[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tmar0:AAD35173.1


[Show Plain Result]

## Summary of Sequence Search
   1::322
   8::320  PF01032 0.0% 42.258064516129  FecCD transport family 
 107::294  PF00950 0.0% 24.4444444444444  ABC 3 transport family 
   1::322


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRKLVFPILILSFLLGIFFGSVPLDPLEVLGVLFGLKENPGVERILSLRIPRVLASFLVGAGLSIVGNSF
PF01032         -------llllllllslllgavkislsdvfeallgkdssleesivlelrlprilaallvGaaLavaGall
PF00950         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           QNLLKNPLVDPYLLGISSGASFGTVVSFYLAETLGISWIYRIPLLSFGFSMIASLLTLLIARKEGRFPVT
PF01032         QtvtrNpLadPsilGissgaalgavlalllf...lslsllalplaaflgallaallvlllskkrggaspl
PF00950         ------------------------------------n....lllgailvgliaavaiellkrksk...lk


                         +         -         -         -         -         *         -:210
query           TIVLSGVVVSTLFSSLTYMTIVLLKRNVTTISMWLFGSFSGSTWEDVLFYLMVVIPFLLYSLIFSKHLNA
PF01032         rliLaGiavsallsaltslllllaneealasilfwllGslsgaswsevllllpllllglllllllarkln
PF00950         edtaiGivlssfl.alglllislikkskvdldsyLfGniltiseedliliaiieavvllllllfykelll


                         -         -         -         +         -         -         -:280
query           MALGEEEAFILGVSVERLKVVTFLFGNLITAFLVSRSGVIGFVGLIVPHISRYLVGPNFLKSVLSSLIVG
PF01032         llalgdetAkslGvnvkrlrllllllaalltavavalvGpIgFvGLvvPhiarllvgarhrkllplsali
PF00950         itfdeelAkveglsvkllkllllilialtvvvalqavGviLvialliiPaatArllakslesllllaill


                         -         *         -         -         -         -         +:350
query           GVLLTLCDTAARTFFSPTELPVGVVTALIGAPFLAFLMKRGV----------------------------
PF01032         GallllladllarlllaptelpvGivtaliGapfflylll------------------------------
PF00950         glvsvvlGlllSyl--------------------------------------------------------