[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ56815.1


[Show Plain Result]

## Summary of Sequence Search
   1::390
   4::214  4.2e-51 31.8% 0045717 00457171 1/1   p containing nucleoside triphosphate hy 
  33::231  1.2e-34 35.0% 0052931 00529311 1/1   p containing nucleoside triphosphate hy 
   4::233    3e-32 25.1% 0047665 00476651 1/1   p containing nucleoside triphosphate hy 
   4::238  4.8e-26 24.1% 0049491 00494911 1/1   p containing nucleoside triphosphate hy 
   4::224  3.5e-25 28.4% 0043798 00437981 1/1   p containing nucleoside triphosphate hy 
   2::233  4.1e-24 25.0% 0047420 00474201 1/1   p containing nucleoside triphosphate hy 
   4::236  4.1e-23 30.5% 0043792 00437921 1/1   p containing nucleoside triphosphate hy 
   4::227  2.5e-21 28.6% 0043794 00437941 1/1   p containing nucleoside triphosphate hy 
   4::201  4.3e-19 25.7% 0040238 00402381 1/1   p containing nucleoside triphosphate hy 
   4::212    2e-18 27.6% 0049053 00490531 1/1   p containing nucleoside triphosphate hy 
   4::201  3.2e-18 24.2% 0043012 00430121 1/1   p containing nucleoside triphosphate hy 
   4::241  2.1e-17 24.9% 0038674 00386741 1/1   p containing nucleoside triphosphate hy 
   4::227  4.1e-17 25.7% 0047394 00473941 1/1   p containing nucleoside triphosphate hy 
   4::226  1.5e-15 25.6% 0043790 00437901 1/1   p containing nucleoside triphosphate hy 
   3::203  2.6e-13 21.9% 0046258 00462581 1/1   p containing nucleoside triphosphate hy 
   4::222  9.6e-13 26.2% 0041830 00418301 1/1   p containing nucleoside triphosphate hy 
   6::220  1.1e-12 24.1% 0041617 00416171 1/1   p containing nucleoside triphosphate hy 
   4::222  7.5e-12 22.2% 0052155 00521551 1/1   p containing nucleoside triphosphate hy 
   2::240  1.4e-11 26.9% 0036729 00367291 1/1   p containing nucleoside triphosphate hy 
   4::222  1.7e-11 23.3% 0040237 00402371 1/1   p containing nucleoside triphosphate hy 
   4::201  2.1e-11 26.0% 0036850 00368501 1/1   p containing nucleoside triphosphate hy 
   4::212  3.5e-11 24.1% 0037996 00379961 1/1   p containing nucleoside triphosphate hy 
   4::260  3.7e-11 24.2% 0039270 00392701 1/1   p containing nucleoside triphosphate hy 
   4::183  5.2e-11 24.8% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
   4::261  5.9e-11 21.1% 0042094 00420941 1/1   p containing nucleoside triphosphate hy 
   4::278  3.8e-10 26.0% 0040678 00406781 1/1   p containing nucleoside triphosphate hy 
   4::186  1.3e-09 26.0% 0047073 00470731 1/1   p containing nucleoside triphosphate hy 
   4::215  1.6e-09 24.9% 0037926 00379261 1/1   p containing nucleoside triphosphate hy 
   4::240  2.5e-09 21.7% 0044438 00444381 1/1   p containing nucleoside triphosphate hy 
  38::203  4.5e-09 23.9% 0047808 00478081 1/1   p containing nucleoside triphosphate hy 
  41::253  1.5e-07 19.8% 0042008 00420081 1/1   p containing nucleoside triphosphate hy 
   5::224  5.4e-07 23.3% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
  38::186    1e-06 25.4% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
  19::233  1.4e-06 20.3% 0039713 00397131 1/1   p containing nucleoside triphosphate hy 
   4::174  4.8e-06 27.6% 0048266 00482661 1/1   p containing nucleoside triphosphate hy 
  36::365  1.1e-05 20.8% 0047813 00478131 1/1   p containing nucleoside triphosphate hy 
   4::201  1.4e-05 17.6% 0049757 00497571 1/1   p containing nucleoside triphosphate hy 
   4::211  0.00011 25.4% 0040419 00404191 1/1   p containing nucleoside triphosphate hy 
   2::181  0.00074 20.4% 0046826 00468261 1/1   p containing nucleoside triphosphate hy 
  36::250  0.00076 22.0% 0049398 00493981 1/1   p containing nucleoside triphosphate hy 
  36::166   0.0009 19.0% 0048050 00480501 1/1   p containing nucleoside triphosphate hy 
  36::208  0.00099 20.4% 0047291 00472911 1/1   p containing nucleoside triphosphate hy 
   1::390


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSVFDTLVGQDTVVQRLRAAVRAADNLLSGGDGTGMTHAWLFTGPPGAGRAQAARAFAAALQCTHGGCGE
00457171   1/1  ---lddivgleeakelllealla.........g.rlphalLlyGppGtGKttlakalakellglnflsvs
00529311   1/1  --------------------------------edlklllrllagrllhalLlyGppGvGKttlaralaka
00476651   1/1  ---yeplveklrpvllddlvgqeeakealleala..........ggrpprpvllvGppGtGKTtlarala
00494911   1/1  ---llveklrpvllddlvgqeeakealleala...........agrpghvllvGppGtGKTtlaralane
00437981   1/1  ---lveklrpknldkvigqeealkdlslalk..........pgeiphalllvGppGsGKttlaralagll
00474201   1/1  -deelelleklslllveklrpvllddlvgqeeakeallealr...........agrpghvllvGppGtGK
00437921   1/1  ---lglllveklrpkllddvvgqeealerlllalk...........agklphlllvGppGvGKTtlaral
00437941   1/1  ---lddvygqeevlkalslale...........kgrpehlllvGppGtGKTtlakalaglllptsg....
00402381   1/1  ---Plsklleddlplllklrpdlfddvvgqdeaieallealrrarkglnl..glkprgnvlLvGppGtGK
00490531   1/1  ---tlpaleseardltekarpvllddviGqeeaierllealerg..........ppgn.vLlvGppGtGK
00430121   1/1  ---fddvvgqeeakeallealrrgrkglel..girpggnvllvGPpGvGKTtlakalagllfpsgvpfir
00386741   1/1  ---lddvvgqeeakeallealkavll......girpgehllLvGppGtGKTtlaralagelga.......
00473941   1/1  ---lddvvgqeevkkalllalalallrge......pgehvlLvGppGtGKTtlaralagllga.......
00437901   1/1  ---lddvvgqeeakeallealalararplkrpelflslgirpgrillLyGppGvGKTtlakalakel...
00462581   1/1  --edleslllnplvkfedivpkvlddleealealaea.klp...........ppkgvllyGppGtGKTtl
00418301   1/1  ---lddviGqeeakkallealalplkrlelfeklrgirpgknvlLvGppGtGKTtlaralakllgr....
00416171   1/1  -----diigqeeakkallealslaa.........rtgenvllvGppGtGKttlaralakllprsgvpfvr
00521551   1/1  ---lddvigqeeakeallealarlkapelflslglrpgkgvlLvGppGtGKTtlaralagll........
00367291   1/1  -vtlddvvgqeeakeallealelalkgldlflslg..lrpgrnvllyGppGtGKTtlaralanel.....
00402371   1/1  ---lddviGqeealeallealrr...........rpgrnvllvGppGvGKTtlaralagllvrssgpill
00368501   1/1  ---kerllllelrnvllddviGqeeakealsealelplkrpelfdglgvelpgknvlLvGppGvGKTtla
00379961   1/1  ---fddivGqeealralslalaag...........ppegvllvGppGtGKstlaralagllppdsgrivl
00392701   1/1  ---lddvvgqeeakeallealagarlaledlslgirpgknvlLvGppGvGKTtlaralagll........
00394721   1/1  ---lddvvgreealeallealrr...........gpprnvlLvGppGvGKTtlakalakelaag.sgpil
00420941   1/1  ---lrpvllddvigqeeakeallealalplkrldlglsl..girpgkgvllyGppGtGKTtlakalagel
00406781   1/1  ---lddvigqeeakeallealaglrlllkdlslgippgknvllvGppGtGKTtlakalagel....gvpf
00470731   1/1  ---arpltfddvvgqdeakeeleel.......lagllgikkpkvillvGppGsGKTTlaralakel....
00379261   1/1  ---drllleelrpvllddviGqeeakealsealrlplkrlelferlglrrpgknvlLvGppGvGKTtlar
00444381   1/1  ---asdelekllelrpvlledvigqeeakkalslalelp..lkrlelfgklddligrspairrllellga
00478081   1/1  -------------------------------------gkvivltGppGsGKtTlarlLaellkplgggvv
00420081   1/1  ----------------------------------------smkkglrIaleGpsGvGKTTlaklLarhlg
00503741   1/1  ----fifldlrplallplpdrlvgrdeeiealskalgg...aldgvslsiepggivllvGppGvGKTtLa
00512891   1/1  -------------------------------------evilltGppGvGKTTlakalagelgakfgsvsl
00397131   1/1  ------------------pmmlyvlqliella.kslapvylllGeegtgkeelaraih............
00482661   1/1  ---kkvaivllsnyalsislddlllildlykevqvaydnfykvdesdiayqyallakedenaaaflksnr
00478131   1/1  -----------------------------------kgkvivltGppGsGKtTlarlLaellkplglgvvv
00497571   1/1  ---aselvqwlldlgildeseilledlenalalllsligaklvkdllllvlkylpsllslldvlrpkvdf
00404191   1/1  ---lddlvgleelkealkealell......slgikpgeivllyGppGtGKTtlakalanelkkr.ggrvl
00468261   1/1  -sahvelterlrpvllstivgredqieellellfgglhrgdrl.........iglvliyGpagsGKttil
00493981   1/1  -----------------------------------kpklilltGppGsGKttlaraLaeelglpf...id
00480501   1/1  -----------------------------------MgklillvGppGsGKtTlaralaellggvvvidgd
00472911   1/1  -----------------------------------mkmkkgklilltGppGsGKtTlaraLaellgapfi


                         -         -         *         -         -         -         -:140
query           CASCHQVLAGTHPDVLYVRPSGLSFGVEQTRELVVRAASSPTGGRFRVVLFEDADRATEAASNALLKAIE
00457171   1/1  lselcskcvgeseglhpdlfllapenspsiifideidallekrsltpleggrkvviideadrlteeaana
00529311   1/1  llcefielnpclecnsc.................asligiddirelieflslspllgkrkvliideadrl
00476651   1/1  nelgrpfvpvallcfvrvncaallelsasdlleselfge.ekeaflgallerlgklalagggtvlflDEi
00494911   1/1  llrlgvlglpfvrvnasellealllsdlfgell......gallralfellrgalelakggvlflDEidrl
00437981   1/1  gpdsgkilldgkdirrgiglvfqliglfphltvlelvalglggilveevrellkellsgGqkqrvaiara
00474201   1/1  Ttlaralanelprslpgl...............pfvrvnasdltd.vglleellgkllgaatfllakpgv
00437921   1/1  arlllgs...............gggvdvieldasdl.rgvddlreligevlqalglllggkpdvlllDEi
00437941   1/1  gvrvlgidaselld.....psels.ggerqrvliarall....adpkvlllDEidaldpeaqnaLlklle
00402381   1/1  Ttlaralakal....gvpfvrinlselteallvsdliGhldg.yvgededgiltgalrkap....ggvlf
00490531   1/1  Ttlaralakelargd........vpevlvg..vpvieinassllfGskyvgefeealrrlfgeaekangg
00430121   1/1  i.nlseltekllvselighppg.yvGedelgvlfeaarkap....psvlllDEidkldpdvlnaLlqlle
00386741   1/1  .............pfvrldaselsg.geklrgllarala.....kpgvlllDEidaldpdvqeallelle
00473941   1/1  .............pfielsasdllg.esdlrggfkqa......akpgvlflDEidrldrevqnaLlelle
00437901   1/1  .................gapvieidaselrdvddlsgyvgelsggeklrellaealteavlkgkpsvlll
00462581   1/1  aralakel....................glpfvrinasdllvgllvgelegrlrglfteavlanpgvlfl
00418301   1/1  ................pfirvdaselteaelvGyesgarlrelfaragigllaladpg....vlflDEid
00416171   1/1  vncsaltedlleselfghekgafgggekqrlgllrla.......dggvlflDEidkldpdvqnaLlrvle
00521551   1/1  ............gapfvrlsaselvgkyvgelegglrqllalaraa....npgvlflDEidklapkrspt
00367291   1/1  ...............gapfirvdaselleklvgegegrlrgalaealradp.....gvlflDEidalagk
00402371   1/1  dgvpfvrldaselle.......fgkyvgafegglrqllglaraa......kpgvlflDEidsllgarggs
00368501   1/1  ralakllga.pfiridgseltekdyvGesvearlrelfeeaigyvfqdpalfpgtvlenlalgllvseli
00379961   1/1  vgnlsdlldpkdlrellragiplvflnfaal.pasllesellsggerqrvalaralalrpGllvlAdggv
00392701   1/1  ............gapfgrvdasdllgkyvgelsgglrqrlarallakps....vlllDEidklapkrspt
00394721   1/1  ldgvpvvrldlsellsvsdlvgeleggl..rgllteala...lakpsvlflDEidrlldardsesslevl
00420941   1/1  ....gapfiridgsellg........kyvgelsgglrqllalara.......akpsilllDEidklapkr
00406781   1/1  vrisa........sellgkyvgelsgglrqrlalara.......adpgvlllDEidalldarsgsgsggd
00470731   1/1  .gagfilidgddlrekavgeleklgrdlfqvaregglvpdilfideidallrkgpd.vildgag.rtpeq
00379261   1/1  alAkll....gapfvevdaselteggyvgedlekrirelfqearllvfltvlenirldaseylekrvvsr
00444381   1/1  rpgenvlLvGppGtGKTtlakalakll....gvpfiridgselte...kelvGesegailsggfkqrvgi
00478081   1/1  vidtddlrreairelllgldlleilfeglllsdef.relleealalladg..dvvilDgfgrlldarqll
00420081   1/1  ptggrvllvgEPiaywrsvggsdlleliyqlplrldlgeislddaallllslqllfaapylslnevidaa
00503741   1/1  kllagllkpkfgeillfgkvvyvnvselldlkellrlllealglpppyqlsggerlrvalaeal..lalg
00512891   1/1  tgrdv.......rsarrgigyvfqtveellgllaelvglevrgeleellktlikelsggekqrvalaral
00397131   1/1  .......caaipeglleselfgve.kgadtgallekagllslfadggtlfldeigelpglelqkaLlrll
00482661   1/1  qkklvrdladrviaeerlellekiieellrirldklledldeiveelppvlfddlvgqeeakeallenlk
00478131   1/1  idgddlrreavgqlglglsieeldeal.llpdalrralleealealkag..dvvildgfgrslaarq.ll
00497571   1/1  ddii.leeakeelllellelplklpelfkrlglkapkrrgvlLyGppGtGKTllakalakelgrl.....
00404191   1/1  yvsadelvsk............lsgglqeqrvaiafalark.....pdllllDEidalgldpelqeelle
00468261   1/1  rllakllsenngvpvflinlgeltktaillklllsalgfkkkslagtidalrklltealgk.........
00493981   1/1  addllrelvgegigllfelaeraeflillidei.dkllee......gkvvildgtplllealrellreld
00480501   1/1  dlrralvggl..idgllilfledeaalselvlevllealegg..gnpdvvildgt.nlleedrellrell
00472911   1/1  sgddllrglageggkplgllfedaleagf.rqrladlirallakg.....kvvild.gtglsreareell


                         +         -         -         -         -         *         -:210
query           EPAPRTVWLLCTPTAHDLLVTIRSRCRLVNLRTPSTEAIIDALVTRDGIDRDRAVAAARAAAGHLERARQ
00457171   1/1  LlktleeppsnvlvilttnrperldpallsRcrvielplpdeeerleiLleklpldddvlealaeltegs
00529311   1/1  nkeaqnaLLktLEeppgntifilatnnpskllptilSRcqvfrlkpl..eeileilkrilekenieldde
00476651   1/1  dkldpdvqnaLlrlleeppsnvrvilttnrpekldpallsRflvielpppsleerleilkllleklglpl
00494911   1/1  spdvqnaLlrlleelpsnvrviattnrpelldpallsRflvielpppsleerleilkllleklglelsde
00437981   1/1  lagdpkvlllDEptaldpdaqnaLlklleelakgvtvilathdlsellpallsrcqvirfpplseeelle
00474201   1/1  lflDEidkldpdvqnaLlrlleelpsnvrviattnrpleldpallsRflvielpppdleerleilkllle
00437921   1/1  drldpdaqnallklleelpagvtlilttnrleellpallsrfdiiefkplseeelleilkrileeegvkl
00437941   1/1  elpkgvtvilttnrleeldpallsRfdviefpppdeeelleilklilkkeglklddealellaelsggsp
00402381   1/1  lDEidkldpdvlnaLlqvleegeltdlggrivdlpnvrviaatnpgleelvklllgflael---------
00490531   1/1  viLflDEidklagargsggspdvqnaLlrlle...rgnvrvIaatnrpellkfeldpallrRflvielpp
00430121   1/1  egevtdlggrvvdlsnviviattnpglegivellldllllgrlrelvedelrdrldpallr---------
00386741   1/1  egeltivgggllteldglllpsgvlviattnrpelldpallsRfdlvielpppdeeerleilkrllkkeg
00473941   1/1  elqvtilggglvvvelllllpsgvlviaatnrpelldpallsRfdlvielpppdleerleilkrllkkeg
00437901   1/1  DEidaldpdvlnallklldglrdlsgvliilttndpeeldpallrRfdiiefpppdeeelleilkrilek
00462581   1/1  DEidrlplkrqaggdllrallealltlldglislpsnvrviaatnrpeeldpasllrRfdvii-------
00418301   1/1  kllpargssggdvsredvlnaLlrlleegeltilgggvdlpnvlviaatnpdlyrpdeldpallrRfdlv
00416171   1/1  egeltrlgggivlpadvrliaatnpdllelvlegelrpaLldRfdvieldlpsleerleilelllelllk
00521551   1/1  sglddvsrrrvlnaLlrllegledlsnvlviaatnrpeeldpallrpgRfdlvielplpdleerleil..
00367291   1/1  rgsgtsrldpevqnaLlrlleelrvlsgvlviattnrpeeldpallrpgRfdlvielplpdleerleilk
00402371   1/1  gvdpevqnaLlrlleeg..nvrviaatnrpelvklgeldpallrRfdvielplpdleerleilklllekl
00368501   1/1  gappgyvggdlggllteavlealriklvegelgfrelerevlldlplhdasviallgggre---------
00379961   1/1  lllDEpdaldpevqaaLlrlleegevtieragitlllpagvtviaatnddlgeldpalldRfdlvielgp
00392701   1/1  sgldvelrrrvlnaLlrlleglrllsgvtviattnrpeeldpallrpgrfdriieldlpdleerleil..
00394721   1/1  naLlrlledg..nvlviattnrpellgrleldpallrrfdvie---------------------------
00420941   1/1  sptsaldadvrrevlnaLlrlldglqalsnvtviattnrpeeldpallrpgRfdlviefplpdeeerlei
00406781   1/1  sssrrvlnaLlrlleelrllsgvtviattndleeldpallrpgrfdrvielplpdleerleil.......
00470731   1/1  lealldlleelgrpvvviilttnrevlldralrRpgrllldepeld------------------------
00379261   1/1  ligappgyvgyglggllteavrrlpysvllldelekahrpirvlllsaslvlllgglglpevgelllell
00444381   1/1  a..lladpg.....ilflDEidkllddrgeaegggdvsregvqnaLlrlleegellitggggrikvfsnv
00478081   1/1  eelllllleepppdlvifl.dadpevlleRllkRgrrerk..ddseevlellekrleryepll-------
00420081   1/1  rvlladefikplpagykvviiDRhplsallvFplarylggdlslealnallktleelpppdlivlldasp
00503741   1/1  kpdllilDEitnlldpetlspdvlelLlrlleegkltdkllgltliltthdldllerladrllsrfngkg
00512891   1/1  lakpdvlllDEidgldpdvleallelleelkrsgvtvilttndlde------------------------
00397131   1/1  eelpvdvrlilatnrldklveagkfrkdlyyrlvvvplklpplrerpewikllaklfgleldddalelLa
00482661   1/1  lflkgpellldlglpkgrg..llLyGPpGtGKTt------------------------------------
00478131   1/1  lellrelgrvvkpdlvifldappevlleRllkRg....................................
00497571   1/1  pfirvn.......................nlrdlfelar......dpgilflDE.dklapd---------
00404191   1/1  lldelaergvtlilttnnrpeeldqallrllsrldrvivldlppdleergeilkrlaeklglplsdevle
00468261   1/1  tdrptvlvlddidlldnevlaaLldllddlseidcsgisfi-----------------------------
00493981   1/1  ...........................lvvfldappeellerllkR....pgrfdrrilipeeilerlle
00480501   1/1  krlgrpdlvifldapleellerllkr--------------------------------------------
00472911   1/1  ellkelg.pvlvifldadpevlleRllkr.....grallreevldrllevrepyelleeadlvidtsg--


                         -         -         -         +         -         -         -:280
query           LATDETARARREEVLTIPARLDSLGACVHAAARLYEIAEADAKESTAALDEQEKADLKAAFGEGATGKGV
00457171   1/1  pgda------------------------------------------------------------------
00529311   1/1  alellarlsdgdlrdalllll-------------------------------------------------
00476651   1/1  sdealealaelsggnprellnll-----------------------------------------------
00494911   1/1  alealaelspgnprellnlleraallal------------------------------------------
00437981   1/1  ildrilvleggklv--------------------------------------------------------
00474201   1/1  klglelsdealealaelspgnpr-----------------------------------------------
00437921   1/1  sdealealaelsggdpraalnllera--------------------------------------------
00437941   1/1  rdalnlldraavlaagr-----------------------------------------------------
00402381   1/1  ----------------------------------------------------------------------
00490531   1/1  pd--------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00386741   1/1  lelddealealaelaegsprdllnlleraaa---------------------------------------
00473941   1/1  velddealellaelagg-----------------------------------------------------
00437901   1/1  eglklddealealael------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00418301   1/1  ielplpdleerl----------------------------------------------------------
00416171   1/1  rlaarlgleg------------------------------------------------------------
00521551   1/1  ............----------------------------------------------------------
00367291   1/1  llleklglssdealealaeltegfsarell----------------------------------------
00402371   1/1  lkrlglelsdea----------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00379961   1/1  lr--------------------------------------------------------------------
00392701   1/1  ................kllleklgleldddalellaeteggsardllnll--------------------
00394721   1/1  ----------------------------------------------------------------------
00420941   1/1  lkllleklglesdealealaeltegfsgrdlrnlldraaalallegrevit-------------------
00406781   1/1  ...........kllleklgle.sdealealae..ltegfsardlrnlleralalalle.........g--
00470731   1/1  ----------------------------------------------------------------------
00379261   1/1  ddvgl-----------------------------------------------------------------
00444381   1/1  tviaatnrlfigggaflgleelverllgln----------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00420081   1/1  eellkRirkRgrpge.vidleylealrnvYealvntvrylnke---------------------------
00503741   1/1  ivielpplseeell--------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00397131   1/1  sywegNlraleneleklallapd-----------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00478131   1/1  ......................................................................
00497571   1/1  ----------------------------------------------------------------------
00404191   1/1  l---------------------------------------------------------------------
00468261   1/1  ----------------------------------------------------------------------
00493981   1/1  ilerllaplleaadlvidtsg.sleevveeilelldelll------------------------------
00480501   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           AKAVRGAAGALKELEERQKRRATRIKRDAYDTFLMDLVAFYRDVLAIQLGASVELSTADRDADLRRVARS
00457171   1/1  ----------------------------------------------------------------------
00529311   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00402381   1/1  ----------------------------------------------------------------------
00490531   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00397131   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00478131   1/1  ..................................rgseddieeelleallrilepylrllael...pera
00497571   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00468261   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           STPEATLRRIDAIMECRRRINANVHPQIAMEAMTAALYLG------------------------------
00457171   1/1  ----------------------------------------------------------------------
00529311   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00402381   1/1  ----------------------------------------------------------------------
00490531   1/1  ----------------------------------------------------------------------
00430121   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00368501   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00397131   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00478131   1/1  dlviinadlsleevv-------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00468261   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------