[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tmar0:AAD35255.1


[Show Plain Result]

## Summary of Sequence Search
   1::771
 268::329  PF00561 0.0% 28.9473684210526  alpha/beta hydrolase fold 
   1::771


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSFLKKLLEIVLKRKILFFTLVFISITVFFLLIFFQKEGSLKIGKEGAESGFINLRVEIPPGAFGKQKVL
PF00561         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           KITRLSDEERKLYPDVFVGDLYRVEFADGVDEFALKPIRLKYYFDAKYLRGENYNNLTFAYATEDGGYRI
PF00561         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           IPGSMIGKDERGYYVEAFTYHLSVFGVVLRSAGFQKHGIRLLREAVNSSGPAVLLVPGEDPTFEGVVKDN
PF00561         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           NIWETIFPDRTIMTYEYALYEPRSLAYSEMYRSFIEKEGRRSFIDFESDFLSQEILKYSQYEFDILAHGT
PF00561         ---------------------------------------------------------lkk..ltlvGhSm


                         -         *         -         -         -         -         +:350
query           GGLIVLRMLQRHPEVNNVRKVVLLSTPVQGTNVVNPLYFSSIFYGKDPEVLEDIFGIEWTKLKMLTLHIR
PF00561         GGmialayaaeypd..rvkamvllgtva....................s---------------------


                         -         -         -         -         *         -         -:420
query           NLIDTLGEVVQEILPDSQLVKELGGFSRNDVEIVSICGDTPPYGVDVSGTELERFYPEFVKGRGDGFVSI
PF00561         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           QSCRVGKVEQLSGNFYDLYSREENVAYIRELLKYEVQVFSGFRSDDYEEYLPSKNPELSEESAQKVVEVK
PF00561         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           ETEGTEFPVLPVNILFENFLERIRSLELSSYLSGALVGKEVYIATESGVFAWDKKVLDKKIEFFKKIEDY
PF00561         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           ASFVGEGDIFIIDNIGIKKYAPFPLVGDISDALITRNAIIYARVVPGGVRYYLFRNGAEKLIATSPGTTV
PF00561         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           RMKSENGNYLLITDGEVVAIGSDFKEKGRVLSSLFGEKVKIVDASFKDDAFYILLNDGSIAFVSSSRSET
PF00561         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           KNYGLAVPKKVLNFQGRILVVYDGVILDLSAGKAQRFDRGIIDVFPGNESLFIVFDEKVRVSVEEWWLSK
PF00561         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           D---------------------------------------------------------------------
PF00561         ----------------------------------------------------------------------