[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tmar0:AAD36283.1


[Show Plain Result]

## Summary of Sequence Search
   1::70
   1::70


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MMLIAAFFAVEARKILDSVIAFSSLSLLSVFLFIIMKAPDVAITEASVGAGLTTAVLLITLFKMGKDDER