[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tmar0:AAD36098.1


[Show Plain Result]

## Summary of Sequence Search
   1::422
   7::325  PF07690 0.0% 25.6410256410256  Major Facilitator Superfamily 
 218::409  PF07690 0.0% 23.121387283237  Major Facilitator Superfamily 
  29::175  PF00083 0.0% 29.3706293706294  Sugar (and other) transporter 
  11::174  PF11700 0.0% 20.1219512195122  Vacuole effluxer Atg22 like 
 288::409  PF11700 0.0% 18.5840707964602  Vacuole effluxer Atg22 like 
  32::397  PF05977 0.0% 26.3005780346821  Bacterial protein of unknown function (DUF894) 
   3::84   PF03137 0.0% 18.2926829268293  Organic Anion Transporter Polypeptide (OATP) family 
  89::149  PF03137 0.0% 21.3114754098361  Organic Anion Transporter Polypeptide (OATP) family 
   1::422


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAVIFILILMVLLNADQMVMSPNIGAIEQEFNITDAQIGLVASSFTVIGALVSLVWGYLADRYSRKNLLI
PF07690         ------llaaflaalarsilgpalplalaedlgispseigwlltlyslgyaiasllaGrlsdrfGrrrvl
PF07690         ------llaaflaalarsilgpalplalaedlgispseigwlltlyslgyaiasllaGrlsdrfGrrrvl
PF00083         ----------------------------e....ssvlsglivssflvgaliGslfaglladrfGRkksll
PF11700         ----------llsdgiatvsslavlfaktelgmstaalivlsilatlaavlGaflwsalsrrfglktkqt
PF11700         ----------llsdgiatvsslavlfaktelgmstaalivlsilatlaavlGaflwsalsrrfglktkqt
PF05977         -------------------------------sasplmValvqaaatLPifllsllaGvlaDnldrRkvll
PF03137         --llllglaaliqllvnaylkssittiEkrFklsssksGlisslydignllliifvsYfgsrvhrprlig
PF03137         --llllglaaliqllvnaylkssittiEkrFklsssksGlisslydignllliifvsYfgsrvhrprlig


                         -         -         *         -         -         -         -:140
query           YSILVGEIPCLMSAFSRSYGELFFWRALTGIGVGASFPIVYSMIGDMFDEVKRGKVVALISSAISIGSVL
PF07690         llglllfalglllllfasslwalllvlrvlqGlgagalfpagaaliadwfpkeergralgllsagfslGa
PF07690         llglllfalglllllfasslwalllvlrvlqGlgagalfpagaaliadwfpkeergralgllsagfslGa
PF00083         valvlfvigavlqaaakakksvwvlivgRvivGlgvGlisvlvPmyisEiApkklrgalgslyqlaitvG
PF11700         iiaiivlfeliplyGllGfipavlGlqqpwemyvlavlyglvlgglssysrsmfseliPrGkeaaFFaLf
PF11700         iiaiivlfeliplyGllGfipavlGlqqpwemyvlavlyglvlgglssysrsmfseliPrGkeaaFFaLf
PF05977         vvqlllllasvlltvlaalgllspwlllaltfllgiGaalnapaWqasvgelvkrddvpaAvaLnsvgvN
PF03137         iGlllmalgsllla----lllllvaqllsGiGatplvtlGisYiDdnvkskksplylgilyalavlGPai
PF03137         iGlllmalgsllla----lllllvaqllsGiGatplvtlGisYiDdnvkskksplylgilyalavlGPai


                         +         -         -         -         -         *         -:210
query           GMIVGGFLGPKYGWRVPFIAVSVPNIFFAVLSIFVLKEPKRGAFEKGIGELVQSGYEYPKAPKLSDYAKL
PF07690         ilgpllggllasslgWravFlilailsllaavlvllllprepperkrkspaeel.......rkepaplvp
PF07690         ilgpllggllasslgWravFlilailsllaavlvllllprepperkrkspaeel.......rkepaplvp
PF00083         ilvaaiiglglnktsnadgwrillglqlvpallll-----------------------------------
PF11700         aitdkgssviGpllvglitdrtgniriaflflav------------------------------------
PF11700         aitdkgssviGpllvglitdrtgniriaflflav------------------------------------
PF05977         iaRsvGPAlgGvlvaavgaalafavnalsylavivalarwkrevrksalprEkllaalraglRytaa...
PF03137         Gfllgsvll-------------------------------------------------------------
PF03137         Gfllgsvll-------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           VKVKTNLLLFFQGIAGTIPWGAIPYFLVEFFRRERGLSVETATLVFLVFGLGNIVGIILGGLWGASIYAK
PF07690         awklllkaaflaalarsilgpalplal....aedlgispseigwlltlyslgyaiasllaGrlsdr.f.G
PF07690         awklllkaaflaalarsilgpalplal....aedlgispseigwlltlyslgyaiasllaGrlsdr.f.G
PF00083         ----------------------------------------------------------------------
PF11700         ----------------------------------------------------------------------
PF11700         ----------------------------------------------------------------------
PF05977         Srelksvlvra..alFgl.sasav.laLLP..lv..ardelggdalvyGillgalG....aGAvlgalll
PF03137         ----------------------------------------------------------------------
PF03137         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           SRPFLPLFCSITTALGTFFTVMTLDYMGSLLVLMLLGFIASFTASLTGPNVKFMLLNVNEPQERGRIFSI
PF07690         rrr.vlllglllfalglllll.fa....sslwalllvlrvlqGlgagalfpagaaliadwfpkeergral
PF07690         rrr.vlllglllfalglllll.fa....sslwalllvlrvlqGlgagalfpagaaliadwfpkeergral
PF00083         ----------------------------------------------------------------------
PF11700         -------liplyGllGfipavlGlqqpwe...myvlavlyglvlgglssysrsmfseliPrGkeaaFFaL
PF11700         -------liplyGllGfipavlGlqqpwe...myvlavlyglvlgglssysrsmfseliPrGkeaaFFaL
PF05977         srlrrrlsserlvllaavalAlvllslalssslwvavlvlllgG..aaWiaalstlnvavqlavpr..Wv
PF03137         ----------------------------------------------------------------------
PF03137         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           FNLTDSLGTGFGKFAGGVMSVALGSLGAALKVSAYFWLICAVLLFVLVFYFAKDVERLQKTMIELAKNSQ
PF07690         gllsagfslGailgpllggllasslg.......WravFlilailsllaavlvllllpre-----------
PF07690         gllsagfslGailgpllggllasslg.......WravFlilailsllaavlvllllpre-----------
PF00083         ----------------------------------------------------------------------
PF11700         faitdkgssviGpllvglitdrtgniria......flflavLlvlplpllllvdvergr-----------
PF11700         faitdkgssviGpllvglitdrtgniria......flflavLlvlplpllllvdvergr-----------
PF05977         rgRalsvYltvlaGglaaGsllWGtvaeal.slelaLllaavalllg-----------------------
PF03137         ----------------------------------------------------------------------
PF03137         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           TR--------------------------------------------------------------------
PF07690         ----------------------------------------------------------------------
PF07690         ----------------------------------------------------------------------
PF00083         ----------------------------------------------------------------------
PF11700         ----------------------------------------------------------------------
PF11700         ----------------------------------------------------------------------
PF05977         ----------------------------------------------------------------------
PF03137         ----------------------------------------------------------------------
PF03137         ----------------------------------------------------------------------