[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tfus0:AAZ57003.1


[Show Plain Result]

## Summary of Sequence Search
   1::792
   1::375  2.9e-68 33.2% 0040412 00404121 1/1   in diphosphate-binding fold (THDP-bindi 
  35::385  1.3e-56 26.4% 0049136 00491361 1/1   in diphosphate-binding fold (THDP-bindi 
  32::430  4.1e-51 28.5% 0044101 00441011 1/1   in diphosphate-binding fold (THDP-bindi 
  43::382  3.7e-49 28.2% 0036596 00365961 1/1   in diphosphate-binding fold (THDP-bindi 
  29::352  6.3e-41 27.8% 0039197 00391971 1/1   in diphosphate-binding fold (THDP-bindi 
  53::345  2.2e-32 27.8% 0049028 00490281 1/1   in diphosphate-binding fold (THDP-bindi 
 381::595  1.7e-26 19.6% 0044102 00441021 1/1   in diphosphate-binding fold (THDP-bindi 
  94::302  4.6e-21 27.3% 0042045 00420451 1/1   in diphosphate-binding fold (THDP-bindi 
  53::246    3e-18 29.1% 0048897 00488971 1/1   in diphosphate-binding fold (THDP-bindi 
  34::336  1.6e-16 26.8% 0042762 00427621 1/2   in diphosphate-binding fold (THDP-bindi 
  18::254    1e-11 26.3% 0050394 00503941 1/1   in diphosphate-binding fold (THDP-bindi 
 598::746  1.7e-11 22.2% 0039199 00391991 1/1   terminal domain-like                    
  18::254  7.3e-06 20.5% 0041402 00414021 1/1   in diphosphate-binding fold (THDP-bindi 
  88::254  8.7e-06 24.8% 0044439 00444391 1/1   in diphosphate-binding fold (THDP-bindi 
 150::246  5.5e-05 34.1% 0051271 00512711 1/1   in diphosphate-binding fold (THDP-bindi 
  94::255  0.00047 23.4% 0042488 00424881 1/1   in diphosphate-binding fold (THDP-bindi 
 150::178  0.00091 55.2% 0052450 00524501 1/1   in diphosphate-binding fold (THDP-bindi 
 150::180  0.00092 54.8% 0042411 00424111 1/1   in diphosphate-binding fold (THDP-bindi 
 695::785      7.8 21.1% 0042762 00427622 2/2   in diphosphate-binding fold (THDP-bindi 
   1::792


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTSTESVPRQALTVTELQEIDRYWRAANYLSVGQIYLQDNPLLREPLVPEHIKPRLLGHWGTTPGLNFIY
00404121   1/1  ltpllntipspadllslsdlelldrlanairylaldmvl...........kanhvklglgGHpgsslgaa
00491361   1/1  ----------------------------------LlelyrlalliRrlaldavklangGhlgsflglael
00441011   1/1  -------------------------------edllelyrlalliRrlaldavslangGhlglylglaela
00365961   1/1  ------------------------------------------alrrllidallkavsghpghllglagiv
00391971   1/1  ----------------------------kldllqlyrlanliRrlald..avslangGhpgsplgaagle
00490281   1/1  ----------------------------------------------------relvpldlylglteadld
00441021   1/1  ----------------------------------------------------------------------
00420451   1/1  ----------------------------------------------------------------------
00488971   1/1  ----------------------------------------------------rpgllghlglglgpeavl
00427621   1/2  ---------------------------------eelyrlalliRrlaldavelan.gGhlggslgaaelf
00503941   1/1  -----------------reildllektycgsigvelmhildllgriwlpedleklskeellelyrlmlla
00391991   1/1  ----------------------------------------------------------------------
00414021   1/1  -----------------gvveltvelirvldldgllwlksgheg...lsldvllqlyrhmlltrrfeefl
00444391   1/1  ----------------------------------------------------------------------
00512711   1/1  ----------------------------------------------------------------------
00424881   1/1  ----------------------------------------------------------------------
00524501   1/1  ----------------------------------------------------------------------
00424111   1/1  ----------------------------------------------------------------------
00427622   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           AHLNHQIRSRGTEMMWIVGPGHGGPSPVATAWLDGVYSQIYPDVGRNAEGMRRLFRQFSFPGGVPSHAAP
00404121   1/1  ellavlfrvflrydpwlnrdrfvlskGHgspllYallyltGrlse.........edLkn.frqlsfgsgl
00491361   1/1  lvalyrgfeavdvgspaaldrddfvlsvGHgsyrlyalllltG........rdlsleellgfrqlgglsg
00441011   1/1  aalfavlrydpdnilwtyrdrfvlsaGhgspllyallyltGrdl............sledlktfrqlgsg
00365961   1/1  evlfalhlvfdppnpdwlsrdvllqlyrhmlltrrfeefltllqrqgkigrfvlsaGhealalyaalalr
00391971   1/1  avlvgvflaldpddpvwpnrdrfvlsvghgspllyallyltGrl.......dlsledlktfrqlgsglsg
00490281   1/1  refdlggllglelltlreilallkktycgsigveymhildlegrwllerleslspeellellrlmllira
00441021   1/1  ----------------------------------------------------------------------
00420451   1/1  -----------------------dgdpltpayvlkalsellpddaivvtdvglsqfwarylrfpg.....
00488971   1/1  valaaalpedd.....ivvsdvgchqrwaarlltgrg................................p
00427621   1/2  valyagfeavnvgapaalnrd..dfvlsvghgspllyahllltGrd............lsaellgnfrql
00503941   1/1  releellldlvrqgkighlgsslGqealavllaaalr....prdrivl.gHrghllyl...llgl.....
00391991   1/1  ----------------------------------------------------------------------
00414021   1/1  tllqpggkirgf...filseGhealavglalalr...gedvlgmayRgrlnvlalgvplkeilaellglr
00444391   1/1  -----------------aysghlgaelgvvllt.lhlvfdpprpelsdeellqlyrhmlltrrfeeflll
00512711   1/1  ----------------------------------------------------------------------
00424881   1/1  -----------------------lggplgpaevlralaellpddaivvtdvGtsqfwaarll........
00524501   1/1  ----------------------------------------------------------------------
00424111   1/1  ----------------------------------------------------------------------
00427622   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ETPGSIHEGGELGYALAHAFGAAFDNPDLVVAAVVGDGEAETGALSGSWQSIRFLNPARDGAVLPILHLN
00404121   1/1  pghpepglmtpgvefttGslGqglsaAvGmAlalkylgarfnkdivdrrvyaliGDGeldeGv...swea
00491361   1/1  ghpes..ghtpgvefttgplGtglpvAvGaAlalkllgelfnrglldlvdrvvvaliGDGalseGv...v
00441011   1/1  lpghpepetpgvefttGplGqglsaAvGaAlalkllgalfnrglldlpdrvvvafiGDGalseGv...sh
00365961   1/1  gydvifptYRdhglllalgvdllkifrelggklpghpeggggsmhlgsetpgvepttgplGtglpaAvGa
00391971   1/1  hper..getpgvefttGplGqglpaAvGaAlaakllgalfnrplldlpdrvvvaliGDGalneGv...sl
00490281   1/1  lelrlvllagsgrgghllslagqeallvalalalnpedpvigdhRdrlvllghgspllyaflelrg....
00441021   1/1  ----------------------------------------------------------------------
00420451   1/1  ..prtfltsgglgtmGyglpaAlGaalanpdrrvvaivGDGsf.......gmtlqelataaryglpviiv
00488971   1/1  rtllnsg.lgsmGyglpaAlGaalaapdrrvvaviGDGsflmg.....leelntaarynlpvvivvlnNg
00427621   1/2  gsglpghphrgetpgvefttgplGqglslAvGmAlaakllgalfnrplldlvdrvvvafiGDGalseGv.
00503941   1/1  ........dllkifrelggk..sgghpvsehlgvlfntghlgtglpvAvGmAlAlkllgkdvvvvaliGD
00391991   1/1  ----------------------------------------------------------------------
00414021   1/1  tglskgggvpmhlgsp..gllgntghlgtglpvAvGaalAakllgkdrvvvaliGDGalseGvvhEalnl
00444391   1/1  lqrqgkrgffvlsaGhealavgaalalrggedvigmayRgrlnvlalgvplleifaellgklpghpgggd
00512711   1/1  ---------gtmGyglpaAlGaalalpdrrvvaviGDGsflmg.leelntaary.....nlpvlivvlnN
00424881   1/1  ...lpkprslltsgglgsmGyglpaAlGaalalkllgpdrrvvalvGDGsf..gmtlqelataarygl..
00524501   1/1  ---------gtmGyglpaAlGaklanpdrrvvaivGDG--------------------------------
00424111   1/1  ---------gtmGyglpaAlGaalanpdrrVvaivGDGsf------------------------------
00427622   2/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GYKIAGPTVLARIPEEDLLAQMRGHGYEPHVVAGDDPDTVHQLMAGTLASCLERIDTIRFRARQEDGDIA
00404121   1/1  lslaghlkldnlivilddNgisidgpvglalklledlekrfeaygwnvirviwgslwdallagddlglll
00491361   1/1  weAlnlagllklpnlifivdnNgysisgpv..sralsedladrfeayGwpvirvidGnlDveavyaalke
00441011   1/1  ealnlaghlklgnlifildnNgysisgpvglas..ledlakrfeayGwnvirviwdGhdveavyaalkea
00365961   1/1  AlAaklagpdrvvvaliGDGalseGmvhEalnlagllk.......lpvlfvvenNgyaistptglatas.
00391971   1/1  ealnlAghlkldnlivivdnNgysidgpvglql..ledlakrfeayGwnvirvdGhsldveavyaalkea
00490281   1/1  ..............kledlsggrdgsyhpghpelgvefttghlgtglpvAvGmalalkllgpdrvvvavi
00441021   1/1  ----------------------------------------------------------------------
00420451   1/1  vlnNggygitrqqqsltypgndlpnpdfaklaeafGakyvalgirvetpd.................ele
00488971   1/1  gygitrglqeltggeglsgtdlpnpdfaklaeafGa----------------------------------
00427621   1/2  ..fhEalnlAgvlkldnlifvvdnNgysisgpvggqt..ledlaarfeayGwnvirvvdGhDvlavyaal
00503941   1/1  GalseGvvhEAlnlAgllkl...pvlfvved.Ngigistpvgrs--------------------------
00391991   1/1  ----------------------------------------------------------------------
00414021   1/1  aalykl...pvlfvvvn.Nqigistpve..rssayptl.laeaf--------------------------
00444391   1/1  vkmhlgseslgvlfntghlgtglpvAvGaAlAakllgkdrvvva--------------------------
00512711   1/1  ggygitgglqslttgygysgttlptgllllgllpdf----------------------------------
00424881   1/1  .pviivvlnNggygiirqlqeltyg.grdlpnpdfaklaeafGak-------------------------
00524501   1/1  ----------------------------------------------------------------------
00424111   1/1  ----------------------------------------------------------------------
00427622   2/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           NVRWPMIILRTPKGWTGPRAVDGKPVEDTWRSHQVPLAATRENPEHLRLLEEWLRSYRPEELFDEHGAPR
00404121   1/1  qlmaetldgayqllkalkgayvrellfeelgelkelvedlsdeliyllprdGhdleaiyaalkeakes..
00491361   1/1  aler.....................gggPvlieaktyrgk.......ghseeddpkahrvpldkeeieal
00441011   1/1  ker....................gggPtlIeakTykgk.......ghsleddakaHgvylg.....keev
00365961   1/1  edlaaraeayGipgirVdGndvealyaalkealerar.................sgggPvlIevvtyrgk
00391971   1/1  ker....................gdgPtlieakTykgkghp......paegttkaHgvyl.....gkeev
00490281   1/1  GDGalseGvvhEAlnlagllk.......lpvlivvvdNgigistpvdlrssayedlaarfeayGi-----
00441021   1/1  ----------------------------------------------------------------------
00420451   1/1  ealkeala......adgpvlie------------------------------------------------
00488971   1/1  ----------------------------------------------------------------------
00427621   1/2  keaker....................gggPtlIeakTykgkglpla......egtl--------------
00503941   1/1  ----------------------------------------------------------------------
00391991   1/1  ----------------------------------------------------------------------
00414021   1/1  ----------------------------------------------------------------------
00444391   1/1  ----------------------------------------------------------------------
00512711   1/1  ----------------------------------------------------------------------
00424881   1/1  ----------------------------------------------------------------------
00524501   1/1  ----------------------------------------------------------------------
00424111   1/1  ----------------------------------------------------------------------
00427622   2/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           PETTTVVPPPDCRISSSPHANGGLLLRDLLLPDFRDYAVEVERPGVDMVEATRVLGGFLRDVVAANPHNF
00404121   1/1  ...kgkPtlIiakTvkgkglp....---------------------------------------------
00491361   1/1  rerdpllr.laeflipeglldeaeelkeivaeaaa-----------------------------------
00441011   1/1  ealrkrl.glppedlflvpddpiarlraylleegl...................................
00365961   1/1  ghstaddpskyhgkpevdeerahrdpilrlrk--------------------------------------
00391971   1/1  ea--------------------------------------------------------------------
00490281   1/1  ----------------------------------------------------------------------
00441021   1/1  ------------------------------lPdlwhavlpfdlatgkkvatrkafgkaLaalakldp.rl
00420451   1/1  ----------------------------------------------------------------------
00488971   1/1  ----------------------------------------------------------------------
00427621   1/2  ----------------------------------------------------------------------
00503941   1/1  ----------------------------------------------------------------------
00391991   1/1  ----------------------------------------------------------------------
00414021   1/1  ----------------------------------------------------------------------
00444391   1/1  ----------------------------------------------------------------------
00512711   1/1  ----------------------------------------------------------------------
00424881   1/1  ----------------------------------------------------------------------
00524501   1/1  ----------------------------------------------------------------------
00424111   1/1  ----------------------------------------------------------------------
00427622   2/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           RIMGPDETQSNRLGAVFESTDRAWTTERLPVDQQLSPDGRVMEVLNEQLCQGWLEGYLLTGRHGLFNSYE
00404121   1/1  ----------------------------------------------------------------------
00491361   1/1  ----------------------------------------------------------------------
00441011   1/1  ..lteeelge------------------------------------------------------------
00365961   1/1  ----------------------------------------------------------------------
00391971   1/1  ----------------------------------------------------------------------
00490281   1/1  ----------------------------------------------------------------------
00441021   1/1  vgisaDltgstlt......llkllvdikgldlfaeafpgryidvgiaEqamvaiaaGlalhGgrliPfva
00420451   1/1  ----------------------------------------------------------------------
00488971   1/1  ----------------------------------------------------------------------
00427621   1/2  ----------------------------------------------------------------------
00503941   1/1  ----------------------------------------------------------------------
00391991   1/1  ----------------------------------------------------------------------
00414021   1/1  ----------------------------------------------------------------------
00444391   1/1  ----------------------------------------------------------------------
00512711   1/1  ----------------------------------------------------------------------
00424881   1/1  ----------------------------------------------------------------------
00524501   1/1  ----------------------------------------------------------------------
00424111   1/1  ----------------------------------------------------------------------
00427622   2/2  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           AFIHIVDSMVNQHAKWLKVSRELPWRRPISSLNYLLSSHVWRQDHNGFSHQDPGFIDHVVNKKPEIIRVY
00404121   1/1  ----------------------------------------------------------------------
00491361   1/1  ----------------------------------------------------------------------
00441011   1/1  ----------------------------------------------------------------------
00365961   1/1  ----------------------------------------------------------------------
00391971   1/1  ----------------------------------------------------------------------
00490281   1/1  ----------------------------------------------------------------------
00441021   1/1  tyltF...ldraydqi..rlaalqnlp.......vilvlthdgigvgedGpTHqgiedlallraipn..l
00420451   1/1  ----------------------------------------------------------------------
00488971   1/1  ----------------------------------------------------------------------
00427621   1/2  ----------------------------------------------------------------------
00503941   1/1  ----------------------------------------------------------------------
00391991   1/1  ----------------------------------------------------------------------
00414021   1/1  ----------------------------------------------------------------------
00444391   1/1  ----------------------------------------------------------------------
00512711   1/1  ----------------------------------------------------------------------
00424881   1/1  ----------------------------------------------------------------------
00524501   1/1  ----------------------------------------------------------------------
00424111   1/1  ----------------------------------------------------------------------
00427622   2/2  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           LPPDCNTLLCTMDHCLRSRNFINVVIAGKQPQLTYLPMEAAIAHCTRGAGIWEWASSDEGAEPDVVLACA
00404121   1/1  ----------------------------------------------------------------------
00491361   1/1  ----------------------------------------------------------------------
00441011   1/1  ----------------------------------------------------------------------
00365961   1/1  ----------------------------------------------------------------------
00391971   1/1  ----------------------------------------------------------------------
00490281   1/1  ----------------------------------------------------------------------
00441021   1/1  tvyrPadanelaaalklalestdgpvalrlsrqnl-----------------------------------
00420451   1/1  ----------------------------------------------------------------------
00488971   1/1  ----------------------------------------------------------------------
00427621   1/2  ----------------------------------------------------------------------
00503941   1/1  ----------------------------------------------------------------------
00391991   1/1  -------------------------------------ekgevegvakgayilkaavlreg..advtliat
00414021   1/1  ----------------------------------------------------------------------
00444391   1/1  ----------------------------------------------------------------------
00512711   1/1  ----------------------------------------------------------------------
00424881   1/1  ----------------------------------------------------------------------
00524501   1/1  ----------------------------------------------------------------------
00424111   1/1  ----------------------------------------------------------------------
00427622   2/2  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           GDVPTLETLAAADLLRRHLPELRVRVVNVVDLMRLSNEGEHPHAMTDREYDTLFTRDKPVIFAFHGYPWL
00404121   1/1  ----------------------------------------------------------------------
00491361   1/1  ----------------------------------------------------------------------
00441011   1/1  ----------------------------------------------------------------------
00365961   1/1  ----------------------------------------------------------------------
00391971   1/1  ----------------------------------------------------------------------
00490281   1/1  ----------------------------------------------------------------------
00441021   1/1  ----------------------------------------------------------------------
00420451   1/1  ----------------------------------------------------------------------
00488971   1/1  ----------------------------------------------------------------------
00427621   1/2  ----------------------------------------------------------------------
00503941   1/1  ----------------------------------------------------------------------
00391991   1/1  Gseve.laleAaelLake..gisvrvvslpslkpldeqtieyklevlpktvrlvvvvEagvtlgwlg...
00414021   1/1  ----------------------------------------------------------------------
00444391   1/1  ----------------------------------------------------------------------
00512711   1/1  ----------------------------------------------------------------------
00424881   1/1  ----------------------------------------------------------------------
00524501   1/1  ----------------------------------------------------------------------
00424111   1/1  ----------------------------------------------------------------------
00427622   2/2  ----------------------------------------------------------------gggPtl


                         -         -         -         -         +         -         -:770
query           IHRLTYRRAGHPNLHVRGYKEEGTTTTPFDMVMLNDLDRFHLVMDVIDRVPGLGVRAAGLRQHMQDERLR
00404121   1/1  ----------------------------------------------------------------------
00491361   1/1  ----------------------------------------------------------------------
00441011   1/1  ----------------------------------------------------------------------
00365961   1/1  ----------------------------------------------------------------------
00391971   1/1  ----------------------------------------------------------------------
00490281   1/1  ----------------------------------------------------------------------
00441021   1/1  ----------------------------------------------------------------------
00420451   1/1  ----------------------------------------------------------------------
00488971   1/1  ----------------------------------------------------------------------
00427621   1/2  ----------------------------------------------------------------------
00503941   1/1  ----------------------------------------------------------------------
00391991   1/1  ......yvgleglvlgvdgfgasgpadelleefgltaenivaavke------------------------
00414021   1/1  ----------------------------------------------------------------------
00444391   1/1  ----------------------------------------------------------------------
00512711   1/1  ----------------------------------------------------------------------
00424881   1/1  ----------------------------------------------------------------------
00524501   1/1  ----------------------------------------------------------------------
00424111   1/1  ----------------------------------------------------------------------
00427622   2/2  IeakTykgkglplae.gtlkaHgvpldpeeyralkevlgwplepdpiprlrkyllelgllgeeelaelde


                         -         -         *         -         -         -         -:840
query           CRAYTRQYGEDAPDIRNWVWEP------------------------------------------------
00404121   1/1  ----------------------------------------------------------------------
00491361   1/1  ----------------------------------------------------------------------
00441011   1/1  ----------------------------------------------------------------------
00365961   1/1  ----------------------------------------------------------------------
00391971   1/1  ----------------------------------------------------------------------
00490281   1/1  ----------------------------------------------------------------------
00441021   1/1  ----------------------------------------------------------------------
00420451   1/1  ----------------------------------------------------------------------
00488971   1/1  ----------------------------------------------------------------------
00427621   1/2  ----------------------------------------------------------------------
00503941   1/1  ----------------------------------------------------------------------
00391991   1/1  ----------------------------------------------------------------------
00414021   1/1  ----------------------------------------------------------------------
00444391   1/1  ----------------------------------------------------------------------
00512711   1/1  ----------------------------------------------------------------------
00424881   1/1  ----------------------------------------------------------------------
00524501   1/1  ----------------------------------------------------------------------
00424111   1/1  ----------------------------------------------------------------------
00427622   2/2  elvaivaaapefaee-------------------------------------------------------