[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tmar0:AAD35678.1


[Show Plain Result]

## Summary of Sequence Search
   1::246
  31::245  PF00497 0.0% 48.3720930232558  Bacterial extracellular solute-binding proteins, fa 
  68::97   PF09084 0.0% 30  NMT1/THI5 like 
 116::183  PF09084 0.0% 25.7575757575758  NMT1/THI5 like 
   1::246


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKLLAVSILLVSIVIFSGAIDEIKSRGYLLVGLSADFPPFEFVDENGNIVGFDVDLAKEIARRLGVELK
PF00497         ------------------------------kvgtdadypPfsfkdengklsGfdvdlakaiakrlgvkle
PF09084         -------------------------------------------------------------------dvt
PF09084         -------------------------------------------------------------------dvt


                         -         -         *         -         -         -         -:140
query           IVDMTFDGLIPSLLTKKIDVIISGMTITEERKKVVAFSDPYFDAGQVIVVRKDSDFRPKTYEDLVGKTVA
PF00497         fvevsfddlipalesgkvDiaiaaisitpeRekkvdFsqpyftaglvilvrkkdakkissiksladLkgk
PF09084         lvnvggtslakalltgkvDaviggyen------------------nglivlkdsgik..spkDLkGkrig
PF09084         lvnvggtslakalltgkvDaviggyen------------------nglivlkdsgik..spkDLkGkrig


                         +         -         -         -         -         *         -:210
query           VQIGTTGDIEVSKYDGIKVVRFDKFTDAFLELKRGRADAVVLDSATARAFVAKNPDLVISSGVLSSEQYG
PF00497         kvgvqagttaedllkeelkkgakvveyddleealaaLaagrvdavvadspvlaylvkknggkklvvvdep
PF09084         ysgsefekallkallkkaGidpsdvtlvnvggtslakalltgk---------------------------
PF09084         ysgsefekallkallkkaGidpsdvtlvnvggtslakalltgk---------------------------


                         -         -         -         +         -         -         -:280
query           IAVRKEDTDLLEFINSVLRELKKSPYDVLIEKWFSE----------------------------------
PF00497         legeeyaiavrkgdseLrkainkalaelkedgtld-----------------------------------
PF09084         ----------------------------------------------------------------------
PF09084         ----------------------------------------------------------------------