[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tmar0:AAD35750.1


[Show Plain Result]

## Summary of Sequence Search
   1::377
  13::373  PF01041 0.0% 40.0568181818182  DegT/DnrJ/EryC1/StrS aminotransferase family 
  35::271  PF01212 0.0% 27.906976744186  Beta-eliminating lyase 
  38::128  PF01053 0.0% 31.3953488372093  Cys/Met metabolism PLP-dependent enzyme 
   1::377


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIPLFDLTRQYERIRGEILNAIDKLISSGNVILGENVRRLEEEIASFTGVKHGVGVASGSDALLIALRAM
PF01041         ------------sideeelaaveevlksgwltttgkeveeFEkafaeylgvkhavavssGtaAlllaLra
PF01212         ----------------------------------ktvarledavaellgkeaalfvpsGtaAnqialsal
PF01053         -------------------------------------evleeriaaLeggeaalavsSGmaAiaaallal


                         -         -         *         -         -         -         -:140
query           GVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVLKKEKVKAIIPVHLFGRTVDL
PF01041         lgigpGdeVIvpsltfvAtanavlqlGakpvfvDvdpetlnldpaaieaaitp.rtkaIlpVhlyGqpad
PF01212         lqreeevvvtepshihfdetgaikel.ggvklvtlknkeagkldleklealikevgaheenialisltit
PF01053         .lkaGdevvatddlYggtqrllekvlkk.lgvev..kfvdtsdleelekaikp.ntkl------------


                         +         -         -         -         -         *         -:210
query           EALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVGDAAIFSFFPTKNLGTYGDGGMIVTNSDEIA
PF01041         mdairaiaaehglkvieDaAqAlGatykG.....kkvGtlgdaatfSffptKnl.ttgeGGavvtdDpel
PF01212         nntaGGqvvsleelreiaeiakeygiplhlDgARlaeaa.kslgeiakeiasyaDsvtisl..kKdlgan
PF01053         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           EESRILRVHGARKKYFHEKVGYNSRLDEIHAAILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVYPR
PF01041         aeraralrnhGlkrkaeeryreevslGynlrltelqAavglaqLekldeliarrreiaelykeelaelpg
PF01212         vG.gilafrdk.................flaeaveqrkylggglrqaGvlaalelyleagl---------
PF01053         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           VEEKGFRYHVFHQYVVLFENEEVRERVREGLKERGIQTAIYYPLPLHLQKCFRDLGYQEGDFPVAESLSK
PF01041         leelteptees..eaawhlfpvllkeeaavsrdelvealkeegigtrvhytnplhaqpvyeerkkeaage
PF01212         ----------------------------------------------------------------------
PF01053         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           RSLALPMFPELRDDEIKEVVDTIALFL-------------------------------------------
PF01041         lpnaerlaeevlslplypeltee-----------------------------------------------
PF01212         ----------------------------------------------------------------------
PF01053         ----------------------------------------------------------------------