[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tmar0:AAD35126.1


[Show Plain Result]

## Summary of Sequence Search
   1::381
 107::244  PF00480 0.0% 33.8345864661654  ROK family 
  18::59   PF09339 0.0% 40.4761904761905  IclR helix-turn-helix domain 
  14::60   PF01978 0.0% 29.7872340425532  Sugar-specific transcriptional regulator TrmB 
  17::58   PF01047 0.0% 42.8571428571429  MarR family 
  14::58   PF01022 0.0% 34.0909090909091  Bacterial regulatory protein, arsR family 
   1::381


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MHKKLNPKSMKRENKKMVLRYLIESGPHSRVEIARKTGLAQSAIWRIIEELVNEGLVEEKGTATGRRRKA
PF00480         ----------------------------------------------------------------------
PF09339         -----------------iLdalaeapqelslselArrtglpkStvhRlLqtLvelGyve-----------
PF01978         -------------yEakvYlaLlkkgpatadeiaeelgvprskvyevLrsLekkGlvere----------
PF01047         ----------------viLrilyesgplsvseLakklgvsrstvtrvldrLEkkGlie------------
PF01022         -------------tRlkIlklLae.gelcvcelaeelglsqstvShHLkkLreaGLVe------------


                         -         -         *         -         -         -         -:140
query           VTYGPTRSFITSIIYNVEVLETLVAVGFLDGAWRIIERFSTPKDFDEFKQRVTSSYENILKSHVLNKNIS
PF00480         ------------------------------------ekvptpttpeellealvdlvekaeeqfgev....
PF09339         ----------------------------------------------------------------------
PF01978         ----------------------------------------------------------------------
PF01047         ----------------------------------------------------------------------
PF01022         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           KVVFSLPGIVNTESKFLIHAPNLGWRNIDFRREFGNLDLEVLVENDSNLSLLAEEFFSQDVKESDVAFFL
PF00480         gvgigvpGivnkdqgtivstPnikwadvdlvkkleerlnvpvvlendanaaalaEkvfgaakdvsnv.iy
PF09339         ----------------------------------------------------------------------
PF01978         ----------------------------------------------------------------------
PF01047         ----------------------------------------------------------------------
PF01022         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           YFGEGIGGAISVNGKIVRGENFAAGEIGHVVLDVKNGKEVEEFLSISKLVERMEKFVELQGESLDEKFRY
PF00480         vtigtGiGaGviingklirGangeaGeighilld------------------------------------
PF09339         ----------------------------------------------------------------------
PF01978         ----------------------------------------------------------------------
PF01047         ----------------------------------------------------------------------
PF01022         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           IKRLWFSGEKNVKETMEEFLQHVAVVLKNIIYFLNPGVIVLGGVVNDLWDTFGSFIKRELEKITDREIAN
PF00480         ----------------------------------------------------------------------
PF09339         ----------------------------------------------------------------------
PF01978         ----------------------------------------------------------------------
PF01047         ----------------------------------------------------------------------
PF01022         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           VLIRDTIFKEISPSLVGGNVLAIEEFLRQIT---------------------------------------
PF00480         ----------------------------------------------------------------------
PF09339         ----------------------------------------------------------------------
PF01978         ----------------------------------------------------------------------
PF01047         ----------------------------------------------------------------------
PF01022         ----------------------------------------------------------------------