[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tmar0:AAD36465.1


[Show Plain Result]

## Summary of Sequence Search
   1::290
   6::274  PF01430 0.0% 41.8867924528302  Hsp33 protein 
 149::196  PF01886 0.0% 25.531914893617  Protein of unknown function DUF61 
 243::281  PF01886 0.0% 28.9473684210526  Protein of unknown function DUF61 
   1::290


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIYYGTMFDHKVRFSIVRMREVVEEARNRHALSYLATVVLGRALIGAALVTPWLAEKERWTLDIEGNGPI
PF01430         -----llensdvRgelvrltkvvqeilkrhnyppavaallGealaaaallastlkfegrltlqiqgdgpv
PF01886         ----------------------------------------------------------------------
PF01886         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           RRVVAQSTSEFTVRGYVANPKVELPLNEKGKFDVAGAIGQGVLRVVRDLGLKTPFVSQVPLVSGEIAEDL
PF01430         kllvaeadadgevRGyarlarnpevdlapleedg..dvkellgkkGilavtkdlgegepyqGiVplegge
PF01886         ----------------------------------------------------------------------
PF01886         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           AYYFAVSEQIPSAFSIGVLVDSDGVKIAGGFAVQIIDRTLEQEKVEMIEKNIKNLPSISKLFQEAEPLDV
PF01430         laedlehYfaqSeQiptairlavklksdnnveragGlllQlLPgaedeeewerleelle..tliseellk
PF01886         --------rlPiileidstlgegevvirgkeevkviskllgleee.lleekilrly--------------
PF01886         --------rlPiileidstlgegevvirgkeevkviskllgleee.lleekilrly--------------


                         -         -         -         +         -         -         -:280
query           LERIFGEKVGFVETAEIKYKCDCNREKAKNALLVLDKKELEDMRKEGKGEVVCKWCNTRYVFSEEELEEL
PF01430         eglsieellkrLfheeevriletqpvrfkCsCsrervkdaLlslgkeelkelleengkievtCe------
PF01886         --------------------------------lpserktLkelLkeekpkiilr.dGsrhrikrdeLell
PF01886         --------------------------------lpserktLkelLkeekpkiilr.dGsrhrikrdeLell


                         -         *         -         -         -         -         +:350
query           LKFKVDDSGS------------------------------------------------------------
PF01430         ----------------------------------------------------------------------
PF01886         k---------------------------------------------------------------------
PF01886         k---------------------------------------------------------------------