[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ56713.1


[Show Plain Result]

## Summary of Sequence Search
   1::248
   4::104  3.9e-16 30.0% 0037265 00372651 1/1   arrel domain                            
   6::109  2.8e-15 23.3% 0036658 00366581 1/1   arrel domain                            
   9::113  7.1e-06 17.5% 0042908 00429081 1/1   arrel domain                            
   3::57   2.1e-05 27.3% 0042374 00423741 1/1   arrel domain                            
   1::248


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAPRLGIQELIGHKLIDQDGHSVGKIGQVYRDDQTQEPTWVTVHTGMFGHQESFVPLVGAEVTEQDLRVP
00372651   1/1  ---lpvplpktfvldsggtlvvvsrveelillnlagtsaylGapllptgdpmldgvgpgalaprpdlpel
00366581   1/1  -----gdddlrGlpVvgadgekiGtVedllvDdeeglirylvvdtggw.gkkvllPlsalrvdtdrvvvl
00429081   1/1  --------dprGlevygadgekvGtikdlwvDraeglvrYlelelg..gdkkvllPlsllkidtdkvlvl
00423741   1/1  --qllraseligkeVittdgeklGkvkdlvidlesgkiaalvvslgglllflglggk-------------


                         -         -         *         -         -         -         -:140
query           FSKKMIKDSPRFETGGHLSPEQEAQLYEHYGVRPKVPGPRGDVEGVAEQERAQQKEETSMTVSEERARIG
00372651   1/1  dagghvkivplrvadnfsvligaddliGltVvgt------------------------------------
00366581   1/1  altkdqvknaPeydddlevsleeeekvyayYglgtlyat-------------------------------
00429081   1/1  gissdqfenvPglksddqvtlleeekilayygsgtlyatpdrk---------------------------
00423741   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           VERTESGHARVHKTVEREEFEQDVPVRREELRIEREPVTGEEQAAATDRIGEQDQEITLHEERAVVGKEE
00372651   1/1  ----------------------------------------------------------------------
00366581   1/1  ----------------------------------------------------------------------
00429081   1/1  ----------------------------------------------------------------------
00423741   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           VPVERVRISKEEVTDTERVKGELRKEHLEVEEEEEEGP--------------------------------
00372651   1/1  ----------------------------------------------------------------------
00366581   1/1  ----------------------------------------------------------------------
00429081   1/1  ----------------------------------------------------------------------
00423741   1/1  ----------------------------------------------------------------------