdkdtgrilGahivgpgagelinll
00410231   1/1  eiAsvGlteeeAkeagidvkvvkfpfaanallllllekeeksllllralalgetegfvKlvvdkdtgril
00455192   2/2  ----------------------------------------------------------------------
00471332   2/2  ----------------------------------------------------------------------
00382852   2/2  ----------------------------------------------------------------------
00380761   1/1  eiAsvGlteeeakeagidenvkvvklpfaalgralalgetegfvklvvdkdtgrilGahivgpgagelin
00440982   2/2  ----------------------------------------------------------------------
00406882   2/2  ----------------------------------------------------------------------
00481991   1/2  ----------------------------------------------------------------------
00457982   2/2  ----------------------------------------------------------------------
00455201   1/1  eiAsvGlteeeakeagieedvkvgklpfaalgralalgetegfvklvvdkdtgrilGahivgpgagelin
00464162   2/2  ----------------------------------------------------------------------
00455182   2/2  ----------------------------------------------------------------------
00485842   2/2  ----------------------------------------------------------------------
00481082   2/2  ----------------------------------------------------------------------
00533222   2/2  ----------------------------------------------------------------------
00480452   2/2  ----------------------------------------------------------------------
00475652   2/2  ----------------------------------------------------------------------
00529631   1/2  ----------------------------------------------------------------------
00523131   1/2  ----------------------------------------------------------------------
00488662   2/2  ----------------------------------------------------------------------
00480092   2/2  ----------------------------------------------------------------------
00406881   1/2  ----------------------------------------------------------------------
00384492   2/2  ----------------------------------------------------------------------
00419402   2/2  ----------------------------------------------------------------------
00469732   2/2  ----------------------------------------------------------------------
00366542   2/2  ----------------------------------------------------------------------
00469722   2/2  ----------------------------------------------------------------------
00413941   1/1  elAsvGlteeeAkelgidvkvvtlpfsdrpral.pgeteglvklvvdkdtgriLGaqivgpegaselinv
00529262   2/2  ----------------------------------------------------------------------
00374372   2/2  ----------------------------------------------------------------------
00380741   1/2  ----------------------------------------------------------------------
00368892   2/2  ----------------------------------------------------------------------
00482002   2/2  ----------------------------------------------------------------------
00467612   2/2  ----------------------------------------------------------------------
00463442   2/2  ----------------------------------------------------------------------
00384491   1/2  ----------------------------------------------------------------------
00464161   1/2  ----------------------------------------------------------------------
00509612   2/2  ----------------------------------------------------------------------
00465141   1/2  ----------------------------------------------------------------------
00487712   2/2  rvtgVrtadGe.ieadlvvlAaGawsn...el--------------------------------------
00479092   2/2  ----------------------------------------------------------------------
00529111   1/2  ----------------------------------------------------------------------
00483652   2/2  ----------------------------------------------------------------------
00368891   1/2  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------
00455181   1/2  ----------------------------------------------------------------------
00472701   1/2  ----------------------------------------------------------------------
00488651   1/2  ----------------------------------------------------------------------
00469721   1/2  ----------------------------------------------------------------------
00469731   1/2  ----------------------------------------------------------------------
00376431   1/2  ----------------------------------------------------------------------
00363012   2/2  ----------------------------------------------------------------------
00440981   1/2  ----------------------------------------------------------------------
00471331   1/2  ----------------------------------------------------------------------
00482001   1/2  ----------------------------------------------------------------------
00485841   1/2  ----------------------------------------------------------------------
00480091   1/2  ----------------------------------------------------------------------
00533221   1/2  ----------------------------------------------------------------------
00496792   2/2  ----------------------------------------------------------------------
00488661   1/2  ----------------------------------------------------------------------
00447052   2/2  ----------------------------------------------------------------------
00480451   1/2  ----------------------------------------------------------------------
00455191   1/2  ----------------------------------------------------------------------
00363001   1/2  ----------------------------------------------------------------------
00501481   1/2  ----------------------------------------------------------------------
00467601   1/2  ----------------------------------------------------------------------
00424461   1/2  ----------------------------------------------------------------------
00366541   1/2  ----------------------------------------------------------------------
00509611   1/2  ----------------------------------------------------------------------
00483641   1/2  ----------------------------------------------------------------------
00509601   1/2  ----------------------------------------------------------------------
00467611   1/2  ----------------------------------------------------------------------
00475651   1/2  ----------------------------------------------------------------------
00529261   1/2  ----------------------------------------------------------------------
00468342   2/2  ----------------------------------------------------------------------
00364592   2/2  ----------------------------------------------------------------------
00424462   2/2  ----------------------------------------------------------------------
00479091   1/2  ----------------------------------------------------------------------
00472712   2/2  ----------------------------------------------------------------------
00468341   1/2  ----------------------------------------------------------------------
00483651   1/2  ----------------------------------------------------------------------
00447051   1/2  ----------------------------------------------------------------------
00477122   2/2  ----------------------------------------------------------------------
00496791   1/2  ----------------------------------------------------------------------
00457951   1/2  ----------------------------------------------------------------------
00460572   2/2  ----------------------------------------------------------------------
00384681   1/2  ----------------------------------------------------------------------
00460571   1/2  ----------------------------------------------------------------------
00472711   1/2  ----------------------------------------------------------------------
00363011   1/2  ----------------------------------------------------------------------
00477121   1/2  ----------------------------------------------------------------------
00487711   1/2  ----------------------------------------------------------------------
00406191   1/2  ----------------------------------------------------------------------
00486072   2/2  ----------------------------------------------------------------------
00406192   2/2  ----------------------------------------------------------------------
00384682   2/2  ----------------------------------------------------------------------
00419401   1/2  ----------------------------------------------------------------------
00457952   2/2  ----------------------------------------------------------------------
00481081   1/2  ----------------------------------------------------------------------
00382851   1/2  ----------------------------------------------------------------------
00445591   1/2  ----------------------------------------------------------------------
00360161   1/2  ----------------------------------------------------------------------
00457981   1/2  ----------------------------------------------------------------------
00423421   1/2  ----------------------------------------------------------------------
00472761   1/2  ----------------------------------------------------------------------
00479921   1/2  ----------------------------------------------------------------------
00454811   1/2  ----------------------------------------------------------------------
00529641   1/2  ----------------------------------------------------------------------
00463441   1/2  ----------------------------------------------------------------------
00374371   1/2  ----------------------------------------------------------------------
00463571   1/2  ----------------------------------------------------------------------
00472781   1/2  ----------------------------------------------------------------------
00533831   1/2  ----------------------------------------------------------------------
00531721   1/2  ----------------------------------------------------------------------
00504432   2/2  ----------------------------------------------------------------------
00482271   1/2  ----------------------------------------------------------------------
00355351   1/2  ----------------------------------------------------------------------
00425341   1/2  ----------------------------------------------------------------------
00480271   1/2  ----------------------------------------------------------------------
00473461   1/2  ----------------------------------------------------------------------
00504431   1/2  ----------------------------------------------------------------------
00481021   1/2  ----------------------------------------------------------------------
00529642   2/2  ----------------------------------------------------------------------
00463572   2/2  ----------------------------------------------------------------------
00360162   2/2  ----------------------------------------------------------------------
00475101   1/2  ----------------------------------------------------------------------
00372751   1/2  ----------------------------------------------------------------------
00528371   1/2  ----------------------------------------------------------------------
00423401   1/2  ----------------------------------------------------------------------
00423661   1/2  ----------------------------------------------------------------------
00466731   1/2  ----------------------------------------------------------------------
00445592   2/2  ----------------------------------------------------------------------
00452431   1/2  ----------------------------------------------------------------------
00480351   1/2  ----------------------------------------------------------------------
00367851   1/2  ----------------------------------------------------------------------
00479922   2/2  ----------------------------------------------------------------------
00367461   1/2  ----------------------------------------------------------------------
00383791   1/1  ----------------------------------------------------------------------
00406511   1/2  ----------------------------------------------------------------------
00432761   1/2  ----------------------------------------------------------------------
00486871   1/2  ----------------------------------------------------------------------
00452432   2/2  ----------------------------------------------------------------------
00372752   2/2  ----------------------------------------------------------------------
00529632   2/2  ----------------------------------------------------------------------
00421801   1/2  ----------------------------------------------------------------------
00484141   1/2  ----------------------------------------------------------------------
00454812   2/2  ----------------------------------------------------------------------
00502691   1/2  ----------------------------------------------------------------------
00366641   1/2  ----------------------------------------------------------------------
00523132   2/2  le--------------------------------------------------------------------
00435071   1/2  ----------------------------------------------------------------------
00423402   2/2  ----------------------------------------------------------------------
00425342   2/2  ----------------------------------------------------------------------
00472782   2/2  ----------------------------------------------------------------------
00466732   2/2  ----------------------------------------------------------------------
00423422   2/2  ----------------------------------------------------------------------
00533832   2/2  ----------------------------------------------------------------------
00355352   2/2  ----------------------------------------------------------------------
00367462   2/2  ----------------------------------------------------------------------
00472762   2/2  ----------------------------------------------------------------------
00481022   2/2  ----------------------------------------------------------------------
00482272   2/2  ----------------------------------------------------------------------
00366642   2/2  ----------------------------------------------------------------------
00486872   2/2  ----------------------------------------------------------------------
00423662   2/2  ----------------------------------------------------------------------
00367852   2/2  ----------------------------------------------------------------------
00475102   2/2  ----------------------------------------------------------------------
00470682   2/2  ----------------------------------------------------------------------
00529112   2/2  ----------------------------------------------------------------------
00467502   2/2  ----------------------------------------------------------------------
00432762   2/2  ----------------------------------------------------------------------
00502692   2/2  ----------------------------------------------------------------------
00473462   2/2  ----------------------------------------------------------------------
00435072   2/2  ----------------------------------------------------------------------
00528372   2/2  ----------------------------------------------------------------------
00492222   2/2  ----------------------------------------------------------------------
00406512   2/2  ----------------------------------------------------------------------
00484142   2/2  ----------------------------------------------------------------------
00480352   2/2  ----------------------------------------------------------------------
00531722   2/2  ----------------------------------------------------------------------
00421802   2/2  ----------------------------------------------------------------------
00480272   2/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           SLAVQQRLTVDDVAHTFAVYPSLSGSVTEAARSLMQGFPE------------------------------
00374411   1/1  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00491501   1/1  ----------------------------------------------------------------------
00435771   1/1  ----------------------------------------------------------------------
00470291   1/1  ----------------------------------------------------------------------
00360921   1/1  ----------------------------------------------------------------------
00400491   1/1  ----------------------------------------------------------------------
00470221   1/1  ----------------------------------------------------------------------
00400351   1/1  ----------------------------------------------------------------------
00503631   1/1  ----------------------------------------------------------------------
00461281   1/1  ----------------------------------------------------------------------
00413411   1/1  ----------------------------------------------------------------------
00485831   1/1  ----------------------------------------------------------------------
00484941   1/1  ----------------------------------------------------------------------
00359891   1/1  ----------------------------------------------------------------------
00457971   1/1  ----------------------------------------------------------------------
00396641   1/1  ----------------------------------------------------------------------
00509271   1/1  ----------------------------------------------------------------------
00526001   1/1  ----------------------------------------------------------------------
00475641   1/1  ----------------------------------------------------------------------
00406601   1/1  ----------------------------------------------------------------------
00520321   1/1  ----------------------------------------------------------------------
00464461   1/1  ----------------------------------------------------------------------
00458701   1/1  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00462701   1/1  ----------------------------------------------------------------------
00470681   1/2  ----------------------------------------------------------------------
00458811   1/1  ----------------------------------------------------------------------
00483561   1/1  ----------------------------------------------------------------------
00533211   1/1  ----------------------------------------------------------------------
00490031   1/1  ----------------------------------------------------------------------
00499901   1/1  ----------------------------------------------------------------------
00406021   1/1  ----------------------------------------------------------------------
00471411   1/1  ----------------------------------------------------------------------
00492221   1/2  ----------------------------------------------------------------------
00472702   2/2  ----------------------------------------------------------------------
00483642   2/2  ----------------------------------------------------------------------
00476821   1/1  ----------------------------------------------------------------------
00363002   2/2  ----------------------------------------------------------------------
00509602   2/2  ----------------------------------------------------------------------
00364591   1/2  ----------------------------------------------------------------------
00481992   2/2  ----------------------------------------------------------------------
00488652   2/2  ----------------------------------------------------------------------
00444131   1/1  ----------------------------------------------------------------------
00465142   2/2  ----------------------------------------------------------------------
00501482   2/2  ----------------------------------------------------------------------
00467602   2/2  ----------------------------------------------------------------------
00465791   1/1  ----------------------------------------------------------------------
00467501   1/2  ----------------------------------------------------------------------
00509281   1/1  alaiklgltvedladtifahPtlsealveaalallg----------------------------------
00380742   2/2  ----------------------------------------------------------------------
00486071   1/2  ----------------------------------------------------------------------
00384501   1/1  iqelalaiklgltvedladtihahPtlsealveaal----------------------------------
00406901   1/1  alaielgltvedladtihahPtlsealveaalallgkllhl-----------------------------
00375101   1/1  lalaiklgltvedladtihahPtlsealveaalal-----------------------------------
00419411   1/1  elinelalaiklgltvedladtihahPtlse---------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00376432   2/2  ----------------------------------------------------------------------
00418871   1/1  alaiklgltvedladtihahPtlsealveaalaal-----------------------------------
00488071   1/1  ----------------------------------------------------------------------
00395041   1/1  alaiklgltvedladtihahPtlsealveaalaalgallhl-----------------------------
00455331   1/1  alaiklgltvedladtihahPtlsealveaalaalglllhlp----------------------------
00366551   1/1  alaiklgltvedladtihahPtlsealveaalaalglllhl-----------------------------
00406041   1/1  alaiklgltvedladtihahPtlsealveaalaalglllhlp----------------------------
00351301   1/1  lalaiklgltvedladtihahPtlsealveaalal-----------------------------------
00368901   1/1  alaiklgltvedladtifahPtlsealveallaal-----------------------------------
00410231   1/1  GahivGpgagelinelalaiklgltvddladtdlifahPt------------------------------
00455192   2/2  ----------------------------------------------------------------------
00471332   2/2  ----------------------------------------------------------------------
00382852   2/2  ----------------------------------------------------------------------
00380761   1/1  elalaiklgltvedladtihahPtlsealve---------------------------------------
00440982   2/2  ----------------------------------------------------------------------
00406882   2/2  ----------------------------------------------------------------------
00481991   1/2  ----------------------------------------------------------------------
00457982   2/2  ----------------------------------------------------------------------
00455201   1/1  elalaiklgltvedladtihahPtlsealve---------------------------------------
00464162   2/2  ----------------------------------------------------------------------
00455182   2/2  ----------------------------------------------------------------------
00485842   2/2  ----------------------------------------------------------------------
00481082   2/2  ----------------------------------------------------------------------
00533222   2/2  ----------------------------------------------------------------------
00480452   2/2  ----------------------------------------------------------------------
00475652   2/2  ----------------------------------------------------------------------
00529631   1/2  ----------------------------------------------------------------------
00523131   1/2  ----------------------------------------------------------------------
00488662   2/2  ----------------------------------------------------------------------
00480092   2/2  ----------------------------------------------------------------------
00406881   1/2  ----------------------------------------------------------------------
00384492   2/2  ----------------------------------------------------------------------
00419402   2/2  ----------------------------------------------------------------------
00469732   2/2  ----------------------------------------------------------------------
00366542   2/2  ----------------------------------------------------------------------
00469722   2/2  ----------------------------------------------------------------------
00413941   1/1  lalaiqagltvedLaltdlayhPtlsealdllalaalvalnk----------------------------
00529262   2/2  ----------------------------------------------------------------------
00374372   2/2  ----------------------------------------------------------------------
00380741   1/2  ----------------------------------------------------------------------
00368892   2/2  ----------------------------------------------------------------------
00482002   2/2  ----------------------------------------------------------------------
00467612   2/2  ----------------------------------------------------------------------
00463442   2/2  ----------------------------------------------------------------------
00384491   1/2  ----------------------------------------------------------------------
00464161   1/2  ----------------------------------------------------------------------
00509612   2/2  ----------------------------------------------------------------------
00465141   1/2  ----------------------------------------------------------------------
00487712   2/2  ----------------------------------------------------------------------
00479092   2/2  ----------------------------------------------------------------------
00529111   1/2  ----------------------------------------------------------------------
00483652   2/2  ----------------------------------------------------------------------
00368891   1/2  ----------------------------------------------------------------------
00503641   1/1  ----------------------------------------------------------------------
00455181   1/2  ----------------------------------------------------------------------
00472701   1/2  ----------------------------------------------------------------------
00488651   1/2  ----------------------------------------------------------------------
00469721   1/2  ----------------------------------------------------------------------
00469731   1/2  ----------------------------------------------------------------------
00376431   1/2  ----------------------------------------------------------------------
00363012   2/2  ----------------------------------------------------------------------
00440981   1/2  ----------------------------------------------------------------------
00471331   1/2  ----------------------------------------------------------------------
00482001   1/2  ----------------------------------------------------------------------
00485841   1/2  ----------------------------------------------------------------------
00480091   1/2  ----------------------------------------------------------------------
00533221   1/2  ----------------------------------------------------------------------
00496792   2/2  ----------------------------------------------------------------------
00488661   1/2  ----------------------------------------------------------------------
00447052   2/2  ----------------------------------------------------------------------
00480451   1/2  ----------------------------------------------------------------------
00455191   1/2  ----------------------------------------------------------------------
00363001   1/2  ----------------------------------------------------------------------
00501481   1/2  ----------------------------------------------------------------------
00467601   1/2  ----------------------------------------------------------------------
00424461   1/2  ----------------------------------------------------------------------
00366541   1/2  ----------------------------------------------------------------------
00509611   1/2  ----------------------------------------------------------------------
00483641   1/2  ----------------------------------------------------------------------
00509601   1/2  ----------------------------------------------------------------------
00467611   1/2  ----------------------------------------------------------------------
00475651   1/2  ----------------------------------------------------------------------
00529261   1/2  ----------------------------------------------------------------------
00468342   2/2  ----------------------------------------------------------------------
00364592   2/2  ----------------------------------------------------------------------
00424462   2/2  ----------------------------------------------------------------------
00479091   1/2  ----------------------------------------------------------------------
00472712   2/2  ----------------------------------------------------------------------
00468341   1/2  ----------------------------------------------------------------------
00483651   1/2  ----------------------------------------------------------------------
00447051   1/2  ----------------------------------------------------------------------
00477122   2/2  ----------------------------------------------------------------------
00496791   1/2  ----------------------------------------------------------------------
00457951   1/2  ----------------------------------------------------------------------
00460572   2/2  ----------------------------------------------------------------------
00384681   1/2  ----------------------------------------------------------------------
00460571   1/2  ----------------------------------------------------------------------
00472711   1/2  ----------------------------------------------------------------------
00363011   1/2  ----------------------------------------------------------------------
00477121   1/2  ----------------------------------------------------------------------
00487711   1/2  ----------------------------------------------------------------------
00406191   1/2  ----------------------------------------------------------------------
00486072   2/2  ----------------------------------------------------------------------
00406192   2/2  ----------------------------------------------------------------------
00384682   2/2  ----------------------------------------------------------------------
00419401   1/2  ----------------------------------------------------------------------
00457952   2/2  ----------------------------------------------------------------------
00481081   1/2  ----------------------------------------------------------------------
00382851   1/2  ----------------------------------------------------------------------
00445591   1/2  ----------------------------------------------------------------------
00360161   1/2  ----------------------------------------------------------------------
00457981   1/2  ----------------------------------------------------------------------
00423421   1/2  ----------------------------------------------------------------------
00472761   1/2  ----------------------------------------------------------------------
00479921   1/2  ----------------------------------------------------------------------
00454811   1/2  ----------------------------------------------------------------------
00529641   1/2  ----------------------------------------------------------------------
00463441   1/2  ----------------------------------------------------------------------
00374371   1/2  ----------------------------------------------------------------------
00463571   1/2  ----------------------------------------------------------------------
00472781   1/2  ----------------------------------------------------------------------
00533831   1/2  ----------------------------------------------------------------------
00531721   1/2  ----------------------------------------------------------------------
00504432   2/2  ----------------------------------------------------------------------
00482271   1/2  ----------------------------------------------------------------------
00355351   1/2  ----------------------------------------------------------------------
00425341   1/2  ----------------------------------------------------------------------
00480271   1/2  ----------------------------------------------------------------------
00473461   1/2  ----------------------------------------------------------------------
00504431   1/2  ----------------------------------------------------------------------
00481021   1/2  ----------------------------------------------------------------------
00529642   2/2  ----------------------------------------------------------------------
00463572   2/2  ----------------------------------------------------------------------
00360162   2/2  ----------------------------------------------------------------------
00475101   1/2  ----------------------------------------------------------------------
00372751   1/2  ----------------------------------------------------------------------
00528371   1/2  ----------------------------------------------------------------------
00423401   1/2  ----------------------------------------------------------------------
00423661   1/2  ----------------------------------------------------------------------
00466731   1/2  ----------------------------------------------------------------------
00445592   2/2  ----------------------------------------------------------------------
00452431   1/2  ----------------------------------------------------------------------
00480351   1/2  ----------------------------------------------------------------------
00367851   1/2  ----------------------------------------------------------------------
00479922   2/2  ----------------------------------------------------------------------
00367461   1/2  ----------------------------------------------------------------------
00383791   1/1  ----------------------------------------------------------------------
00406511   1/2  ----------------------------------------------------------------------
00432761   1/2  ----------------------------------------------------------------------
00486871   1/2  ----------------------------------------------------------------------
00452432   2/2  ----------------------------------------------------------------------
00372752   2/2  ----------------------------------------------------------------------
00529632   2/2  ----------------------------------------------------------------------
00421801   1/2  ----------------------------------------------------------------------
00484141   1/2  ----------------------------------------------------------------------
00454812   2/2  ----------------------------------------------------------------------
00502691   1/2  ----------------------------------------------------------------------
00366641   1/2  ----------------------------------------------------------------------
00523132   2/2  ----------------------------------------------------------------------
00435071   1/2  ----------------------------------------------------------------------
00423402   2/2  ----------------------------------------------------------------------
00425342   2/2  ----------------------------------------------------------------------
00472782   2/2  ----------------------------------------------------------------------
00466732   2/2  ----------------------------------------------------------------------
00423422   2/2  ----------------------------------------------------------------------
00533832   2/2  ----------------------------------------------------------------------
00355352   2/2  ----------------------------------------------------------------------
00367462   2/2  ----------------------------------------------------------------------
00472762   2/2  ----------------------------------------------------------------------
00481022   2/2  ----------------------------------------------------------------------
00482272   2/2  ----------------------------------------------------------------------
00366642   2/2  ----------------------------------------------------------------------
00486872   2/2  ----------------------------------------------------------------------
00423662   2/2  ----------------------------------------------------------------------
00367852   2/2  ----------------------------------------------------------------------
00475102   2/2  ----------------------------------------------------------------------
00470682   2/2  ----------------------------------------------------------------------
00529112   2/2  ----------------------------------------------------------------------
00467502   2/2  ----------------------------------------------------------------------
00432762   2/2  ----------------------------------------------------------------------
00502692   2/2  ----------------------------------------------------------------------
00473462   2/2  ----------------------------------------------------------------------
00435072   2/2  ----------------------------------------------------------------------
00528372   2/2  ----------------------------------------------------------------------
00492222   2/2  ----------------------------------------------------------------------
00406512   2/2  ----------------------------------------------------------------------
00484142   2/2  ----------------------------------------------------------------------
00480352   2/2  ----------------------------------------------------------------------
00531722   2/2  ----------------------------------------------------------------------
00421802   2/2  ----------------------------------------------------------------------
00480272   2/2  ----------------------------------------------------------------------