[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tmar0:AAD35944.1


[Show Plain Result]

## Summary of Sequence Search
   1::355
   3::236  PF00483 0.0% 32.9059829059829  Nucleotidyl transferase 
 237::318  PF07959 0.0% 20.7792207792208  L-fucokinase 
   1::355


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKAIVLCAGKGTRLRPLTFTTAKHLIPIANKPILFYSLENIARAGIEEVGIVVSPHNAEEFKSIVGTGE
PF00483         --kavILaGGsGtRLwPltrtlakklvpvlgkerliqytlsrlansgieeiivvltqehrflvaeqlreg
PF07959         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           NFGLRISYIIQEEPKGLAHAVWVSREFLGDEDFMMYLGDNLILEDLGKFVKDFENSDYAASILLSPVKDP
PF00483         sklgvevlialepegrgtAdAvalaaelledeksdelvlvLagDhlikdayeeavkkaiekaadgtvtfg
PF07959         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           TRFGVAVMEGDRVIKVVEKPKTPPSNLAIVGLYLFRNKIFEGIKNIKPSWRGELEITDAIEYLIEKGEKV
PF00483         ivpveeatgYGvieideegrverfvEKPkeakaselassgiYvfnsgvllflakyleelkrgedeitdil
PF07959         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           RGYIVYGWWKDTGKPEDLLEANRKILMETTEELLGEMDDKSSIQGPVRIGKASKIVNSVIRGPAVIGENC
PF00483         paaleegkealaflrkgeayWsDvGt--------------------------------------------
PF07959         --------------------------fgTsaEvLdhltsdaskl....rvarrk.lssspaitvediaat


                         -         *         -         -         -         -         +:350
query           FIKNSYVGPYSSIGNRVILEDCEVENSIVMDECSITGVEKRIDSSILGKGVSVKGSQKRPASLNLILGNM
PF00483         ----------------------------------------------------------------------
PF07959         svilssllesgvsvgedslvedsrlggevriGsqcivs--------------------------------


                         -         -         -         -         *         -         -:420
query           SRVEL-----------------------------------------------------------------
PF00483         ----------------------------------------------------------------------
PF07959         ----------------------------------------------------------------------