[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tmar0:AAD35418.1


[Show Plain Result]

## Summary of Sequence Search
   1::187
  43::137  PF00156 0.0% 35.7894736842105  Phosphoribosyl transferase domain 
   1::187


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIKEILEKTGALMEGHFILSSGKHSSRYVQCARLFEFPEYGDVVGEELAKLLKKYDVETVVGPAMGGVIL
PF00156         ------------------------------------------eagrllaeklreekgkkdvvvGiargGv


                         -         -         *         -         -         -         -:140
query           SYVVARYLKARSLFAERENGVMKLRRGFFVKPGEKVAVVEDVVTTGGSVKEVIELLKEYGANVVCVGSII
PF00156         platelaraLglpldlvrvrkssapassetsrkreaailesrpeedlkgkrvliVDDvlatGgTlra---


                         +         -         -         -         -         *         -:210
query           DRSGGKVDFGVPFESLLKLDLPVYDPEDCPLCKQGIPAEKPGSRGLK-----------------------
PF00156         ----------------------------------------------------------------------