[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tmar0:AAD35671.1


[Show Plain Result]

## Summary of Sequence Search
   1::301
  13::130  PF00892 0.0% 30.5084745762712  EamA-like transporter family 
 151::272  PF00892 0.0% 22.6890756302521  EamA-like transporter family 
   1::301


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MILERFFAWLVVVFWGISFLATKVVVQVLDPFFAGFLRFIFAFFFLFLISGGRPKLFNKNIVMAGFWGVF
PF00892         ------------lswaiyfvlskkllesvspltitayrlliagillilllfllrepialislkdilalll
PF00892         ------------lswaiyfvlskkllesvspltitayrlliagillilllfllrepialislkdilalll


                         -         -         *         -         -         -         -:140
query           SYFAFENSALMFTEPTNAAIIVSSAPVFFLLFSHLVQKKKTTSKMYLGVILSFLGVALVVLNGRFVLKLN
PF00892         lgllgtvlgyllffyalkktsasnaslitslePvftillsvlllgekltlkqllgivlil----------
PF00892         lgllgtvlgyllffyalkktsasnaslitslePvftillsvlllgekltlkqllgivlil----------


                         +         -         -         -         -         *         -:210
query           PLGDLLAFGAALSWVFYTHHIESLGSLSFRENAGIMFWGVVFFLPFSAGKFQQIREMNSIVVISLLYLGL
PF00892         ----------aiyfvlskkllesvsplti..tayrlliagi.llilllfllrepialislkdilallllg
PF00892         ----------aiyfvlskkllesvsplti..tayrlliagi.llilllfllrepialislkdilallllg


                         -         -         -         +         -         -         -:280
query           VCSGLAYFLWNKAIERLGSRTTTNMIYYIPVVTAVAEHLLKLKLPSALLVGGVVLVVIGLLIFEREVHYE
PF00892         llgtvlgyllffyalkktsasnaslitslePvftillsvlllgekltlkqllgivlillGvl--------
PF00892         llgtvlgyllffyalkktsasnaslitslePvftillsvlllgekltlkqllgivlillGvl--------


                         -         *         -         -         -         -         +:350
query           TEDSTRGMRKDRTEETRPSAD-------------------------------------------------
PF00892         ----------------------------------------------------------------------
PF00892         ----------------------------------------------------------------------