[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ56646.1


[Show Plain Result]

## Summary of Sequence Search
   1::169
  42::169  1.6e-45 60.6% 0037619 00376191 1/1   omal protein S5 domain 2-like           
   1::169


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVEPTGIEDVQEYDENSEEYPAEYTTETPETVGETYIPTAVGPSLGTGRRKTAVARVRVVPGTGEWKING
00376191   1/1  -----------------------------------------klvlgtgrrktavArvllvpgsgkilvng


                         -         -         *         -         -         -         -:140
query           KSLEEYFPNKVHQQLIKEPLATLGFEGAYDVFARLNGGGTSGQAGALRHGLARALAAMDPEHNRPPLKKA
00376191   1/1  rplelyfpllllrlkvlePllllgllgkldvlvtvkGGGlsgqagAirlaiaralvallp.elrlelkka


                         +         -         -         -         -         *         -:210
query           GFLTRDARKVERKKAGLKKARKAPQYSKR-----------------------------------------
00376191   1/1  glLtrDprvverkkyGlkkARkapqfskR-----------------------------------------