[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tmar0:AAD35545.1


[Show Plain Result]

## Summary of Sequence Search
   1::614
  68::518  PF00496 0.0% 35.5555555555556  Bacterial extracellular solute-binding proteins, fa 
   1::614


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKLFVLFLAVLSVLVLAEVKNPDTIIDATIGEPDTLDPHFAYDTASGEVIYNVYENLIAYKGESLTEFE
PF00496         -------------------------------------------------------------------evv


                         -         -         *         -         -         -         -:140
query           PRLAERWEILDDGKTYKFYIRKGVKFHEGGDLTPEDVEYSFERGLIFDPTAGPMWMLWEALFGVDSLETF
PF00496         paLAeswwevsddgktytfkLRkgvkfsDGtpltAdDvvfslerladpdtasgaaslla...........


                         +         -         -         -         -         *         -:210
query           VEEKIGKPYSELFDENGEPLPEYRDALIKIYTDYIDPAIEVEGDAVVFHLVRPFAPFMYILAQSASWSAV
PF00496         .................................qdivgveavddytvrftlkkpnalflpllaavaaaia


                         -         -         -         +         -         -         -:280
query           LDKEWCIEIGCWDGRADTWWKYHDIRKEDSPLYARMNGTGPFKFVEWDRAQQKVILERNDNYWREPAKIK
PF00496         k....................kakkeddasktlaekpvgtGPYklksfkp.gqkivlerNpdYWgggkpk


                         -         *         -         -         -         -         +:350
query           RVIIWGIDEWSTRRAMFLQGDADICAVPTQYLEQVEGKPGVTVVKGLPELAVTSLHFAWNVPEDSKYIGS
PF00496         ldriefrvipdadaaaaal.qsGeiddvaevppgdlaalkekpgldvlarspgggvtylafNtk......


                         -         -         -         -         *         -         -:420
query           GKLDGNGIPPDFFSDENVRKAFIYAFDYDTFINEVLKGLGRKIPTDLPEGLLGFNEELLNDPDAPHFDIV
PF00496         .............kppfddkrvRqAlayAiDreeivkavlgglatpansllppsspgynpyytkapp...


                         -         -         +         -         -         -         -:490
query           KATEYFKKAWNGEVWKKGFKITLLYNTGNEVRRQAAEMLKAYIEMINPKFKVEVRGVQWPTYLDATKRGE
PF00496         .dpakAkklLaeaGykdgdgggrrkkkllltlllasgdptskaiaeaiqqqlkkiG..ikvevktvdwta


                         *         -         -         -         -         +         -:560
query           VPAFIIGWLADYPDPHNFIFTYYHSAGVYSGRQGENFRKFVSTPHPDLGGRSLDELIEEAIAKTDPAERQ
PF00496         tylaavaegdfdmallgwgadypdpdaf------------------------------------------


                         -         -         -         *         -         -         -:630
query           ALYEEIQRFAMKHALGMPLYQPLGVRVQRSWVKGWYHNPMRPGDDYYVLWKAEE----------------
PF00496         ----------------------------------------------------------------------